F378344

General Info

Members Datasets Scaffolds Average Seq Length
272 199 260 284

Family's Representative Sequence

Representative Sequence 3300009988|Ga0105035_102452|Ga0105035_1024521
Length 331
Sequence LSRLVFHPLPAILRQKPACFKKLSVASKVAATKRKRQLVVEPLIVGLLLAAALMHASWNAILKSDQSDRLATFGVIMSTGTVMGLFIVPFVPMIEPGAWKYLVSSVLIHGAYYYFLLKAYSYGDLSHTYPIARGLGPLLVALVSGRFIGEHLRTQDIVGVLLLSFGLIALAMPLKAAAPRPGARHGLATLFAMLTGVTIAGYIIADGLGVRAAGPTFEHRISYIGWLAVLEGPWLLVLAIALRPGTVWVHLRSKWYRGVIGGLIANTGYGIAIYALALGPMAHVAALRETSVLFGALMGTLLLGEPFGVRRVAAAFVIVAGLVLMNGPQIL

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 2751185800 Brucella pituitosa AA2 Isolate Unclassified
7 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
8 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
9 2854911287 Brucella lupini LUP21 Isolate Unclassified
10 2857558681 Duganella sp. R-74565 Isolate Unclassified
11 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
12 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
196 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.22
Metatranscriptomes 0.37
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.13
Nodule 0
Rhizoplane 0.37
Rhizosphere 78.68
Stem 0
Stem Tuber 0.37
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10175999 3300003320 Bacteria 4843
2 rootH1_10172993 3300003323 Bacteria 3050
3 Ga0070690_100058636 3300005330 Bacteria 2473
4 Ga0070690_100343791 3300005330 Bacteria 1081
5 Ga0068869_100222322 3300005334 Bacteria 1497
6 Ga0070689_100070330 3300005340 Bacteria 2732
7 Ga0070691_10003953 3300005341 Bacteria 6703
8 Ga0070671_100057594 3300005355 Bacteria 3234
9 Ga0070667_100156575 3300005367 Bacteria 2004
10 Ga0070667_100451994 3300005367 Bacteria 1174
11 Ga0070714_100159486 3300005435 Bacteria 2040
12 Ga0070694_100139311 3300005444 Bacteria 1760
13 Ga0070694_100272781 3300005444 Bacteria 1287
14 Ga0070662_100227068 3300005457 Bacteria 1492
15 Ga0070681_10004738 3300005458 Bacteria 13025
16 Ga0070706_100122199 3300005467 Bacteria 2427
17 Ga0070707_100115288 3300005468 Bacteria 2607
18 Ga0070698_100000587 3300005471 Bacteria 39046
19 Ga0070699_100114040 3300005518 Bacteria 2374
20 Ga0070679_100006716 3300005530 Bacteria 10730
21 Ga0070684_100081465 3300005535 Bacteria 2864
22 Ga0070697_100283777 3300005536 Bacteria 1421
23 Ga0070686_100032920 3300005544 Bacteria 3182
24 Ga0070695_100116534 3300005545 Bacteria 1821
25 Ga0070665_100052713 3300005548 Bacteria 4079
26 Ga0070665_100223233 3300005548 Bacteria 1885
27 Ga0068855_100046720 3300005563 Bacteria 5117
28 Ga0070664_100056219 3300005564 Bacteria 3343
29 Ga0068857_100104322 3300005577 Bacteria 2545
30 Ga0068856_100051005 3300005614 Bacteria 4080
31 Ga0068859_100686841 3300005617 Bacteria 1115
32 Ga0068858_100061316 3300005842 Bacteria 3477
33 Ga0081455_10000268 3300005937 Bacteria 68637
34 Ga0081455_10003029 3300005937 Bacteria 19581
35 Ga0081455_10012349 3300005937 Bacteria 8522
36 Ga0081539_10001802 3300005985 Bacteria 33905
37 Ga0081539_10013689 3300005985 Bacteria 6092
38 Ga0075368_10004780 3300006042 Bacteria 4613
39 Ga0075363_100111199 3300006048 Bacteria 1523
40 Ga0075363_100298311 3300006048 Bacteria 935
41 Ga0075364_10106107 3300006051 Bacteria 1872
42 Ga0075362_10002937 3300006177 Bacteria 5849
43 Ga0075362_10067850 3300006177 Bacteria 1624
44 Ga0075367_10036363 3300006178 Bacteria 2855
45 Ga0075367_10058154 3300006178 Bacteria 2300
46 Ga0075369_10011462 3300006186 Bacteria 3488
47 Ga0097621_100012978 3300006237 Bacteria 6192
48 Ga0075370_10164499 3300006353 Bacteria 1303
49 Ga0075370_10172446 3300006353 Bacteria 1272
50 Ga0075434_100791058 3300006871 Unclassified 965
51 Ga0097620_100686885 3300006931 Bacteria 1115
52 Ga0075435_100092486 3300007076 Bacteria 2498
53 Ga0099794_10112777 3300007265 Bacteria 1363
54 Ga0105240_10044690 3300009093 Bacteria 5626
55 Ga0111539_10372611 3300009094 Unclassified 1662
56 Ga0105245_10002397 3300009098 Bacteria 16940
57 Ga0105241_10228778 3300009174 Bacteria 1567
