F377877

General Info

Members Datasets Scaffolds Average Seq Length
271 170 542 194

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0036837|Ga0495594_0036837_1906_2613
Length 235
Sequence MEPRWFQGERLNPTSSLRTSTCHLVDAPEHPWHLALTMKRCPWAGADNPLMLEYHDREWGVPVHDDRTHFEFLILEGAQAGLSWSTILNKREGYRRAFSDFDPAKVARYTEKHVAKLLADPGIVRNRLKIASAVRNARAFLAVQKEFGSFDEYCWGFVGGLPKDNRLKAGQRIPATTPESDALSKDLKQRGFNFVGSTVIYAYMQAVGLVNDHLVDCFRYRDIQRLARAHKKRAT

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
95 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
96 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
113 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
114 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
115 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
138 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
139 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
140 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
168 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
169 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
170 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 1.11
Rhizoplane 1.48
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0036837 3300046499 Bacteria 2669
2 rootH1_10252860 3300003323 Bacteria 4769
3 JGI25404J52841_10022454 3300003659 Bacteria 1363
4 Ga0065715_10119106 3300005293 Bacteria 2295
5 Ga0070683_100422807 3300005329 Bacteria 1271
6 Ga0070660_100166933 3300005339 Bacteria 1776
7 Ga0070674_100006479 3300005356 Bacteria 6835
8 Ga0070673_100215032 3300005364 Bacteria 1661
9 Ga0070713_100007786 3300005436 Bacteria 7547
10 Ga0070713_100010102 3300005436 Bacteria 6808
11 Ga0070711_100285081 3300005439 Bacteria 1308
12 Ga0070711_100392024 3300005439 Bacteria 1125
13 Ga0070705_100072943 3300005440 Bacteria 2081
14 Ga0070705_100185233 3300005440 Bacteria 1414
15 Ga0070694_100069149 3300005444 Unclassified 2428
16 Ga0070694_100210504 3300005444 Bacteria 1454
17 Ga0070708_100004808 3300005445 Bacteria 10652
18 Ga0070708_100716122 3300005445 Bacteria 942
19 Ga0070678_100209525 3300005456 Bacteria 1614
20 Ga0070706_100134855 3300005467 Bacteria 2304
21 Ga0070706_100162763 3300005467 Bacteria 2083
22 Ga0070706_100218866 3300005467 Bacteria 1777
23 Ga0070706_100226826 3300005467 Bacteria 1744
24 Ga0070706_100305718 3300005467 Unclassified 1483
25 Ga0070706_100343659 3300005467 Bacteria 1391
26 Ga0070707_100009925 3300005468 Bacteria 8860
27 Ga0070707_100652477 3300005468 Bacteria 1015
28 Ga0070707_100983895 3300005468 Bacteria 809
29 Ga0070698_100006636 3300005471 Bacteria 12548
30 Ga0070698_100012288 3300005471 Bacteria 9066
31 Ga0070698_100027298 3300005471 Bacteria 5939
32 Ga0070699_100011844 3300005518 Bacteria 7526
33 Ga0070699_100014933 3300005518 Bacteria 6675
34 Ga0070699_100292530 3300005518 Bacteria 1460
35 Ga0070699_100338524 3300005518 Bacteria 1354
36 Ga0070699_100365908 3300005518 Bacteria 1300
37 Ga0070684_100647911 3300005535 Bacteria 983
38 Ga0070697_100316492 3300005536 Bacteria 1343
39 Ga0070697_100912550 3300005536 Bacteria 779
40 Ga0070686_100671203 3300005544 Bacteria 824
