F378283

General Info

Members Datasets Scaffolds Average Seq Length
272 118 272 227

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100000603|Ga0075431_10000060312
Length 255
Sequence MIFGSMAPLRPPKLLPVGRVGAVLVVVTLLTTGCNTLLNIIGYPTAGDPTVELKKAESKWVLIKNPRFGDVPSEPEYVWVEEEKMPTTMKSFVFGKSTLLAPPEVVSKYGQPPGGGRISPLQKVPYQAAEPPATAGSPRPTGVTAAAAPTTRTDGALAPVAPAPPPSRGYVVYVDTTRIVIDLNGQDGLKPGSLVSLRRDKIPIVHPITGELLGELDEEVATGKVIEVREKFSVVEIGNTTEAAEIKIRDRVVVR

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10004281 3300003911 Bacteria 2546
2 Ga0065707_10360516 3300005295 Bacteria 905
3 Ga0070676_10068995 3300005328 Bacteria 2118
4 Ga0070690_100287223 3300005330 Bacteria 1175
5 Ga0068869_100015054 3300005334 Bacteria 5178
6 Ga0070680_100098444 3300005336 Bacteria 2426
7 Ga0070703_10007603 3300005406 Bacteria 3045
8 Ga0070701_10015422 3300005438 Bacteria 3529
9 Ga0070705_100018562 3300005440 Bacteria 3648
10 Ga0070705_100059110 3300005440 Bacteria 2269
11 Ga0070705_100107951 3300005440 Bacteria 1772
12 Ga0070705_100246479 3300005440 Bacteria 1251
13 Ga0070700_100100639 3300005441 Bacteria 1903
14 Ga0070700_100156831 3300005441 Bacteria 1563
15 Ga0070694_100000980 3300005444 Bacteria 16208
16 Ga0070694_100034829 3300005444 Bacteria 3324
17 Ga0070694_100072397 3300005444 Bacteria 2378
18 Ga0070708_100017047 3300005445 Bacteria 6047
19 Ga0070708_100029207 3300005445 Bacteria 4753
20 Ga0070708_100029727 3300005445 Bacteria 4715
21 Ga0070708_100034082 3300005445 Bacteria 4428
22 Ga0070708_100042709 3300005445 Bacteria 3982
23 Ga0070708_100045228 3300005445 Bacteria 3877
24 Ga0070708_100162211 3300005445 Bacteria 2083
25 Ga0070681_10205999 3300005458 Bacteria 1884
26 Ga0068867_100162170 3300005459 Bacteria 1764
27 Ga0068867_100203170 3300005459 Bacteria 1587
28 Ga0070706_100017523 3300005467 Bacteria 6611
29 Ga0070706_100018785 3300005467 Bacteria 6374
30 Ga0070706_100029772 3300005467 Bacteria 5030
31 Ga0070706_100238279 3300005467 Bacteria 1699
32 Ga0070707_100006754 3300005468 Bacteria 10628
33 Ga0070707_100027472 3300005468 Bacteria 5414
34 Ga0070707_100109430 3300005468 Unclassified 2680
35 Ga0070707_100167155 3300005468 Bacteria 2144
36 Ga0070707_100372913 3300005468 Unclassified 1386
37 Ga0070698_100043107 3300005471 Bacteria 4628
38 Ga0070698_100062332 3300005471 Unclassified 3762
39 Ga0070698_100301682 3300005471 Bacteria 1532
40 Ga0070699_100002899 3300005518 Bacteria 15269
41 Ga0070699_100017146 3300005518 Bacteria 6219
42 Ga0070699_100023070 3300005518 Bacteria 5362
43 Ga0070679_100276860 3300005530 Bacteria 1631
44 Ga0070697_100004630 3300005536 Bacteria 10560
45 Ga0070697_100024804 3300005536 Bacteria 4775
46 Ga0070697_100097122 3300005536 Bacteria 2444
47 Ga0070697_100177634 3300005536 Bacteria 1804
48 Ga0070697_100344978 3300005536 Bacteria 1285
49 Ga0070695_100000963 3300005545 Bacteria 15635
50 Ga0070695_100039381 3300005545 Bacteria 2988
51 Ga0070695_100208677 3300005545 Bacteria 1401
52 Ga0070695_100274036 3300005545 Bacteria 1237
53 Ga0070696_100054899 3300005546 Bacteria 2778
54 Ga0070696_100163514 3300005546 Unclassified 1641
55 Ga0070693_100029078 3300005547 Bacteria 3010
56 Ga0070693_100059387 3300005547 Bacteria 2216
57 Ga0070704_100103323 3300005549 Bacteria 2152
58 Ga0070704_100279204 3300005549 Bacteria 1383
59 Ga0070704_100533051 3300005549 Bacteria 1024
60 Ga0068857_100266075 3300005577 Bacteria 1575
61 Ga0068866_10076174 3300005718 Bacteria 1788
62 Ga0068866_10153974 3300005718 Bacteria 1334
63 Ga0068870_10017712 3300005840 Bacteria 3426
64 Ga0068860_100075153 3300005843 Bacteria 3213
65 Ga0068860_100327152 3300005843 Bacteria 1505
66 Ga0068862_100027292 3300005844 Bacteria 4805
67 Ga0068862_100062779 3300005844 Bacteria 3196
68 Ga0081455_10025813 3300005937 Bacteria 5416
69 Ga0081455_10230156 3300005937 Bacteria 1368
70 Ga0081538_10004925 3300005981 Bacteria 12160