58 Ga0105248_10129288 3300009177 Bacteria 2849
59 Ga0105238_10140136 3300009551 Bacteria 2395
60 Ga0105035_102452 3300009988 Bacteria 1368
61 Ga0105246_10298694 3300011119 Bacteria 1299
62 Ga0157373_10194169 3300013100 Bacteria 1431
63 Ga0157371_10348071 3300013102 Bacteria 1078
64 Ga0157370_10470286 3300013104 Bacteria 1155
65 Ga0157369_10162939 3300013105 Bacteria 2353
66 Ga0157374_10143920 3300013296 Bacteria 2315
67 Ga0157378_10641325 3300013297 Bacteria 1077
68 Ga0157376_10182709 3300014969 Bacteria 1918
69 Ga0206353_10936629 3300020082 Bacteria 2507
70 Ga0213874_10044898 3300021377 Unclassified 1336
71 Ga0213876_10013526 3300021384 Bacteria 4331
72 Ga0207426_1013454 3300025302 Bacteria 3031
73 Ga0207647_10176079 3300025904 Bacteria 1244
74 Ga0207643_10117081 3300025908 Bacteria 1575
75 Ga0207654_10213288 3300025911 Bacteria 1277
76 Ga0207707_10041778 3300025912 Bacteria 4004
77 Ga0207695_10064478 3300025913 Bacteria 3772
78 Ga0207649_10213573 3300025920 Bacteria 1370
79 Ga0207694_10127621 3300025924 Bacteria 2036
80 Ga0207687_10005765 3300025927 Bacteria 8196
81 Ga0207700_10112379 3300025928 Bacteria 2194
82 Ga0207670_10363125 3300025936 Bacteria 1149
83 Ga0207665_10174614 3300025939 Bacteria 1553
84 Ga0207661_10208929 3300025944 Bacteria 1719
85 Ga0207679_10019946 3300025945 Bacteria 4515
86 Ga0207667_10344878 3300025949 Bacteria 1519
87 Ga0207651_10275018 3300025960 Bacteria 1389
88 Ga0207640_10022422 3300025981 Bacteria 3779
89 Ga0207677_10005640 3300026023 Bacteria 6805
90 Ga0207703_10022150 3300026035 Bacteria 4981
91 Ga0207702_10029520 3300026078 Bacteria 4563
92 Ga0207648_10528192 3300026089 Bacteria 1082
93 Ga0207674_10225831 3300026116 Bacteria 1821
94 Ga0207683_10014041 3300026121 Bacteria 6829
95 Ga0268266_10101426 3300028379 Bacteria 2537
96 Ga0268266_10135912 3300028379 Bacteria 2202
97 Ga0268264_10068064 3300028381 Bacteria 3008
98 Ga0307408_100573786 3300031548 Bacteria 999
99 Ga0316575_10074646 3300031665 Bacteria 1365
100 Ga0265314_10114652 3300031711 Bacteria 1707
101 Ga0265314_10156372 3300031711 Unclassified 1392
102 Ga0265342_10142807 3300031712 Bacteria 1334
103 Ga0373934_0064421 3300035086 Bacteria 1463
104 Ga0373944_0001521 3300035089 Bacteria 5876
105 Ga0373953_0191044 3300035117 Unclassified 884
106 Ga0316574_0136524 3300035398 Bacteria 1579
107 Ga0373931_0236463 3300035691 Bacteria 1106
108 Ga0373935_0022204 3300035692 Bacteria 3889
109 Ga0373935_0272861 3300035692 Bacteria 1189
110 Ga0373927_0090175 3300035695 Bacteria 1991
111 Ga0373933_0054204 3300035724 Bacteria 2403
112 Ga0373947_0030118 3300035725 Bacteria 3188
113 Ga0373937_0031257 3300036401 Bacteria 4823
114 Ga0373925_0020061 3300037068 Bacteria 4864
115 Ga0373925_0086152 3300037068 Bacteria 2396
116 Ga0395899_0031821 3300037312 Bacteria 3963
117 Ga0395900_0013272 3300037418 Bacteria 8422
118 Ga0395900_0013406 3300037418 Bacteria 8374
119 Ga0395900_0019585 3300037418 Bacteria 6900
120 Ga0395900_0126315 3300037418 Bacteria 2623
121 Ga0395898_0060305 3300037466 Bacteria 3687
122 Ga0395898_0069891 3300037466 Bacteria 3396
123 Ga0395901_0005326 3300038443 Bacteria 12998
124 Ga0395901_0017426 3300038443 Bacteria 7332
125 Ga0395901_0097023 3300038443 Bacteria 3089
126 Ga0395901_0331617 3300038443 Bacteria 1573
127 Ga0436365_0088563 3300039437 Bacteria 10412
128 Ga0436363_1025691 3300039450 Archaea 2690
129 Ga0436363_1543659 3300039450 Bacteria 8452
130 Ga0436362_0501941 3300039453 Bacteria 1416
131 Ga0439448_0063991 3300042005 Bacteria 1219
132 Ga0466961_0030398 3300044693 Bacteria 3471
133 Ga0466963_0013352 3300044694 Bacteria 5043
134 Ga0466963_0036760 3300044694 Bacteria 3194
135 Ga0466963_0181343 3300044694 Bacteria 1470
136 Ga0466963_0310807 3300044694 Unclassified 1109
137 Ga0466971_0111024 3300044719 Bacteria 1265
138 Ga0466960_0068162 3300044901 Bacteria 1764
139 Ga0466960_0237158 3300044901 Bacteria 1009
140 Ga0466967_0296216 3300045976 Bacteria 1555
141 Ga0466967_0519692 3300045976 Bacteria 1170