41 Ga0070696_100062721 3300005546 Bacteria 2602
42 Ga0070696_100210940 3300005546 Bacteria 1454
43 Ga0070704_100155274 3300005549 Bacteria 1804
44 Ga0070704_100384920 3300005549 Bacteria 1193
45 Ga0068864_100163071 3300005618 Bacteria 2027
46 Ga0068860_100706617 3300005843 Bacteria 1018
47 Ga0068860_100760922 3300005843 Bacteria 981
48 Ga0068862_100550785 3300005844 Bacteria 1101
49 Ga0081540_1000570 3300005983 Bacteria 35788
50 Ga0070717_10143347 3300006028 Bacteria 2062
51 Ga0070716_100034369 3300006173 Plasmid 2779
52 Ga0070712_100013861 3300006175 Bacteria 5160
53 Ga0070712_100094947 3300006175 Bacteria 2193
54 Ga0075367_10476547 3300006178 Bacteria 791
55 Ga0097621_100006969 3300006237 Bacteria 8049
56 Ga0068871_100000831 3300006358 Bacteria 20665
57 Ga0068871_100291852 3300006358 Bacteria 1429
58 Ga0075428_100000716 3300006844 Bacteria 34355
59 Ga0075428_100365750 3300006844 Bacteria 1547
60 Ga0075428_100793751 3300006844 Bacteria 1007
61 Ga0075428_100865317 3300006844 Bacteria 959
62 Ga0075430_100002164 3300006846 Bacteria 16261
63 Ga0075431_100008473 3300006847 Bacteria 10295
64 Ga0075431_100115150 3300006847 Bacteria 2775
65 Ga0075433_10043855 3300006852 Unclassified 3884
66 Ga0075433_10299424 3300006852 Bacteria 1424
67 Ga0075433_10758112 3300006852 Bacteria 849
68 Ga0075434_100028575 3300006871 Bacteria 5481
69 Ga0075434_100373202 3300006871 Bacteria 1447
70 Ga0075429_100385759 3300006880 Bacteria 1227
71 Ga0075436_100198290 3300006914 Bacteria 1421
72 Ga0075436_100369576 3300006914 Bacteria 1036
73 Ga0075436_100575905 3300006914 Bacteria 828
74 Ga0099794_10125407 3300007265 Bacteria 1294
75 Ga0099795_10013073 3300007788 Bacteria 2537
76 Ga0105240_10075198 3300009093 Bacteria 4167
77 Ga0111539_10001075 3300009094 Bacteria 36049
78 Ga0111539_10007297 3300009094 Bacteria 14153
79 Ga0111539_10062848 3300009094 Bacteria 4394
80 Ga0111539_10661384 3300009094 Unclassified 1216
81 Ga0114129_10002446 3300009147 Bacteria 25786
82 Ga0114129_10068858 3300009147 Bacteria 4933
83 Ga0114129_10154125 3300009147 Bacteria 3143
84 Ga0114129_10171182 3300009147 Bacteria 2961
85 Ga0105248_10046902 3300009177 Bacteria 4845
86 Ga0105248_10165736 3300009177 Bacteria 2492
87 Ga0099796_10029068 3300010159 Unclassified 1780
88 Ga0157370_10000783 3300013104 Bacteria 39902
89 Ga0163162_11442948 3300013306 Bacteria 783
90 Ga0157376_10261977 3300014969 Bacteria 1620
91 Ga0213876_10136488 3300021384 Bacteria 1305
92 Ga0207653_10137909 3300025885 Bacteria 890
93 Ga0207710_10324081 3300025900 Bacteria 781
94 Ga0207699_10000036 3300025906 Bacteria 129236
95 Ga0207699_10004653 3300025906 Bacteria 6565
96 Ga0207699_10010055 3300025906 Bacteria 4731
97 Ga0207684_10035180 3300025910 Bacteria 4254
98 Ga0207684_10103304 3300025910 Bacteria 2437
99 Ga0207684_10186301 3300025910 Bacteria 1790
100 Ga0207684_10229605 3300025910 Bacteria 1601
101 Ga0207684_10246085 3300025910 Bacteria 1543
102 Ga0207684_10277910 3300025910 Bacteria 1444
103 Ga0207707_11018803 3300025912 Bacteria 679
104 Ga0207693_10010524 3300025915 Bacteria 7506
105 Ga0207693_10016681 3300025915 Bacteria 5866
106 Ga0207663_10224190 3300025916 Bacteria 1369