71 Ga0075428_100001580 3300006844 Bacteria 24420
72 Ga0075428_100026314 3300006844 Bacteria 6440
73 Ga0075428_100186419 3300006844 Bacteria 2245
74 Ga0075428_100234116 3300006844 Bacteria 1982
75 Ga0075430_100012030 3300006846 Bacteria 7365
76 Ga0075430_100124035 3300006846 Bacteria 2153
77 Ga0075431_100000570 3300006847 Bacteria 31149
78 Ga0075431_100000603 3300006847 Bacteria 30361
79 Ga0075431_100001027 3300006847 Bacteria 24883
80 Ga0075431_100008600 3300006847 Bacteria 10220
81 Ga0075431_100071933 3300006847 Bacteria 3568
82 Ga0075431_100074924 3300006847 Bacteria 3492
83 Ga0075431_100159485 3300006847 Bacteria 2320
84 Ga0075431_100268707 3300006847 Bacteria 1729
85 Ga0075433_10000406 3300006852 Bacteria 27514
86 Ga0075433_10005247 3300006852 Bacteria 10157
87 Ga0075433_10034193 3300006852 Bacteria 4364
88 Ga0075433_10436310 3300006852 Bacteria 1155
89 Ga0075433_10615835 3300006852 Bacteria 953
90 Ga0075434_100014316 3300006871 Bacteria 7580
91 Ga0075434_100160189 3300006871 Bacteria 2270
92 Ga0075434_100240302 3300006871 Bacteria 1831
93 Ga0075429_100003527 3300006880 Bacteria 13328
94 Ga0075429_100013173 3300006880 Bacteria 7173
95 Ga0075429_100061160 3300006880 Bacteria 3280
96 Ga0075429_100270945 3300006880 Bacteria 1487
97 Ga0075429_100491624 3300006880 Bacteria 1075
98 Ga0075436_100003018 3300006914 Bacteria 11532
99 Ga0075436_100014324 3300006914 Bacteria 5429
100 Ga0075435_100014993 3300007076 Bacteria 5814
101 Ga0075435_100036823 3300007076 Bacteria 3891
102 Ga0075435_100225526 3300007076 Bacteria 1591
103 Ga0099794_10004649 3300007265 Bacteria 5427
104 Ga0099794_10144923 3300007265 Bacteria 1204
105 Ga0111539_10029223 3300009094 Bacteria 6718
106 Ga0111539_10384076 3300009094 Bacteria 1635
107 Ga0105245_10451467 3300009098 Bacteria 1294
108 Ga0105247_10186666 3300009101 Bacteria 1386
109 Ga0114129_10001399 3300009147 Bacteria 32520
110 Ga0114129_10003532 3300009147 Bacteria 21989
111 Ga0114129_10008681 3300009147 Bacteria 14486
112 Ga0114129_10019982 3300009147 Bacteria 9534
113 Ga0114129_10046320 3300009147 Bacteria 6112
114 Ga0114129_10069697 3300009147 Bacteria 4901
115 Ga0114129_10088862 3300009147 Bacteria 4284
116 Ga0114129_10146531 3300009147 Bacteria 3234
117 Ga0114129_10209678 3300009147 Bacteria 2635
118 Ga0114129_10461946 3300009147 Bacteria 1663
119 Ga0105243_10162947 3300009148 Bacteria 1924
120 Ga0105243_10929919 3300009148 Bacteria 867
121 Ga0105242_10011431 3300009176 Bacteria 6825
122 Ga0105249_10079496 3300009553 Bacteria 3044
123 Ga0105249_10922082 3300009553 Unclassified 941
124 Ga0157378_10125113 3300013297 Bacteria 2374
125 Ga0157375_10622049 3300013308 Bacteria 1238
126 Ga0157380_10426379 3300014326 Bacteria 1267
127 Ga0207653_10028120 3300025885 Bacteria 1807
128 Ga0207684_10007454 3300025910 Bacteria 9846
129 Ga0207684_10012804 3300025910 Bacteria 7268
130 Ga0207684_10037740 3300025910 Bacteria 4100
131 Ga0207684_10078522 3300025910 Bacteria 2807
132 Ga0207707_10278792 3300025912 Bacteria 1448
133 Ga0207646_10030439 3300025922 Bacteria 4893
134 Ga0207646_10050010 3300025922 Bacteria 3742
135 Ga0207646_10074531 3300025922 Bacteria 3032
136 Ga0207646_10088605 3300025922 Unclassified 2769
137 Ga0207646_10125944 3300025922 Unclassified 2304
138 Ga0207646_10145248 3300025922 Bacteria 2137
139 Ga0207646_10216014 3300025922 Bacteria 1732
140 Ga0207646_10400898 3300025922 Bacteria 1239
141 Ga0207681_10036213 3300025923 Bacteria 3255
142 Ga0207686_10068578 3300025934 Bacteria 2272
143 Ga0207709_10009628 3300025935 Bacteria 5322
144 Ga0207670_10186118 3300025936 Bacteria 1567
145 Ga0207689_10005790 3300025942 Bacteria 10971
146 Ga0207689_10182375 3300025942 Bacteria 1731
147 Ga0207712_10326326 3300025961 Unclassified 1268
148 Ga0207708_10132773 3300026075 Bacteria 1948
149 Ga0207641_10113348 3300026088 Unclassified 2408
150 Ga0207648_10075935 3300026089 Bacteria 2929