142 Ga0495592_0051723 3300046454 Bacteria 3051
143 Ga0495592_0052711 3300046454 Bacteria 3020
144 Ga0495641_0028687 3300046461 Bacteria 2690
145 Ga0495651_0007006 3300046462 Bacteria 8624
146 Ga0495664_0048130 3300046477 Bacteria 2531
147 Ga0495585_0009551 3300046492 Bacteria 5807
148 Ga0495607_0064554 3300046501 Bacteria 2067
149 Ga0495608_0039521 3300046511 Bacteria 3162
150 Ga0495616_0017410 3300046513 Bacteria 3964
151 Ga0495620_0065399 3300046515 Bacteria 1501
152 Ga0495637_0034823 3300046520 Bacteria 2203
153 Ga0495663_0011326 3300046525 Bacteria 2483
154 Ga0495652_0091841 3300046529 Bacteria 2481
155 Ga0495633_0023253 3300046558 Bacteria 3072
156 Ga0495656_0005367 3300046615 Bacteria 4420
157 Ga0495659_0012711 3300046664 Bacteria 2732
158 Ga0495599_0169540 3300046678 Unclassified 1347
159 Ga0495613_0160220 3300046689 Unclassified 1601
160 Ga0495670_0108280 3300046691 Bacteria 1436
161 Ga0495674_0210105 3300047319 Unclassified 1612
162 Ga0495680_0074585 3300047322 Bacteria 2576
163 Ga0495677_0013199 3300047445 Bacteria 3006
164 Ga0496106_0000007 3300048909 Bacteria 248548
165 Ga0496118_0018535 3300048921 Bacteria 6274
166 Ga0496119_0004467 3300048922 Bacteria 13916
167 Ga0496120_0116295 3300048923 Bacteria 1389
168 Ga0496121_0003981 3300048924 Bacteria 20377
169 Ga0496122_0070847 3300048925 Bacteria 2487
170 Ga0496125_0000017 3300048928 Bacteria 508217
171 Ga0496126_0000065 3300048929 Bacteria 252549
172 Ga0501032_0162550 3300049569 Bacteria 1466
173 Ga0501034_0000031 3300049571 Bacteria 244022
174 Ga0501034_0001770 3300049571 Bacteria 27609
175 Ga0501034_0007391 3300049571 Bacteria 11700
176 Ga0501034_0102793 3300049571 Bacteria 2851
177 Ga0501034_0109693 3300049571 Bacteria 2751
178 Ga0501034_0231003 3300049571 Bacteria 1799
179 Ga0501034_0307303 3300049571 Bacteria 1521
180 Ga0501036_0014329 3300049572 Bacteria 6599
181 Ga0501037_0003468 3300049573 Bacteria 11448
182 Ga0501037_0103190 3300049573 Bacteria 2057
183 Ga0501039_0000745 3300049575 Bacteria 23419
184 Ga0501043_0023134 3300049579 Bacteria 4875
185 Ga0501046_0000503 3300049580 Bacteria 39054
186 Ga0501047_0000175 3300049581 Bacteria 78925
187 Ga0501047_0081732 3300049581 Bacteria 3106
188 Ga0501047_0245518 3300049581 Bacteria 1640
189 Ga0501047_0409606 3300049581 Bacteria 1188
190 Ga0501048_0069143 3300049582 Bacteria 2494
191 Ga0501048_0071238 3300049582 Bacteria 2454
192 Ga0501067_0002375 3300049583 Bacteria 10423
193 Ga0501067_0004393 3300049583 Bacteria 7769
194 Ga0501068_0038140 3300049584 Bacteria 2878
195 Ga0501069_0010005 3300049585 Bacteria 5014
196 Ga0501069_0059593 3300049585 Bacteria 2130
197 Ga0501069_0144145 3300049585 Bacteria 1367
198 Ga0501070_0017205 3300049586 Bacteria 6069
199 Ga0501070_0018265 3300049586 Bacteria 5883
200 Ga0501070_0204329 3300049586 Unclassified 1622
201 Ga0501070_0270762 3300049586 Bacteria 1387
202 Ga0501071_0018219 3300049587 Bacteria 4858
203 Ga0501071_0133971 3300049587 Bacteria 1842
204 Ga0501073_0060948 3300049589 Bacteria 2633
205 Ga0501073_0162158 3300049589 Bacteria 1549
206 Ga0501073_0271656 3300049589 Bacteria 1170
207 Ga0501073_0324674 3300049589 Bacteria 1062
208 Ga0501074_0063957 3300049590 Bacteria 2649
209 Ga0501074_0114323 3300049590 Bacteria 1931
210 Ga0501076_0011401 3300049592 Bacteria 6618
211 Ga0501076_0190423 3300049592 Bacteria 1674
212 Ga0501079_0072081 3300049741 Bacteria 2669
213 Ga0501080_0000020 3300049742 Bacteria 91998
214 Ga0501080_0077838 3300049742 Bacteria 3085
215 Ga0501080_0249293 3300049742 Bacteria 1619
216 Ga0501080_0358830 3300049742 Bacteria 1315
217 Ga0501081_0052097 3300049743 Bacteria 2823
218 Ga0501083_0177747 3300049744 Bacteria 1390
219 Ga0501035_0000077 3300049822 Bacteria 121242
220 Ga0501035_0017938 3300049822 Bacteria 6526
221 Ga0501035_0077758 3300049822 Bacteria 2932
222 Ga0501035_0458201 3300049822 Unclassified 1054
223 Ga0501044_0000013 3300049823 Bacteria 248795
224 Ga0501044_0234341 3300049823 Bacteria 1782
225 Ga0501044_0243788 3300049823 Bacteria 1740