107 Ga0207657_10001501 3300025919 Bacteria 24948
108 Ga0207646_10004299 3300025922 Bacteria 15552
109 Ga0207646_10010351 3300025922 Bacteria 9122
110 Ga0207646_10185035 3300025922 Bacteria 1881
111 Ga0207646_10212154 3300025922 Bacteria 1749
112 Ga0207646_10248944 3300025922 Bacteria 1605
113 Ga0207646_10533343 3300025922 Bacteria 1056
114 Ga0207646_10846845 3300025922 Bacteria 813
115 Ga0207700_10011163 3300025928 Bacteria 5716
116 Ga0207700_10035227 3300025928 Plasmid 3603
117 Ga0207669_10005342 3300025937 Bacteria 5754
118 Ga0207665_10014487 3300025939 Bacteria 5193
119 Ga0207665_10842262 3300025939 Bacteria 726
120 Ga0207711_10168723 3300025941 Bacteria 1985
121 Ga0207711_10254779 3300025941 Bacteria 1612
122 Ga0207661_10517347 3300025944 Bacteria 1091
123 Ga0207703_10309753 3300026035 Bacteria 1443
124 Ga0207703_10750732 3300026035 Bacteria 930
125 Ga0207676_10230228 3300026095 Bacteria 1656
126 Ga0207683_11180616 3300026121 Bacteria 709
127 Ga0209996_1013993 3300027395 Bacteria 1088
128 Ga0209179_1000901 3300027512 Unclassified 3336
129 Ga0209971_1013355 3300027682 Bacteria 1946
130 Ga0207428_10008026 3300027907 Bacteria 9579
131 Ga0207428_10025820 3300027907 Bacteria 4912
132 Ga0207428_10273419 3300027907 Bacteria 1255
133 Ga0268265_10582545 3300028380 Bacteria 1067
134 Ga0268264_10301866 3300028381 Bacteria 1508
135 Ga0265337_1020276 3300028556 Bacteria 2083
136 Ga0265337_1053120 3300028556 Bacteria 1137
137 Ga0265338_10117390 3300028800 Bacteria 2129
138 Ga0265332_10009286 3300031238 Bacteria 4394
139 Ga0307408_100088097 3300031548 Bacteria 2337
140 Ga0307408_100240538 3300031548 Bacteria 1487
141 Ga0307408_101363777 3300031548 Bacteria 666
142 Ga0265342_10007061 3300031712 Bacteria 8278
143 Ga0316576_10015465 3300031727 Bacteria 5123
144 Ga0316576_10242997 3300031727 Bacteria 1352
145 Ga0307413_10370182 3300031824 Bacteria 1113
146 Ga0307413_10438946 3300031824 Bacteria 1033
147 Ga0307406_10022084 3300031901 Bacteria 3773
148 Ga0307412_10088865 3300031911 Bacteria 2156
149 Ga0307416_100009095 3300032002 Bacteria 6472
150 Ga0307411_10050284 3300032005 Bacteria 2714
151 Ga0307415_100073126 3300032126 Bacteria 2417
152 Ga0316583_10013796 3300032133 Bacteria 2916
153 Ga0316574_0041681 3300035398 Bacteria 2831
154 Ga0373933_0122628 3300035724 Bacteria 1628
155 Ga0373937_0170027 3300036401 Bacteria 2045
156 Ga0373925_0172087 3300037068 Bacteria 1710
157 Ga0395905_0513819 3300037471 Bacteria 1098
158 Ga0395901_0130432 3300038443 Bacteria 2641
159 Ga0395901_0414006 3300038443 Bacteria 1383
160 Ga0439462_0028304 3300042015 Bacteria 1481
161 Ga0439463_056574 3300042016 Bacteria 1002
162 Ga0439464_0000373 3300042439 Bacteria 8743
163 Ga0453683_0291024 3300044673 Bacteria 1044
164 Ga0466966_0644429 3300044684 Bacteria 638
165 Ga0453684_0223782 3300044712 Bacteria 2178
166 Ga0451576_0000281 3300045051 Bacteria 124870
167 Ga0495592_0375805 3300046454 Bacteria 905
168 Ga0495580_0236479 3300046472 Bacteria 1253
169 Ga0495652_0452388 3300046529 Bacteria 899
170 Ga0495613_0106012 3300046689 Bacteria 2028
171 Ga0495676_0295485 3300047321 Bacteria 1094