151 Ga0207674_10007363 3300026116 Bacteria 12819
152 Ga0207675_100043910 3300026118 Bacteria 4175
153 Ga0207675_100356093 3300026118 Bacteria 1435
154 Ga0207683_10469656 3300026121 Bacteria 1161
155 Ga0209971_1028196 3300027682 Bacteria 1344
156 Ga0209966_1016299 3300027695 Bacteria 1404
157 Ga0209998_10010487 3300027717 Bacteria 1919
158 Ga0268265_10028950 3300028380 Bacteria 3971
159 Ga0268265_10037955 3300028380 Bacteria 3539
160 Ga0268265_10418715 3300028380 Bacteria 1243
161 Ga0307408_100090142 3300031548 Bacteria 2313
162 Ga0307408_100159227 3300031548 Bacteria 1791
163 Ga0307412_10091675 3300031911 Bacteria 2128
164 Ga0307416_100101756 3300032002 Bacteria 2503
165 Ga0373960_0068969 3300035121 Bacteria 1090
166 Ga0373931_0004575 3300035691 Bacteria 6328
167 Ga0373931_0200310 3300035691 Bacteria 1192
168 Ga0395900_0115624 3300037418 Bacteria 2753
169 Ga0395905_0051876 3300037471 Bacteria 3842
170 Ga0395901_0065922 3300038443 Bacteria 3772
171 Ga0439441_030388 3300042001 Bacteria 1044
172 Ga0453683_0058080 3300044673 Bacteria 2420
173 Ga0453683_0320166 3300044673 Bacteria 994
174 Ga0451576_0017416 3300045051 Bacteria 7900
175 Ga0451576_0048050 3300045051 Bacteria 4484
176 Ga0451576_0162135 3300045051 Bacteria 2334
177 Ga0495580_0083799 3300046472 Unclassified 2221
178 Ga0495580_0123877 3300046472 Bacteria 1794
179 Ga0495659_0019356 3300046664 Bacteria 2278
180 Ga0496102_0024544 3300048905 Bacteria 5361
181 Ga0496106_0081641 3300048909 Bacteria 2484
182 Ga0496110_0321422 3300048913 Bacteria 1410
183 Ga0496113_0235054 3300048916 Bacteria 1462
184 Ga0501031_0240803 3300049568 Bacteria 1176
185 Ga0501037_0213602 3300049573 Bacteria 1360
186 Ga0501040_0000701 3300049576 Bacteria 20654
187 Ga0501040_0067943 3300049576 Bacteria 2457
188 Ga0501041_0010973 3300049577 Bacteria 5349
189 Ga0501041_0214534 3300049577 Bacteria 1207
190 Ga0501042_0509782 3300049578 Unclassified 874
191 Ga0501046_0071769 3300049580 Bacteria 2689
192 Ga0501046_0151102 3300049580 Bacteria 1752
193 Ga0501048_0542039 3300049582 Bacteria 835
194 Ga0501067_0015203 3300049583 Bacteria 4261
195 Ga0501069_0056363 3300049585 Bacteria 2189
196 Ga0501071_0015418 3300049587 Bacteria 5246
197 Ga0501071_0219050 3300049587 Bacteria 1432
198 Ga0501072_0010362 3300049588 Bacteria 7103
199 Ga0501074_0091378 3300049590 Bacteria 2180
200 Ga0501074_0292281 3300049590 Bacteria 1158
201 Ga0501075_0011213 3300049591 Bacteria 6338
202 Ga0501075_0215036 3300049591 Bacteria 1466
203 Ga0501076_0204580 3300049592 Bacteria 1612
204 Ga0501076_0459328 3300049592 Bacteria 1048
205 Ga0501077_0012931 3300049593 Bacteria 5228
206 Ga0501079_0018939 3300049741 Bacteria 5260
207 Ga0501079_0344420 3300049741 Bacteria 1167
208 Ga0501079_0350681 3300049741 Unclassified 1156
209 Ga0501079_0641051 3300049741 Bacteria 836
210 Ga0501080_0108039 3300049742 Bacteria 2579
211 Ga0501080_0335832 3300049742 Unclassified 1366
212 Ga0501081_0007653 3300049743 Bacteria 7007
213 Ga0501081_0019514 3300049743 Bacteria 4513
214 Ga0501081_0124666 3300049743 Bacteria 1837
215 Ga0501081_0148782 3300049743 Bacteria 1681
216 Ga0501081_0303917 3300049743 Bacteria 1170
217 Ga0501081_0315757 3300049743 Unclassified 1148
218 Ga0501045_0033711 3300049824 Bacteria 3714
219 Ga0501045_0066206 3300049824 Bacteria 2653
220 Ga0501045_0426808 3300049824 Bacteria 986
221 nmdc:mga05p37_1082487_c1 3300050507 Bacteria 842
222 nmdc:mga05p37_196466_c1 3300050507 Bacteria 2446
223 nmdc:mga05p37_234233_c1 3300050507 Bacteria 2211
224 nmdc:mga05p37_250540_c1 3300050507 Bacteria 2124
225 nmdc:mga05p37_3838_c1 3300050507 Bacteria 17583
226 nmdc:mga05p37_4050_c1 3300050507 Bacteria 10992
227 nmdc:mga05p37_465263_c1 3300050507 Bacteria 1460
228 nmdc:mga05p37_5745_c1 3300050507 Bacteria 14596
229 nmdc:mga05p37_94339_c1 3300050507 Bacteria 3687
230 nmdc:mga05p37_996_c1 3300050507 Bacteria 32280