226 Ga0501044_0375888 3300049823 Bacteria 1337
227 Ga0501044_0537707 3300049823 Bacteria 1067
228 Ga0501044_0811954 3300049823 Bacteria 814
229 Ga0501045_0045690 3300049824 Bacteria 3188
230 Ga0501045_0060214 3300049824 Bacteria 2783
231 nmdc:mga03683_726_c1 3300050489 Bacteria 7429
232 nmdc:mga03683_74059_c1 3300050489 Bacteria 1460
233 nmdc:mga03683_7827_c1 3300050489 Bacteria 3729
234 nmdc:mga00v17_287987_c1 3300050491 Bacteria 1066
235 nmdc:mga00v17_41486_c1 3300050491 Bacteria 2764
236 nmdc:mga0yw44_232303_c1 3300050492 Bacteria 1224
237 nmdc:mga0yw44_76557_c1 3300050492 Bacteria 2088
238 nmdc:mga06z11_30428_c1 3300050494 Bacteria 2612
239 nmdc:mga07m45_137191_c1 3300050496 Bacteria 1416
240 nmdc:mga07m45_161005_c1 3300050496 Bacteria 1303
241 nmdc:mga07m45_215494_c1 3300050496 Bacteria 1117
242 nmdc:mga0n895_109002_c1 3300050512 Bacteria 2784
243 nmdc:mga0rr50_28421_c1 3300050513 Bacteria 3931
244 nmdc:mga0sz30_18934_c1 3300050516 Bacteria 2760
245 nmdc:mga0sz30_5803_c2 3300050516 Bacteria 4102
246 Ga0495595_0029810 3300053084 Bacteria 2444
247 Ga0495619_0072406 3300053085 Bacteria 2308
248 Ga0500651_0035948 3300053093 Bacteria 3122
249 Ga0500641_0066801 3300053096 Bacteria 1506
250 Ga0500593_010922 3300053117 Bacteria 3822
251 Ga0500642_0110952 3300053130 Bacteria 1280
252 Ga0500568_0006831 3300053139 Bacteria 5684
253 Ga0500616_0001772 3300053153 Bacteria 19731
254 Ga0500609_006224 3300053731 Bacteria 1627
255 Ga0500552_000444 3300053733 Bacteria 3826
256 Ga0501084_0001708 3300054114 Bacteria 17419
257 Ga0501084_0175883 3300054114 Bacteria 1807
258 Ga0501082_0001338 3300060353 Bacteria 21612
259 Ga0466962_0047834 3300061719 Bacteria 2044
260 Ga0466962_0055498 3300061719 Bacteria 1893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0191044 Ga0373953_0191044_151_831 195
2 3300046454 Ga0495592_0052711 Ga0495592_0052711_63_743 195
3 3300044694 Ga0466963_0310807 Ga0466963_0310807_14_703 198
4 3300049823 Ga0501044_0811954 Ga0501044_0811954_23_763 218
5 3300005535 Ga0070684_100081465 Ga0070684_1000814652 227
6 3300037418 Ga0395900_0013272 Ga0395900_0013272_2067_2948 227
7 3300038443 Ga0395901_0017426 Ga0395901_0017426_2316_3197 227
8 3300042005 Ga0439448_0063991 Ga0439448_0063991_16_897 227
9 3300035086 Ga0373934_0064421 Ga0373934_0064421_168_1109 228
10 3300035692 Ga0373935_0022204 Ga0373935_0022204_2069_3010 228
11 3300035724 Ga0373933_0054204 Ga0373933_0054204_1213_2154 228
12 3300035725 Ga0373947_0030118 Ga0373947_0030118_693_1634 228
13 3300036401 Ga0373937_0031257 Ga0373937_0031257_2643_3584 228
14 3300037068 Ga0373925_0020061 Ga0373925_0020061_1562_2503 228
15 3300046454 Ga0495592_0051723 Ga0495592_0051723_1873_2814 228
16 3300046462 Ga0495651_0007006 Ga0495651_0007006_2358_3299 228
17 3300046477 Ga0495664_0048130 Ga0495664_0048130_1298_2239 228
18 3300046511 Ga0495608_0039521 Ga0495608_0039521_1368_2309 228
19 3300046529 Ga0495652_0091841 Ga0495652_0091841_1230_2171 228
20 3300046678 Ga0495599_0169540 Ga0495599_0169540_155_1096 228
21 3300046689 Ga0495613_0160220 Ga0495613_0160220_611_1552 228
22 3300047319 Ga0495674_0210105 Ga0495674_0210105_128_1069 228
23 3300047322 Ga0495680_0074585 Ga0495680_0074585_1395_2336 228
24 3300049573 Ga0501037_0103190 Ga0501037_0103190_905_1735 230
25 3300049822 Ga0501035_0077758 Ga0501035_0077758_1501_2331 230
26 3300053096 Ga0500641_0066801 Ga0500641_0066801_560_1444 230
27 3300005330 Ga0070690_100058636 Ga0070690_1000586362 232
28 3300005355 Ga0070671_100057594 Ga0070671_1000575942 232
29 3300005367 Ga0070667_100451994 Ga0070667_1004519941 232
30 3300013296 Ga0157374_10143920 Ga0157374_101439202 232
31 3300037312 Ga0395899_0031821 Ga0395899_0031821_2100_2981 232
32 3300037418 Ga0395900_0013406 Ga0395900_0013406_3471_4352 232
33 3300037466 Ga0395898_0069891 Ga0395898_0069891_1427_2308 232
34 3300005330 Ga0070690_100343791 Ga0070690_1003437911 233
35 3300005334 Ga0068869_100222322 Ga0068869_1002223222 233
36 3300005544 Ga0070686_100032920 Ga0070686_1000329202 233