172 Ga0495614_0271796 3300048089 Bacteria 779
173 Ga0496106_0226361 3300048909 Bacteria 1492
174 Ga0496107_0150425 3300048910 Bacteria 1722
175 Ga0496110_0082018 3300048913 Bacteria 2875
176 Ga0496114_0134447 3300048917 Bacteria 2138
177 Ga0496124_0503130 3300048927 Bacteria 812
178 Ga0501291_004336 3300049514 Bacteria 1808
179 Ga0501292_045784 3300049515 Bacteria 765
180 Ga0501298_004106 3300049521 Bacteria 2282
181 Ga0501299_056146 3300049522 Bacteria 824
182 Ga0501031_0001125 3300049568 Bacteria 16264
183 Ga0501032_0028284 3300049569 Bacteria 3852
184 Ga0501033_0378223 3300049570 Bacteria 989
185 Ga0501033_0392764 3300049570 Bacteria 968
186 Ga0501034_0596085 3300049571 Bacteria 1011
187 Ga0501036_0012526 3300049572 Bacteria 7032
188 Ga0501037_0024265 3300049573 Bacteria 4485
189 Ga0501038_0035172 3300049574 Bacteria 4399
190 Ga0501039_0002258 3300049575 Bacteria 14302
191 Ga0501040_0009573 3300049576 Bacteria 6321
192 Ga0501040_0028888 3300049576 Bacteria 3740
193 Ga0501042_0002580 3300049578 Bacteria 11144
194 Ga0501042_0405366 3300049578 Bacteria 988
195 Ga0501043_0189402 3300049579 Bacteria 1600
196 Ga0501046_0004391 3300049580 Bacteria 12818
197 Ga0501048_0006261 3300049582 Bacteria 9051
198 Ga0501048_0197925 3300049582 Bacteria 1424
199 Ga0501069_0208182 3300049585 Unclassified 1135
200 Ga0501070_0081434 3300049586 Bacteria 2678
201 Ga0501071_0002253 3300049587 Bacteria 11614
202 Ga0501072_0029201 3300049588 Bacteria 4305
203 Ga0501072_0491438 3300049588 Bacteria 971
204 Ga0501073_0041782 3300049589 Bacteria 3239
205 Ga0501073_0540660 3300049589 Bacteria 805
206 Ga0501075_0081512 3300049591 Bacteria 2449
207 Ga0501075_0276444 3300049591 Bacteria 1280
208 Ga0501075_0379828 3300049591 Bacteria 1077
209 Ga0501076_0007410 3300049592 Bacteria 7983
210 Ga0501076_0171311 3300049592 Bacteria 1769
211 Ga0501076_0579565 3300049592 Bacteria 925
212 Ga0501077_0166673 3300049593 Bacteria 1399
213 Ga0501077_0525083 3300049593 Bacteria 759
214 Ga0501198_051647 3300049649 Bacteria 734
215 Ga0501206_035398 3300049653 Bacteria 755
216 Ga0501207_015821 3300049654 Bacteria 1165
217 Ga0501243_033270 3300049675 Bacteria 887
218 Ga0501079_0009253 3300049741 Bacteria 7463
219 Ga0501079_0036248 3300049741 Bacteria 3800
220 Ga0501080_0008401 3300049742 Bacteria 9352
221 Ga0501080_0687612 3300049742 Bacteria 903
222 Ga0501081_0006374 3300049743 Bacteria 7654
223 Ga0501083_0038591 3300049744 Bacteria 3246
224 Ga0501279_054068 3300049775 Bacteria 643
225 Ga0501035_0164761 3300049822 Bacteria 1917
226 Ga0501044_0466615 3300049823 Bacteria 1167
227 Ga0501045_0025081 3300049824 Bacteria 4283
228 Ga0501045_0372515 3300049824 Bacteria 1063
229 nmdc:mga03n38_16599_c1 3300050490 Bacteria 2867
230 nmdc:mga06z11_436325_c1 3300050494 Bacteria 790
231 nmdc:mga05p37_101399_c1 3300050507 Bacteria 3545
232 nmdc:mga05p37_10299_c1 3300050507 Bacteria 11102
233 nmdc:mga05p37_1123624_c1 3300050507 Bacteria 820
234 nmdc:mga05p37_150861_c1 3300050507 Bacteria 2843
235 nmdc:mga05p37_192102_c1 3300050507 Bacteria 2478
236 nmdc:mga05p37_292411_c1 3300050507 Bacteria 1939
237 nmdc:mga05p37_888222_c1 3300050507 Bacteria 963