231 nmdc:mga09592_12730_c1 3300050508 Bacteria 6857
232 nmdc:mga09592_1358_c1 3300050508 Bacteria 19562
233 nmdc:mga09592_140027_c1 3300050508 Bacteria 2085
234 nmdc:mga09592_242216_c1 3300050508 Bacteria 1563
235 nmdc:mga09592_380745_c1 3300050508 Bacteria 1220
236 nmdc:mga0qj67_129925_c1 3300050509 Bacteria 2040
237 nmdc:mga0qj67_14662_c1 3300050509 Bacteria 5926
238 nmdc:mga06r32_1127_c1 3300050510 Bacteria 23953
239 nmdc:mga06r32_11548_c1 3300050510 Bacteria 7957
240 nmdc:mga06r32_147839_c1 3300050510 Bacteria 2327
241 nmdc:mga06r32_167967_c1 3300050510 Bacteria 2177
242 nmdc:mga06r32_23646_c1 3300050510 Bacteria 5689
243 nmdc:mga06r32_36484_c1 3300050510 Bacteria 4646
244 nmdc:mga06r32_610_c1 3300050510 Bacteria 31197
245 nmdc:mga06r32_93758_c1 3300050510 Bacteria 2937
246 nmdc:mga08y16_31488_c1 3300050511 Bacteria 5578
247 nmdc:mga08y16_524563_c1 3300050511 Bacteria 1201
248 nmdc:mga0n895_1394_c1 3300050512 Bacteria 18007
249 nmdc:mga0n895_140439_c1 3300050512 Unclassified 2444
250 nmdc:mga0n895_158207_c1 3300050512 Bacteria 2297
251 nmdc:mga0n895_221613_c1 3300050512 Bacteria 1920
252 nmdc:mga0n895_393205_c1 3300050512 Bacteria 1402
253 nmdc:mga0n895_50253_c1 3300050512 Bacteria 4087
254 nmdc:mga0n895_566587_c1 3300050512 Unclassified 1141
255 nmdc:mga0rr50_11020_c1 3300050513 Bacteria 5765
256 nmdc:mga0rr50_3592_c1 3300050513 Bacteria 8967
257 nmdc:mga08x19_136814_c1 3300050514 Bacteria 1652
258 nmdc:mga08x19_253115_c1 3300050514 Bacteria 1216
259 nmdc:mga08x19_421129_c1 3300050514 Unclassified 938
260 nmdc:mga08x19_8661_c1 3300050514 Bacteria 6066
261 nmdc:mga0a205_289_c1 3300050515 Bacteria 37019
262 nmdc:mga0a205_305508_c1 3300050515 Bacteria 1463
263 nmdc:mga0a205_362523_c1 3300050515 Bacteria 1316
264 nmdc:mga0a205_742988_c1 3300050515 Unclassified 830
265 nmdc:mga0a205_905_c1 3300050515 Bacteria 24416
266 Ga0501084_0008904 3300054114 Bacteria 8305
267 Ga0501084_0398884 3300054114 Bacteria 1162
268 Ga0501082_0049604 3300060353 Bacteria 3620
269 Ga0501082_0153019 3300060353 Unclassified 2004
270 Ga0501082_0188722 3300060353 Unclassified 1793
271 Ga0530510_0009270 3300061734 Bacteria 6905
272 Ga0530510_0036966 3300061734 Bacteria 3519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0240803 Ga0501031_0240803_510_1142 176
2 3300025922 Ga0207646_10074531 Ga0207646_100745313 185
3 3300049593 Ga0501077_0012931 Ga0501077_0012931_284_955 191
4 3300048913 Ga0496110_0321422 Ga0496110_0321422_503_1228 199
5 3300048916 Ga0496113_0235054 Ga0496113_0235054_138_863 199
6 3300009553 Ga0105249_10079496 Ga0105249_100794963 200
7 3300046664 Ga0495659_0019356 Ga0495659_0019356_569_1312 202
8 3300049577 Ga0501041_0010973 Ga0501041_0010973_2347_3018 203
9 3300049587 Ga0501071_0219050 Ga0501071_0219050_584_1255 203
10 3300049592 Ga0501076_0459328 Ga0501076_0459328_266_937 203
11 3300049741 Ga0501079_0641051 Ga0501079_0641051_14_727 203
12 3300049742 Ga0501080_0108039 Ga0501080_0108039_1031_1702 203
13 3300049743 Ga0501081_0007653 Ga0501081_0007653_389_1060 203
14 3300060353 Ga0501082_0049604 Ga0501082_0049604_1855_2526 203
15 3300061734 Ga0530510_0009270 Ga0530510_0009270_2181_2852 203
16 3300005937 Ga0081455_10230156 Ga0081455_102301562 204
17 3300005440 Ga0070705_100107951 Ga0070705_1001079512 205
18 3300006871 Ga0075434_100160189 Ga0075434_1001601893 205
19 3300007076 Ga0075435_100225526 Ga0075435_1002255262 205
20 3300009148 Ga0105243_10929919 Ga0105243_109299191 205
21 3300050512 nmdc:mga0n895_140439_c1 nmdc:mga0n895_140439_c1_80_814 205
22 3300050512 nmdc:mga0n895_566587_c1 nmdc:mga0n895_566587_c1_144_878 205
23 3300050514 nmdc:mga08x19_136814_c1 nmdc:mga08x19_136814_c1_608_1342 205
24 3300050515 nmdc:mga0a205_305508_c1 nmdc:mga0a205_305508_c1_536_1270 205
25 3300005406 Ga0070703_10007603 Ga0070703_100076032 206
26 3300005438 Ga0070701_10015422 Ga0070701_100154224 206