37 3300005842 Ga0068858_100061316 Ga0068858_1000613163 233
38 3300006237 Ga0097621_100012978 Ga0097621_1000129784 233
39 3300009098 Ga0105245_10002397 Ga0105245_1000239711 233
40 3300009177 Ga0105248_10129288 Ga0105248_101292883 233
41 3300011119 Ga0105246_10298694 Ga0105246_102986942 233
42 3300025924 Ga0207694_10127621 Ga0207694_101276212 233
43 3300025927 Ga0207687_10005765 Ga0207687_100057654 233
44 3300025936 Ga0207670_10363125 Ga0207670_103631251 233
45 3300025960 Ga0207651_10275018 Ga0207651_102750182 233
46 3300026023 Ga0207677_10005640 Ga0207677_100056408 233
47 3300026035 Ga0207703_10022150 Ga0207703_100221505 233
48 3300026121 Ga0207683_10014041 Ga0207683_100140414 233
49 3300049589 Ga0501073_0271656 Ga0501073_0271656_274_1110 234
50 3300005467 Ga0070706_100122199 Ga0070706_1001221992 236
51 3300005518 Ga0070699_100114040 Ga0070699_1001140403 236
52 3300048928 Ga0496125_0000017 Ga0496125_0000017_17269_18102 236
53 3300049586 Ga0501070_0270762 Ga0501070_0270762_525_1361 236
54 3300049571 Ga0501034_0307303 Ga0501034_0307303_195_1079 237
55 3300013297 Ga0157378_10641325 Ga0157378_106413251 238
56 3300025908 Ga0207643_10117081 Ga0207643_101170812 238
57 3300003323 rootH1_10172993 rootH1_101729932 239
58 3300006048 Ga0075363_100298311 Ga0075363_1002983111 239
59 3300006051 Ga0075364_10106107 Ga0075364_101061073 239
60 3300006177 Ga0075362_10002937 Ga0075362_100029375 239
61 3300006178 Ga0075367_10036363 Ga0075367_100363632 239
62 3300006353 Ga0075370_10164499 Ga0075370_101644993 239
63 3300048921 Ga0496118_0018535 Ga0496118_0018535_2072_2932 239
64 3300048929 Ga0496126_0000065 Ga0496126_0000065_88337_89197 239
65 3300050489 nmdc:mga03683_726_c1 nmdc:mga03683_726_c1_4851_5681 239
66 3300050491 nmdc:mga00v17_41486_c1 nmdc:mga00v17_41486_c1_790_1620 239
67 3300050496 nmdc:mga07m45_161005_c1 nmdc:mga07m45_161005_c1_19_849 239
68 3300035692 Ga0373935_0272861 Ga0373935_0272861_187_1071 240
69 3300035398 Ga0316574_0136524 Ga0316574_0136524_648_1493 241
70 3300005444 Ga0070694_100272781 Ga0070694_1002727812 243
71 3300049585 Ga0501069_0010005 Ga0501069_0010005_277_1119 243
72 3300049585 Ga0501069_0059593 Ga0501069_0059593_147_989 243
73 3300049586 Ga0501070_0017205 Ga0501070_0017205_4513_5355 243
74 3300049742 Ga0501080_0249293 Ga0501080_0249293_379_1221 243
75 3300049742 Ga0501080_0358830 Ga0501080_0358830_200_1042 243
76 3300049822 Ga0501035_0017938 Ga0501035_0017938_4988_5830 243
77 3300049823 Ga0501044_0375888 Ga0501044_0375888_145_987 243
78 3300049587 Ga0501071_0133971 Ga0501071_0133971_396_1253 244
79 3300053130 Ga0500642_0110952 Ga0500642_0110952_82_924 244
80 3300005340 Ga0070689_100070330 Ga0070689_1000703302 245
81 3300005341 Ga0070691_10003953 Ga0070691_100039532 245
82 3300005367 Ga0070667_100156575 Ga0070667_1001565753 245
83 3300005435 Ga0070714_100159486 Ga0070714_1001594862 245
84 3300005444 Ga0070694_100139311 Ga0070694_1001393112 245
85 3300005457 Ga0070662_100227068 Ga0070662_1002270681 245
86 3300005458 Ga0070681_10004738 Ga0070681_100047382 245
87 3300005468 Ga0070707_100115288 Ga0070707_1001152882 245
88 3300005471 Ga0070698_100000587 Ga0070698_1000005875 245
89 3300005530 Ga0070679_100006716 Ga0070679_1000067166 245
90 3300005536 Ga0070697_100283777 Ga0070697_1002837772 245
91 3300005545 Ga0070695_100116534 Ga0070695_1001165342 245
92 3300005548 Ga0070665_100052713 Ga0070665_1000527133 245
93 3300005548 Ga0070665_100223233 Ga0070665_1002232332 245
94 3300005563 Ga0068855_100046720 Ga0068855_1000467205 245
95 3300005564 Ga0070664_100056219 Ga0070664_1000562193 245
96 3300005577 Ga0068857_100104322 Ga0068857_1001043222 245
97 3300005614 Ga0068856_100051005 Ga0068856_1000510053 245
98 3300005617 Ga0068859_100686841 Ga0068859_1006868411 245
99 3300005937 Ga0081455_10000268 Ga0081455_1000026863 245
100 3300005937 Ga0081455_10003029 Ga0081455_100030297 245
101 3300005937 Ga0081455_10012349 Ga0081455_100123492 245
102 3300005985 Ga0081539_10001802 Ga0081539_1000180211 245