238 nmdc:mga09592_12951_c1 3300050508 Bacteria 6805
239 nmdc:mga09592_990851_c1 3300050508 Bacteria 703
240 nmdc:mga0qj67_12419_c1 3300050509 Bacteria 6417
241 nmdc:mga0qj67_138328_c1 3300050509 Bacteria 1974
242 nmdc:mga0qj67_246304_c1 3300050509 Unclassified 1450
243 nmdc:mga06r32_435120_c1 3300050510 Bacteria 1292
244 nmdc:mga06r32_608020_c1 3300050510 Bacteria 1064
245 nmdc:mga08y16_136903_c1 3300050511 Bacteria 2545
246 nmdc:mga08y16_31947_c1 3300050511 Bacteria 5536
247 nmdc:mga08y16_4701_c1 3300050511 Bacteria 14232
248 nmdc:mga08y16_874_c1 3300050511 Bacteria 29065
249 nmdc:mga0n895_1216964_c1 3300050512 Bacteria 727
250 nmdc:mga0n895_235210_c1 3300050512 Bacteria 1859
251 nmdc:mga0n895_627643_c1 3300050512 Bacteria 1075
252 nmdc:mga0rr50_344641_c1 3300050513 Bacteria 1252
253 nmdc:mga0rr50_42220_c1 3300050513 Bacteria 3329
254 nmdc:mga08x19_4367_c1 3300050514 Bacteria 8384
255 nmdc:mga0a205_308314_c1 3300050515 Bacteria 1455
256 nmdc:mga0a205_43462_c1 3300050515 Bacteria 4332
257 nmdc:mga0a205_473731_c1 3300050515 Bacteria 1111
258 nmdc:mga0a205_554878_c1 3300050515 Bacteria 1004
259 Ga0500562_157126 3300053108 Unclassified 619
260 Ga0500569_125542 3300053109 Bacteria 856
261 Ga0500616_0011725 3300053153 Bacteria 5160
262 Ga0500637_0007089 3300053178 Bacteria 5584
263 Ga0501084_0003506 3300054114 Bacteria 12750
264 Ga0501084_0764339 3300054114 Bacteria 814
265 Ga0501082_0003557 3300060353 Bacteria 13605
266 Ga0501082_0220519 3300060353 Bacteria 1650
267 Ga0530510_0009531 3300061734 Bacteria 6809
268 2511090104 2510917013 Bacteria 9951648
269 2513554546 2513237082 Bacteria 8640282
270 2513563494 2513237083 Bacteria 8410967
271 8003960240 8003955200 Bacteria 8601927
272 Ga0495594_0036837
273 rootH1_10252860
274 JGI25404J52841_10022454
275 Ga0065715_10119106
276 Ga0070683_100422807
277 Ga0070660_100166933
278 Ga0070674_100006479
279 Ga0070673_100215032
280 Ga0070713_100007786
281 Ga0070713_100010102
282 Ga0070711_100285081
283 Ga0070711_100392024
284 Ga0070705_100072943
285 Ga0070705_100185233
286 Ga0070694_100069149
287 Ga0070694_100210504
288 Ga0070708_100004808
289 Ga0070708_100716122
290 Ga0070678_100209525
291 Ga0070706_100134855
292 Ga0070706_100162763
293 Ga0070706_100218866
294 Ga0070706_100226826
295 Ga0070706_100305718
296 Ga0070706_100343659
297 Ga0070707_100009925
298 Ga0070707_100652477
299 Ga0070707_100983895
300 Ga0070698_100006636
301 Ga0070698_100012288
302 Ga0070698_100027298
303 Ga0070699_100011844
304 Ga0070699_100014933
305 Ga0070699_100292530
306 Ga0070699_100338524
307 Ga0070699_100365908
308 Ga0070684_100647911
309 Ga0070697_100316492
310 Ga0070697_100912550
311 Ga0070686_100671203
312 Ga0070696_100062721
313 Ga0070696_100210940
314 Ga0070704_100155274
315 Ga0070704_100384920
316 Ga0068864_100163071
317 Ga0068860_100706617
318 Ga0068860_100760922
319 Ga0068862_100550785
320 Ga0081540_1000570
321 Ga0070717_10143347
322 Ga0070716_100034369
323 Ga0070712_100013861
324 Ga0070712_100094947
325 Ga0075367_10476547
326 Ga0097621_100006969
327 Ga0068871_100000831
328 Ga0068871_100291852
329 Ga0075428_100000716
330 Ga0075428_100365750