27 3300005441 Ga0070700_100100639 Ga0070700_1001006392 206
28 3300005445 Ga0070708_100029727 Ga0070708_1000297272 206
29 3300005546 Ga0070696_100163514 Ga0070696_1001635141 206
30 3300005547 Ga0070693_100059387 Ga0070693_1000593871 206
31 3300005549 Ga0070704_100103323 Ga0070704_1001033232 206
32 3300005718 Ga0068866_10076174 Ga0068866_100761742 206
33 3300005840 Ga0068870_10017712 Ga0068870_100177122 206
34 3300005843 Ga0068860_100327152 Ga0068860_1003271522 206
35 3300006852 Ga0075433_10615835 Ga0075433_106158352 206
36 3300009098 Ga0105245_10451467 Ga0105245_104514671 206
37 3300009148 Ga0105243_10162947 Ga0105243_101629472 206
38 3300009176 Ga0105242_10011431 Ga0105242_100114312 206
39 3300025885 Ga0207653_10028120 Ga0207653_100281202 206
40 3300025934 Ga0207686_10068578 Ga0207686_100685782 206
41 3300025935 Ga0207709_10009628 Ga0207709_100096284 206
42 3300026075 Ga0207708_10132773 Ga0207708_101327732 206
43 3300026116 Ga0207674_10007363 Ga0207674_100073636 206
44 3300050515 nmdc:mga0a205_742988_c1 nmdc:mga0a205_742988_c1_31_753 206
45 3300006852 Ga0075433_10005247 Ga0075433_100052476 207
46 3300006914 Ga0075436_100003018 Ga0075436_1000030189 207
47 3300007076 Ga0075435_100036823 Ga0075435_1000368235 207
48 3300009147 Ga0114129_10019982 Ga0114129_100199828 207
49 3300037418 Ga0395900_0115624 Ga0395900_0115624_1299_2021 207
50 3300037471 Ga0395905_0051876 Ga0395905_0051876_1022_1744 207
51 3300038443 Ga0395901_0065922 Ga0395901_0065922_962_1684 207
52 3300049573 Ga0501037_0213602 Ga0501037_0213602_478_1221 207
53 3300050513 nmdc:mga0rr50_3592_c1 nmdc:mga0rr50_3592_c1_632_1393 207
54 3300050514 nmdc:mga08x19_8661_c1 nmdc:mga08x19_8661_c1_4802_5563 207
55 3300050515 nmdc:mga0a205_905_c1 nmdc:mga0a205_905_c1_10066_10827 207
56 3300005577 Ga0068857_100266075 Ga0068857_1002660752 208
57 3300006852 Ga0075433_10034193 Ga0075433_100341932 208
58 3300006852 Ga0075433_10436310 Ga0075433_104363102 208
59 3300009147 Ga0114129_10461946 Ga0114129_104619461 208
60 3300025922 Ga0207646_10400898 Ga0207646_104008981 208
61 3300026088 Ga0207641_10113348 Ga0207641_101133483 208
62 3300028380 Ga0268265_10418715 Ga0268265_104187152 208
63 3300049576 Ga0501040_0000701 Ga0501040_0000701_1421_2113 208
64 3300049582 Ga0501048_0542039 Ga0501048_0542039_88_780 208
65 3300049743 Ga0501081_0124666 Ga0501081_0124666_638_1354 208
66 3300049743 Ga0501081_0148782 Ga0501081_0148782_458_1150 208
67 3300050507 nmdc:mga05p37_1082487_c1 nmdc:mga05p37_1082487_c1_67_798 208
68 3300050514 nmdc:mga08x19_253115_c1 nmdc:mga08x19_253115_c1_178_915 208
69 3300050515 nmdc:mga0a205_362523_c1 nmdc:mga0a205_362523_c1_233_970 208
70 3300005445 Ga0070708_100045228 Ga0070708_1000452282 209
71 3300005468 Ga0070707_100006754 Ga0070707_10000675411 209
72 3300005471 Ga0070698_100043107 Ga0070698_1000431073 209
73 3300005518 Ga0070699_100002899 Ga0070699_1000028996 209
74 3300005536 Ga0070697_100097122 Ga0070697_1000971222 209
75 3300006844 Ga0075428_100001580 Ga0075428_10000158019 209
76 3300006847 Ga0075431_100000570 Ga0075431_1000005708 209
77 3300006880 Ga0075429_100270945 Ga0075429_1002709452 209
78 3300009147 Ga0114129_10001399 Ga0114129_1000139926 209
79 3300009147 Ga0114129_10146531 Ga0114129_101465313 209
80 3300025910 Ga0207684_10007454 Ga0207684_100074548 209
81 3300025922 Ga0207646_10030439 Ga0207646_100304393 209
82 3300032002 Ga0307416_100101756 Ga0307416_1001017563 209
83 3300050507 nmdc:mga05p37_465263_c1 nmdc:mga05p37_465263_c1_520_1218 209
84 3300050507 nmdc:mga05p37_996_c1 nmdc:mga05p37_996_c1_6892_7632 209
85 3300050508 nmdc:mga09592_242216_c1 nmdc:mga09592_242216_c1_400_1140 209
86 3300050508 nmdc:mga09592_380745_c1 nmdc:mga09592_380745_c1_20_754 209
87 3300050510 nmdc:mga06r32_1127_c1 nmdc:mga06r32_1127_c1_7177_7917 209
88 3300006844 Ga0075428_100234116 Ga0075428_1002341162 210
89 3300006847 Ga0075431_100268707 Ga0075431_1002687072 210