103 3300005985 Ga0081539_10013689 Ga0081539_100136895 245
104 3300006042 Ga0075368_10004780 Ga0075368_100047802 245
105 3300006048 Ga0075363_100111199 Ga0075363_1001111992 245
106 3300006177 Ga0075362_10067850 Ga0075362_100678502 245
107 3300006178 Ga0075367_10058154 Ga0075367_100581542 245
108 3300006186 Ga0075369_10011462 Ga0075369_100114622 245
109 3300006353 Ga0075370_10172446 Ga0075370_101724461 245
110 3300006871 Ga0075434_100791058 Ga0075434_1007910581 245
111 3300006931 Ga0097620_100686885 Ga0097620_1006868851 245
112 3300007076 Ga0075435_100092486 Ga0075435_1000924862 245
113 3300007265 Ga0099794_10112777 Ga0099794_101127771 245
114 3300009093 Ga0105240_10044690 Ga0105240_100446906 245
115 3300009174 Ga0105241_10228778 Ga0105241_102287782 245
116 3300009551 Ga0105238_10140136 Ga0105238_101401362 245
117 3300009988 Ga0105035_102452 Ga0105035_1024521 245
118 3300013100 Ga0157373_10194169 Ga0157373_101941692 245
119 3300013102 Ga0157371_10348071 Ga0157371_103480711 245
120 3300013104 Ga0157370_10470286 Ga0157370_104702862 245
121 3300013105 Ga0157369_10162939 Ga0157369_101629392 245
122 3300020082 Ga0206353_10936629 Ga0206353_109366292 245
123 3300021377 Ga0213874_10044898 Ga0213874_100448982 245
124 3300021384 Ga0213876_10013526 Ga0213876_100135265 245
125 3300025302 Ga0207426_1013454 Ga0207426_10134543 245
126 3300025904 Ga0207647_10176079 Ga0207647_101760791 245
127 3300025911 Ga0207654_10213288 Ga0207654_102132882 245
128 3300025912 Ga0207707_10041778 Ga0207707_100417782 245
129 3300025913 Ga0207695_10064478 Ga0207695_100644781 245
130 3300025920 Ga0207649_10213573 Ga0207649_102135732 245
131 3300025928 Ga0207700_10112379 Ga0207700_101123791 245
132 3300025939 Ga0207665_10174614 Ga0207665_101746142 245
133 3300025944 Ga0207661_10208929 Ga0207661_102089292 245
134 3300025945 Ga0207679_10019946 Ga0207679_100199463 245
135 3300025949 Ga0207667_10344878 Ga0207667_103448782 245
136 3300025981 Ga0207640_10022422 Ga0207640_100224222 245
137 3300026078 Ga0207702_10029520 Ga0207702_100295202 245
138 3300026089 Ga0207648_10528192 Ga0207648_105281922 245
139 3300026116 Ga0207674_10225831 Ga0207674_102258312 245
140 3300028379 Ga0268266_10101426 Ga0268266_101014262 245
141 3300028379 Ga0268266_10135912 Ga0268266_101359121 245
142 3300028381 Ga0268264_10068064 Ga0268264_100680643 245
143 3300031665 Ga0316575_10074646 Ga0316575_100746462 245
144 3300035089 Ga0373944_0001521 Ga0373944_0001521_642_1487 245
145 3300035691 Ga0373931_0236463 Ga0373931_0236463_66_950 245
146 3300035695 Ga0373927_0090175 Ga0373927_0090175_860_1744 245
147 3300037068 Ga0373925_0086152 Ga0373925_0086152_1157_2041 245
148 3300037418 Ga0395900_0019585 Ga0395900_0019585_1495_2379 245
149 3300037418 Ga0395900_0126315 Ga0395900_0126315_751_1581 245
150 3300037466 Ga0395898_0060305 Ga0395898_0060305_2494_3378 245
151 3300038443 Ga0395901_0005326 Ga0395901_0005326_7655_8539 245
152 3300038443 Ga0395901_0097023 Ga0395901_0097023_497_1381 245
153 3300038443 Ga0395901_0331617 Ga0395901_0331617_606_1436 245
154 3300039437 Ga0436365_0088563 Ga0436365_0088563_6981_7826 245
155 3300039450 Ga0436363_1025691 Ga0436363_1025691_846_1691 245
156 3300039453 Ga0436362_0501941 Ga0436362_0501941_110_955 245
157 3300044693 Ga0466961_0030398 Ga0466961_0030398_437_1282 245
158 3300044694 Ga0466963_0013352 Ga0466963_0013352_3883_4728 245
159 3300044694 Ga0466963_0036760 Ga0466963_0036760_1833_2678 245
160 3300044694 Ga0466963_0181343 Ga0466963_0181343_496_1377 245
161 3300044719 Ga0466971_0111024 Ga0466971_0111024_144_989 245
162 3300044901 Ga0466960_0237158 Ga0466960_0237158_18_863 245
163 3300045976 Ga0466967_0296216 Ga0466967_0296216_20_901 245
164 3300045976 Ga0466967_0519692 Ga0466967_0519692_256_1098 245
165 3300046461 Ga0495641_0028687 Ga0495641_0028687_16_861 245
166 3300046492 Ga0495585_0009551 Ga0495585_0009551_1861_2706 245
167 3300046501 Ga0495607_0064554 Ga0495607_0064554_996_1841 245
168 3300046513 Ga0495616_0017410 Ga0495616_0017410_2001_2846 245