331 Ga0075428_100793751
332 Ga0075428_100865317
333 Ga0075430_100002164
334 Ga0075431_100008473
335 Ga0075431_100115150
336 Ga0075433_10043855
337 Ga0075433_10299424
338 Ga0075433_10758112
339 Ga0075434_100028575
340 Ga0075434_100373202
341 Ga0075429_100385759
342 Ga0075436_100198290
343 Ga0075436_100369576
344 Ga0075436_100575905
345 Ga0099794_10125407
346 Ga0099795_10013073
347 Ga0105240_10075198
348 Ga0111539_10001075
349 Ga0111539_10007297
350 Ga0111539_10062848
351 Ga0111539_10661384
352 Ga0114129_10002446
353 Ga0114129_10068858
354 Ga0114129_10154125
355 Ga0114129_10171182
356 Ga0105248_10046902
357 Ga0105248_10165736
358 Ga0099796_10029068
359 Ga0157370_10000783
360 Ga0163162_11442948
361 Ga0157376_10261977
362 Ga0213876_10136488
363 Ga0207653_10137909
364 Ga0207710_10324081
365 Ga0207699_10000036
366 Ga0207699_10004653
367 Ga0207699_10010055
368 Ga0207684_10035180
369 Ga0207684_10103304
370 Ga0207684_10186301
371 Ga0207684_10229605
372 Ga0207684_10246085
373 Ga0207684_10277910
374 Ga0207707_11018803
375 Ga0207693_10010524
376 Ga0207693_10016681
377 Ga0207663_10224190
378 Ga0207657_10001501
379 Ga0207646_10004299
380 Ga0207646_10010351
381 Ga0207646_10185035
382 Ga0207646_10212154
383 Ga0207646_10248944
384 Ga0207646_10533343
385 Ga0207646_10846845
386 Ga0207700_10011163
387 Ga0207700_10035227
388 Ga0207669_10005342
389 Ga0207665_10014487
390 Ga0207665_10842262
391 Ga0207711_10168723
392 Ga0207711_10254779
393 Ga0207661_10517347
394 Ga0207703_10309753
395 Ga0207703_10750732
396 Ga0207676_10230228
397 Ga0207683_11180616
398 Ga0209996_1013993
399 Ga0209179_1000901
400 Ga0209971_1013355
401 Ga0207428_10008026
402 Ga0207428_10025820
403 Ga0207428_10273419
404 Ga0268265_10582545
405 Ga0268264_10301866
406 Ga0265337_1020276
407 Ga0265337_1053120
408 Ga0265338_10117390
409 Ga0265332_10009286
410 Ga0307408_100088097
411 Ga0307408_100240538
412 Ga0307408_101363777
413 Ga0265342_10007061
414 Ga0316576_10015465
415 Ga0316576_10242997
416 Ga0307413_10370182
417 Ga0307413_10438946
418 Ga0307406_10022084
419 Ga0307412_10088865
420 Ga0307416_100009095
421 Ga0307411_10050284
422 Ga0307415_100073126
423 Ga0316583_10013796
424 Ga0316574_0041681
425 Ga0373933_0122628
426 Ga0373937_0170027
427 Ga0373925_0172087
428 Ga0395905_0513819
429 Ga0395901_0130432
430 Ga0395901_0414006
431 Ga0439462_0028304
432 Ga0439463_056574
433 Ga0439464_0000373
434 Ga0453683_0291024
435 Ga0466966_0644429
436 Ga0453684_0223782
437 Ga0451576_0000281
438 Ga0495592_0375805
439 Ga0495580_0236479
440 Ga0495652_0452388
441 Ga0495613_0106012
442 Ga0495676_0295485
443 Ga0495614_0271796
444 Ga0496106_0226361
445 Ga0496107_0150425
446 Ga0496110_0082018
447 Ga0496114_0134447
448 Ga0496124_0503130
449 Ga0501291_004336
450 Ga0501292_045784
451 Ga0501298_004106
452 Ga0501299_056146
453 Ga0501031_0001125
454 Ga0501032_0028284
455 Ga0501033_0378223
456 Ga0501033_0392764
457 Ga0501034_0596085
458 Ga0501036_0012526
459 Ga0501037_0024265
460 Ga0501038_0035172
461 Ga0501039_0002258
462 Ga0501040_0009573
463 Ga0501040_0028888
464 Ga0501042_0002580
465 Ga0501042_0405366
466 Ga0501043_0189402
467 Ga0501046_0004391