90 3300006852 Ga0075433_10000406 Ga0075433_100004066 210
91 3300006871 Ga0075434_100014316 Ga0075434_1000143163 210
92 3300007076 Ga0075435_100014993 Ga0075435_1000149933 210
93 3300009147 Ga0114129_10003532 Ga0114129_100035324 210
94 3300009147 Ga0114129_10046320 Ga0114129_100463204 210
95 3300050507 nmdc:mga05p37_5745_c1 nmdc:mga05p37_5745_c1_7123_7842 210
96 3300050508 nmdc:mga09592_12730_c1 nmdc:mga09592_12730_c1_4356_5075 210
97 3300050510 nmdc:mga06r32_167967_c1 nmdc:mga06r32_167967_c1_1426_2145 210
98 3300050512 nmdc:mga0n895_1394_c1 nmdc:mga0n895_1394_c1_12771_13490 210
99 3300050512 nmdc:mga0n895_158207_c1 nmdc:mga0n895_158207_c1_648_1385 210
100 3300050513 nmdc:mga0rr50_11020_c1 nmdc:mga0rr50_11020_c1_1883_2602 210
101 3300050515 nmdc:mga0a205_289_c1 nmdc:mga0a205_289_c1_3544_4263 210
102 3300005441 Ga0070700_100156831 Ga0070700_1001568312 211
103 3300005445 Ga0070708_100029207 Ga0070708_1000292073 211
104 3300005467 Ga0070706_100018785 Ga0070706_1000187853 211
105 3300005471 Ga0070698_100301682 Ga0070698_1003016822 211
106 3300005518 Ga0070699_100017146 Ga0070699_1000171464 211
107 3300005981 Ga0081538_10004925 Ga0081538_1000492510 211
108 3300006847 Ga0075431_100071933 Ga0075431_1000719333 211
109 3300006880 Ga0075429_100491624 Ga0075429_1004916241 211
110 3300025910 Ga0207684_10078522 Ga0207684_100785223 211
111 3300025922 Ga0207646_10050010 Ga0207646_100500104 211
112 3300049580 Ga0501046_0151102 Ga0501046_0151102_447_1184 211
113 3300009147 Ga0114129_10088862 Ga0114129_100888622 212
114 3300050507 nmdc:mga05p37_250540_c1 nmdc:mga05p37_250540_c1_1043_1777 212
115 3300005445 Ga0070708_100017047 Ga0070708_1000170476 213
116 3300006844 Ga0075428_100186419 Ga0075428_1001864192 213
117 3300006846 Ga0075430_100012030 Ga0075430_1000120305 213
118 3300006847 Ga0075431_100001027 Ga0075431_1000010278 213
119 3300006847 Ga0075431_100008600 Ga0075431_1000086005 213
120 3300006871 Ga0075434_100240302 Ga0075434_1002403022 213
121 3300006880 Ga0075429_100013173 Ga0075429_1000131734 213
122 3300006880 Ga0075429_100061160 Ga0075429_1000611604 213
123 3300007265 Ga0099794_10004649 Ga0099794_100046493 213
124 3300009147 Ga0114129_10008681 Ga0114129_1000868110 213
125 3300027682 Ga0209971_1028196 Ga0209971_10281962 213
126 3300027695 Ga0209966_1016299 Ga0209966_10162992 213
127 3300027717 Ga0209998_10010487 Ga0209998_100104872 213
128 3300031548 Ga0307408_100090142 Ga0307408_1000901422 213
129 3300031548 Ga0307408_100159227 Ga0307408_1001592272 213
130 3300031911 Ga0307412_10091675 Ga0307412_100916752 213
131 3300049741 Ga0501079_0350681 Ga0501079_0350681_120_821 213
132 3300050507 nmdc:mga05p37_4050_c1 nmdc:mga05p37_4050_c1_8013_8723 213
133 3300050508 nmdc:mga09592_1358_c1 nmdc:mga09592_1358_c1_565_1275 213
134 3300050508 nmdc:mga09592_140027_c1 nmdc:mga09592_140027_c1_397_1107 213
135 3300050509 nmdc:mga0qj67_129925_c1 nmdc:mga0qj67_129925_c1_637_1347 213
136 3300050509 nmdc:mga0qj67_14662_c1 nmdc:mga0qj67_14662_c1_2463_3173 213
137 3300050510 nmdc:mga06r32_11548_c1 nmdc:mga06r32_11548_c1_6125_6835 213
138 3300050510 nmdc:mga06r32_36484_c1 nmdc:mga06r32_36484_c1_2352_3062 213
139 3300050512 nmdc:mga0n895_393205_c1 nmdc:mga0n895_393205_c1_310_1044 213
140 3300054114 Ga0501084_0398884 Ga0501084_0398884_17_715 213
141 3300009094 Ga0111539_10384076 Ga0111539_103840762 214
142 3300049580 Ga0501046_0071769 Ga0501046_0071769_1024_1737 214
143 3300049583 Ga0501067_0015203 Ga0501067_0015203_1642_2355 214
144 3300049585 Ga0501069_0056363 Ga0501069_0056363_440_1153 214
145 3300049587 Ga0501071_0015418 Ga0501071_0015418_2551_3264 214
146 3300049588 Ga0501072_0010362 Ga0501072_0010362_3768_4481 214
147 3300049590 Ga0501074_0292281 Ga0501074_0292281_72_785 214
148 3300049591 Ga0501075_0011213 Ga0501075_0011213_3328_4041 214
149 3300049592 Ga0501076_0204580 Ga0501076_0204580_293_1006 214