169 3300046515 Ga0495620_0065399 Ga0495620_0065399_561_1406 245
170 3300046520 Ga0495637_0034823 Ga0495637_0034823_65_910 245
171 3300046525 Ga0495663_0011326 Ga0495663_0011326_530_1375 245
172 3300046558 Ga0495633_0023253 Ga0495633_0023253_2072_2917 245
173 3300046615 Ga0495656_0005367 Ga0495656_0005367_1478_2323 245
174 3300046664 Ga0495659_0012711 Ga0495659_0012711_1077_1922 245
175 3300046691 Ga0495670_0108280 Ga0495670_0108280_323_1168 245
176 3300047445 Ga0495677_0013199 Ga0495677_0013199_1806_2651 245
177 3300049569 Ga0501032_0162550 Ga0501032_0162550_467_1312 245
178 3300049571 Ga0501034_0001770 Ga0501034_0001770_2976_3860 245
179 3300049571 Ga0501034_0007391 Ga0501034_0007391_3989_4873 245
180 3300049571 Ga0501034_0102793 Ga0501034_0102793_1355_2239 245
181 3300049581 Ga0501047_0081732 Ga0501047_0081732_423_1268 245
182 3300049581 Ga0501047_0245518 Ga0501047_0245518_41_871 245
183 3300049582 Ga0501048_0071238 Ga0501048_0071238_17_862 245
184 3300049584 Ga0501068_0038140 Ga0501068_0038140_996_1880 245
185 3300049585 Ga0501069_0144145 Ga0501069_0144145_304_1149 245
186 3300049586 Ga0501070_0204329 Ga0501070_0204329_675_1520 245
187 3300049587 Ga0501071_0018219 Ga0501071_0018219_2462_3307 245
188 3300049589 Ga0501073_0162158 Ga0501073_0162158_667_1512 245
189 3300049589 Ga0501073_0324674 Ga0501073_0324674_44_889 245
190 3300049590 Ga0501074_0063957 Ga0501074_0063957_1338_2183 245
191 3300049592 Ga0501076_0011401 Ga0501076_0011401_978_1823 245
192 3300049592 Ga0501076_0190423 Ga0501076_0190423_387_1232 245
193 3300049741 Ga0501079_0072081 Ga0501079_0072081_263_1108 245
194 3300049742 Ga0501080_0077838 Ga0501080_0077838_465_1310 245
195 3300049743 Ga0501081_0052097 Ga0501081_0052097_971_1816 245
196 3300049744 Ga0501083_0177747 Ga0501083_0177747_448_1293 245
197 3300049822 Ga0501035_0458201 Ga0501035_0458201_113_958 245
198 3300049823 Ga0501044_0234341 Ga0501044_0234341_308_1210 245
199 3300049823 Ga0501044_0243788 Ga0501044_0243788_806_1651 245
200 3300049824 Ga0501045_0060214 Ga0501045_0060214_1574_2419 245
201 3300050489 nmdc:mga03683_74059_c1 nmdc:mga03683_74059_c1_551_1435 245
202 3300050489 nmdc:mga03683_7827_c1 nmdc:mga03683_7827_c1_620_1504 245
203 3300050491 nmdc:mga00v17_287987_c1 nmdc:mga00v17_287987_c1_146_1030 245
204 3300050492 nmdc:mga0yw44_232303_c1 nmdc:mga0yw44_232303_c1_255_1139 245
205 3300050492 nmdc:mga0yw44_76557_c1 nmdc:mga0yw44_76557_c1_798_1682 245
206 3300050494 nmdc:mga06z11_30428_c1 nmdc:mga06z11_30428_c1_540_1424 245
207 3300050496 nmdc:mga07m45_137191_c1 nmdc:mga07m45_137191_c1_363_1247 245
208 3300050496 nmdc:mga07m45_215494_c1 nmdc:mga07m45_215494_c1_148_1032 245
209 3300050512 nmdc:mga0n895_109002_c1 nmdc:mga0n895_109002_c1_250_1095 245
210 3300050513 nmdc:mga0rr50_28421_c1 nmdc:mga0rr50_28421_c1_2495_3340 245
211 3300050516 nmdc:mga0sz30_18934_c1 nmdc:mga0sz30_18934_c1_1284_2168 245
212 3300050516 nmdc:mga0sz30_5803_c2 nmdc:mga0sz30_5803_c2_1762_2646 245
213 3300053084 Ga0495595_0029810 Ga0495595_0029810_609_1454 245
214 3300053085 Ga0495619_0072406 Ga0495619_0072406_1138_1983 245
215 3300053093 Ga0500651_0035948 Ga0500651_0035948_710_1594 245
216 3300053117 Ga0500593_010922 Ga0500593_010922_1835_2680 245
217 3300053139 Ga0500568_0006831 Ga0500568_0006831_413_1321 245
218 3300053153 Ga0500616_0001772 Ga0500616_0001772_10215_11099 245
219 3300053731 Ga0500609_006224 Ga0500609_006224_685_1569 245
220 3300053733 Ga0500552_000444 Ga0500552_000444_2212_3096 245
221 3300054114 Ga0501084_0001708 Ga0501084_0001708_426_1271 245
222 3300054114 Ga0501084_0175883 Ga0501084_0175883_297_1142 245
223 3300061719 Ga0466962_0047834 Ga0466962_0047834_372_1217 245
224 3300061719 Ga0466962_0055498 Ga0466962_0055498_1040_1882 245
225 iso_pu_bacteria 2643221598 2643998646 245
226 iso_pu_bacteria 2643221614 2644087408 245
227 iso_pu_bacteria 2643221661 2644344548 245
228 iso_pu_bacteria 2643221666 2644366768 245
229 iso_pu_bacteria 2854601825 2854602207 245