468 Ga0501048_0006261
469 Ga0501048_0197925
470 Ga0501069_0208182
471 Ga0501070_0081434
472 Ga0501071_0002253
473 Ga0501072_0029201
474 Ga0501072_0491438
475 Ga0501073_0041782
476 Ga0501073_0540660
477 Ga0501075_0081512
478 Ga0501075_0276444
479 Ga0501075_0379828
480 Ga0501076_0007410
481 Ga0501076_0171311
482 Ga0501076_0579565
483 Ga0501077_0166673
484 Ga0501077_0525083
485 Ga0501198_051647
486 Ga0501206_035398
487 Ga0501207_015821
488 Ga0501243_033270
489 Ga0501079_0009253
490 Ga0501079_0036248
491 Ga0501080_0008401
492 Ga0501080_0687612
493 Ga0501081_0006374
494 Ga0501083_0038591
495 Ga0501279_054068
496 Ga0501035_0164761
497 Ga0501044_0466615
498 Ga0501045_0025081
499 Ga0501045_0372515
500 nmdc:mga03n38_16599_c1
501 nmdc:mga06z11_436325_c1
502 nmdc:mga05p37_101399_c1
503 nmdc:mga05p37_10299_c1
504 nmdc:mga05p37_1123624_c1
505 nmdc:mga05p37_150861_c1
506 nmdc:mga05p37_192102_c1
507 nmdc:mga05p37_292411_c1
508 nmdc:mga05p37_888222_c1
509 nmdc:mga09592_12951_c1
510 nmdc:mga09592_990851_c1
511 nmdc:mga0qj67_12419_c1
512 nmdc:mga0qj67_138328_c1
513 nmdc:mga0qj67_246304_c1
514 nmdc:mga06r32_435120_c1
515 nmdc:mga06r32_608020_c1
516 nmdc:mga08y16_136903_c1
517 nmdc:mga08y16_31947_c1
518 nmdc:mga08y16_4701_c1
519 nmdc:mga08y16_874_c1
520 nmdc:mga0n895_1216964_c1
521 nmdc:mga0n895_235210_c1
522 nmdc:mga0n895_627643_c1
523 nmdc:mga0rr50_344641_c1
524 nmdc:mga0rr50_42220_c1
525 nmdc:mga08x19_4367_c1
526 nmdc:mga0a205_308314_c1
527 nmdc:mga0a205_43462_c1
528 nmdc:mga0a205_473731_c1
529 nmdc:mga0a205_554878_c1
530 Ga0500562_157126
531 Ga0500569_125542
532 Ga0500616_0011725
533 Ga0500637_0007089
534 Ga0501084_0003506
535 Ga0501084_0764339
536 Ga0501082_0003557
537 Ga0501082_0220519
538 Ga0530510_0009531
539 2511090104
540 2513554546
541 2513563494
542 8003960240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

43

220

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9765 7 185
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9762 16 185
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9696 16 185
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9569 12 185
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9554 7 185
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9806 6 184 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9668 6 187 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9637 12 185 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9465 6 187 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.945 6 185 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A4Q4XET6-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9919 20 181 GO:0006284
GO:0008725
GO:0016491
GO:0046872
AF-A0A3S4K5J3-F1-model_v4 DNA-3-methyladenine glycosylase I (EC 3.2.2.20) 0.9895 33 184 GO:0006284
GO:0008725
GO:0046872
AF-A0A4P8S8J9-F1-model_v4 DNA-3-methyladenine glycosylase I 0.989 5 185 GO:0006284
GO:0008725
GO:0046872
AF-A0A534C2K8-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9888 6 106 GO:0006284
GO:0008725
GO:0046872
AF-A0A7X4EW98-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9884 8 168 GO:0006284
GO:0008725
GO:0046872

Map