150 3300049741 Ga0501079_0018939 Ga0501079_0018939_1559_2272 214
151 3300049743 Ga0501081_0019514 Ga0501081_0019514_3110_3823 214
152 3300049824 Ga0501045_0066206 Ga0501045_0066206_207_920 214
153 3300050511 nmdc:mga08y16_524563_c1 nmdc:mga08y16_524563_c1_160_870 214
154 3300054114 Ga0501084_0008904 Ga0501084_0008904_2890_3603 214
155 3300005330 Ga0070690_100287223 Ga0070690_1002872231 215
156 3300005336 Ga0070680_100098444 Ga0070680_1000984442 215
157 3300005444 Ga0070694_100034829 Ga0070694_1000348293 215
158 3300005445 Ga0070708_100042709 Ga0070708_1000427093 215
159 3300005458 Ga0070681_10205999 Ga0070681_102059992 215
160 3300005467 Ga0070706_100029772 Ga0070706_1000297723 215
161 3300005468 Ga0070707_100167155 Ga0070707_1001671552 215
162 3300005530 Ga0070679_100276860 Ga0070679_1002768602 215
163 3300005536 Ga0070697_100024804 Ga0070697_1000248043 215
164 3300005545 Ga0070695_100274036 Ga0070695_1002740362 215
165 3300005549 Ga0070704_100279204 Ga0070704_1002792042 215
166 3300006844 Ga0075428_100026314 Ga0075428_1000263142 215
167 3300006846 Ga0075430_100124035 Ga0075430_1001240352 215
168 3300006847 Ga0075431_100159485 Ga0075431_1001594852 215
169 3300006880 Ga0075429_100003527 Ga0075429_1000035273 215
170 3300009147 Ga0114129_10209678 Ga0114129_102096782 215
171 3300025910 Ga0207684_10037740 Ga0207684_100377405 215
172 3300025912 Ga0207707_10278792 Ga0207707_102787922 215
173 3300025936 Ga0207670_10186118 Ga0207670_101861181 215
174 3300026121 Ga0207683_10469656 Ga0207683_104696562 215
175 3300035121 Ga0373960_0068969 Ga0373960_0068969_303_1043 215
176 3300035691 Ga0373931_0004575 Ga0373931_0004575_638_1378 215
177 3300048905 Ga0496102_0024544 Ga0496102_0024544_2907_3647 215
178 3300048909 Ga0496106_0081641 Ga0496106_0081641_360_1100 215
179 3300050507 nmdc:mga05p37_234233_c1 nmdc:mga05p37_234233_c1_763_1497 215
180 3300050507 nmdc:mga05p37_3838_c1 nmdc:mga05p37_3838_c1_5099_5842 215
181 3300050510 nmdc:mga06r32_147839_c1 nmdc:mga06r32_147839_c1_1180_1923 215
182 3300050510 nmdc:mga06r32_23646_c1 nmdc:mga06r32_23646_c1_1956_2699 215
183 3300005440 Ga0070705_100018562 Ga0070705_1000185622 216
184 3300005459 Ga0068867_100162170 Ga0068867_1001621702 216
185 3300005546 Ga0070696_100054899 Ga0070696_1000548992 216
186 3300006847 Ga0075431_100074924 Ga0075431_1000749243 216
187 3300007265 Ga0099794_10144923 Ga0099794_101449232 216
188 3300013297 Ga0157378_10125113 Ga0157378_101251132 216
189 3300044673 Ga0453683_0320166 Ga0453683_0320166_291_983 216
190 3300050507 nmdc:mga05p37_94339_c1 nmdc:mga05p37_94339_c1_331_1059 216
191 3300050510 nmdc:mga06r32_93758_c1 nmdc:mga06r32_93758_c1_1793_2509 216
192 3300009094 Ga0111539_10029223 Ga0111539_100292235 217
193 3300042001 Ga0439441_030388 Ga0439441_030388_99_845 217
194 3300050511 nmdc:mga08y16_31488_c1 nmdc:mga08y16_31488_c1_3532_4287 217
195 3300050512 nmdc:mga0n895_50253_c1 nmdc:mga0n895_50253_c1_2854_3609 217
196 3300005445 Ga0070708_100034082 Ga0070708_1000340822 218
197 3300005445 Ga0070708_100162211 Ga0070708_1001622112 218
198 3300005518 Ga0070699_100023070 Ga0070699_1000230702 218
199 3300005536 Ga0070697_100004630 Ga0070697_1000046309 218
200 3300006914 Ga0075436_100014324 Ga0075436_1000143242 218
201 3300009147 Ga0114129_10069697 Ga0114129_100696974 218
202 3300025922 Ga0207646_10216014 Ga0207646_102160142 218
203 3300050507 nmdc:mga05p37_196466_c1 nmdc:mga05p37_196466_c1_892_1617 218
204 3300050512 nmdc:mga0n895_221613_c1 nmdc:mga0n895_221613_c1_1161_1886 218
205 3300050514 nmdc:mga08x19_421129_c1 nmdc:mga08x19_421129_c1_134_871 218
206 3300044673 Ga0453683_0058080 Ga0453683_0058080_859_1605 219
207 3300045051 Ga0451576_0162135 Ga0451576_0162135_563_1309 219
208 3300005468 Ga0070707_100372913 Ga0070707_1003729132 220
209 3300005536 Ga0070697_100177634 Ga0070697_1001776342 220
210 3300006847 Ga0075431_100000603 Ga0075431_10000060312 220