230 3300031548 Ga0307408_100573786 Ga0307408_1005737862 246
231 3300039450 Ga0436363_1543659 Ga0436363_1543659_5050_5886 246
232 3300049571 Ga0501034_0000031 Ga0501034_0000031_172162_172995 246
233 3300049572 Ga0501036_0014329 Ga0501036_0014329_2554_3387 246
234 3300049573 Ga0501037_0003468 Ga0501037_0003468_1885_2718 246
235 3300049575 Ga0501039_0000745 Ga0501039_0000745_1432_2265 246
236 3300049579 Ga0501043_0023134 Ga0501043_0023134_285_1118 246
237 3300049580 Ga0501046_0000503 Ga0501046_0000503_16576_17409 246
238 3300049581 Ga0501047_0000175 Ga0501047_0000175_36913_37746 246
239 3300049581 Ga0501047_0409606 Ga0501047_0409606_10_843 246
240 3300049582 Ga0501048_0069143 Ga0501048_0069143_1313_2146 246
241 3300049583 Ga0501067_0004393 Ga0501067_0004393_6060_6893 246
242 3300049586 Ga0501070_0018265 Ga0501070_0018265_3808_4641 246
243 3300049589 Ga0501073_0060948 Ga0501073_0060948_1226_2059 246
244 3300049590 Ga0501074_0114323 Ga0501074_0114323_959_1792 246
245 3300049742 Ga0501080_0000020 Ga0501080_0000020_40634_41467 246
246 3300049822 Ga0501035_0000077 Ga0501035_0000077_117419_118252 246
247 3300049823 Ga0501044_0000013 Ga0501044_0000013_176316_177149 246
248 3300049824 Ga0501045_0045690 Ga0501045_0045690_465_1298 246
249 3300060353 Ga0501082_0001338 Ga0501082_0001338_19256_20089 246
250 iso_pu_bacteria 2894817345 2894818480 246
251 3300031711 Ga0265314_10114652 Ga0265314_101146523 247
252 3300031711 Ga0265314_10156372 Ga0265314_101563722 247
253 3300031712 Ga0265342_10142807 Ga0265342_101428071 247
254 3300049571 Ga0501034_0109693 Ga0501034_0109693_1660_2508 247
255 3300049571 Ga0501034_0231003 Ga0501034_0231003_727_1575 247
256 3300049583 Ga0501067_0002375 Ga0501067_0002375_1641_2480 247
257 3300049823 Ga0501044_0537707 Ga0501044_0537707_96_944 247
258 iso_pu_bacteria 2857558681 2857563873 247
259 3300009094 Ga0111539_10372611 Ga0111539_103726112 248
260 iso_pu_bacteria 2534681786 2535484453 248
261 iso_pu_bacteria 2751185800 2753359019 248
262 iso_pu_bacteria 2758568016 2758641256 248
263 iso_pu_bacteria 2854911287 2854914540 248
264 iso_pu_bacteria 2915650412 2915651525 248
265 3300003320 rootH2_10175999 rootH2_101759994 249
266 3300014969 Ga0157376_10182709 Ga0157376_101827091 249
267 3300044901 Ga0466960_0068162 Ga0466960_0068162_22_867 249
268 3300048909 Ga0496106_0000007 Ga0496106_0000007_95597_96439 249
269 3300048922 Ga0496119_0004467 Ga0496119_0004467_5807_6652 249
270 3300048923 Ga0496120_0116295 Ga0496120_0116295_236_1081 249
271 3300048924 Ga0496121_0003981 Ga0496121_0003981_6925_7767 249
272 3300048925 Ga0496122_0070847 Ga0496122_0070847_912_1757 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

186

327

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7123 2 249
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7073 2 249
5ogk-assembly2.cif.gz_C crystal structure of a nucleotide sugar transporter with bound nucleotide sugar. 0.7032 2 247
6qsk-assembly2.cif.gz_G-2 crystal structure of a nucleotide sugar transporter with bound nucleotide monophosphate. 0.6996 2 244
5oge-assembly1.cif.gz_A crystal structure of a nucleotide sugar transporter 0.6951 3 244
ID Description Score Start End Superfamily
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6479 3 245 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6372 2 241 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6323 3 245 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6155 2 241 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6155 3 246 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A1A9QZU5-F1-model_v4 Transporter 0.9443 2 215 GO:0016020
AF-A0A2E1HUX6-F1-model_v4 deleted 0.9386 5 175
AF-A0A2N5A6M0-F1-model_v4 EamA family transporter 0.9366 3 218 GO:0016020
AF-A0A432GKQ8-F1-model_v4 EamA domain-containing protein 0.936 4 210 GO:0016020
AF-A0A3N5NH01-F1-model_v4 EamA family transporter 0.9344 2 227 GO:0016020

Feature Viewer

pLDDT pTM Quality
80.71 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map