211 3300049578 Ga0501042_0509782 Ga0501042_0509782_59_802 220
212 3300050510 nmdc:mga06r32_610_c1 nmdc:mga06r32_610_c1_19144_19896 220
213 3300060353 Ga0501082_0153019 Ga0501082_0153019_1019_1762 220
214 3300061734 Ga0530510_0036966 Ga0530510_0036966_1976_2719 220
215 3300005295 Ga0065707_10360516 Ga0065707_103605161 222
216 3300005440 Ga0070705_100246479 Ga0070705_1002464792 222
217 3300005444 Ga0070694_100072397 Ga0070694_1000723972 222
218 3300005467 Ga0070706_100238279 Ga0070706_1002382792 222
219 3300005468 Ga0070707_100027472 Ga0070707_1000274722 222
220 3300005468 Ga0070707_100109430 Ga0070707_1001094302 222
221 3300005545 Ga0070695_100208677 Ga0070695_1002086772 222
222 3300005843 Ga0068860_100075153 Ga0068860_1000751532 222
223 3300005844 Ga0068862_100027292 Ga0068862_1000272924 222
224 3300009101 Ga0105247_10186666 Ga0105247_101866662 222
225 3300013308 Ga0157375_10622049 Ga0157375_106220491 222
226 3300014326 Ga0157380_10426379 Ga0157380_104263792 222
227 3300025922 Ga0207646_10088605 Ga0207646_100886052 222
228 3300025922 Ga0207646_10145248 Ga0207646_101452482 222
229 3300025923 Ga0207681_10036213 Ga0207681_100362133 222
230 3300025942 Ga0207689_10182375 Ga0207689_101823752 222
231 3300026089 Ga0207648_10075935 Ga0207648_100759353 222
232 3300026118 Ga0207675_100043910 Ga0207675_1000439103 222
233 3300028380 Ga0268265_10037955 Ga0268265_100379553 222
234 3300049577 Ga0501041_0214534 Ga0501041_0214534_302_1042 222
235 3300049590 Ga0501074_0091378 Ga0501074_0091378_383_1123 222
236 3300049741 Ga0501079_0344420 Ga0501079_0344420_63_803 222
237 3300049743 Ga0501081_0303917 Ga0501081_0303917_269_1009 222
238 3300049824 Ga0501045_0033711 Ga0501045_0033711_2667_3407 222
239 3300005444 Ga0070694_100000980 Ga0070694_10000098012 223
240 3300005467 Ga0070706_100017523 Ga0070706_1000175233 223
241 3300005545 Ga0070695_100000963 Ga0070695_10000096313 223
242 3300025910 Ga0207684_10012804 Ga0207684_100128047 223
243 3300045051 Ga0451576_0017416 Ga0451576_0017416_1967_2704 223
244 3300049576 Ga0501040_0067943 Ga0501040_0067943_837_1574 223
245 3300049743 Ga0501081_0315757 Ga0501081_0315757_208_951 223
246 3300049824 Ga0501045_0426808 Ga0501045_0426808_196_933 223
247 3300003911 JGI25405J52794_10004281 JGI25405J52794_100042812 224
248 3300005328 Ga0070676_10068995 Ga0070676_100689952 224
249 3300005334 Ga0068869_100015054 Ga0068869_1000150543 224
250 3300005440 Ga0070705_100059110 Ga0070705_1000591102 224
251 3300005459 Ga0068867_100203170 Ga0068867_1002031702 224
252 3300005471 Ga0070698_100062332 Ga0070698_1000623321 224
253 3300005536 Ga0070697_100344978 Ga0070697_1003449782 224
254 3300005545 Ga0070695_100039381 Ga0070695_1000393814 224
255 3300005547 Ga0070693_100029078 Ga0070693_1000290783 224
256 3300005549 Ga0070704_100533051 Ga0070704_1005330511 224
257 3300005718 Ga0068866_10153974 Ga0068866_101539742 224
258 3300005844 Ga0068862_100062779 Ga0068862_1000627792 224
259 3300005937 Ga0081455_10025813 Ga0081455_100258135 224
260 3300009553 Ga0105249_10922082 Ga0105249_109220821 224
261 3300025922 Ga0207646_10125944 Ga0207646_101259442 224
262 3300025942 Ga0207689_10005790 Ga0207689_100057907 224
263 3300025961 Ga0207712_10326326 Ga0207712_103263262 224
264 3300026118 Ga0207675_100356093 Ga0207675_1003560932 224
265 3300028380 Ga0268265_10028950 Ga0268265_100289502 224
266 3300035691 Ga0373931_0200310 Ga0373931_0200310_291_1031 224
267 3300045051 Ga0451576_0048050 Ga0451576_0048050_1435_2175 224
268 3300046472 Ga0495580_0083799 Ga0495580_0083799_463_1197 224
269 3300046472 Ga0495580_0123877 Ga0495580_0123877_754_1476 224
270 3300049591 Ga0501075_0215036 Ga0501075_0215036_209_949 224
271 3300049742 Ga0501080_0335832 Ga0501080_0335832_277_1017 224
272 3300060353 Ga0501082_0188722 Ga0501082_0188722_186_926 224

Feature Viewer

pLDDT pTM Quality
68.5 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map