F377768

General Info

Members Datasets Scaffolds Average Seq Length
271 189 542 243

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100100396|Ga0307416_1001003962
Length 282
Sequence MEQNPEVGLGHSWVSCSSDSWLVGPVPDTEQGTKPHTGRRSVTVISRLIRKLERRDVLSGEEKQALKSAVARVKEARMDEDLVREGDRPSESTLLLEGFAARYKLLRNGRRQITALHIPGDFVDLHSFLLKTMDHGVVALTPCRVGLVPHSTLREITETYLHLGRLLWLSTLIDAAIHREWLVAMGRRPAFNQIAHLLCELFLRLQAVGLTQGMSFELPLTQAELGDVLGLSTVHVNRVIQQLRADGLVTWSEQRIAIEDWAQLQEVAEFDPTFLNLDNEPR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
95 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
117 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
118 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
119 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
133 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
134 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
135 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
136 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
137 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
138 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
139 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
140 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
141 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
144 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
145 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
146 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
147 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
162 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
163 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
172 2643221718 Rhizobium sp. Root268 Isolate Unclassified
173 2643221736 Bosea sp. Root483D1 Isolate Unclassified
174 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
175 2773857925 Microvirga vignae BR3299 Isolate Unclassified
176 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
177 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
178 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
179 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
180 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
181 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
182 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
183 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
184 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
185 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
186 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
187 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
188 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
189 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.88
Metatranscriptomes 0
Isolates 8.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.25
Nodule 1.48
Rhizoplane 1.85
Rhizosphere 61.99
Stem 0
Stem Tuber 0.37
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100100396 3300032002 Bacteria 2517
2 JGI24741J21665_1005394 3300001915 Bacteria 2683
3 JGI24740J21852_10002342 3300001979 Bacteria 8624
4 JGI24739J22299_10060304 3300001989 Bacteria 1201
5 JGI25159J45721_1000859 3300002987 Bacteria 13230
6 Ga0065165_1000044 3300005262 Bacteria 203774
7 Ga0065165_1004106 3300005262 Bacteria 9387
8 Ga0070658_10013918 3300005327 Bacteria 6459
9 Ga0070668_100028577 3300005347 Bacteria 4232
10 Ga0070671_100342329 3300005355 Unclassified 1276
11 Ga0070674_100143792 3300005356 Bacteria 1793
12 Ga0070667_100010891 3300005367 Bacteria 7522
13 Ga0070663_100039905 3300005455 Bacteria 3284
14 Ga0068853_100004832 3300005539 Bacteria 10471
15 Ga0070686_100001601 3300005544 Bacteria 12729
16 Ga0070665_100000080 3300005548 Bacteria 185165
17 Ga0070665_100129078 3300005548 Bacteria 2530
18 Ga0070664_100568195 3300005564 Bacteria 1050
19 Ga0068857_100156599 3300005577 Bacteria 2066
20 Ga0068854_100146290 3300005578 Bacteria 1818
21 Ga0068856_100598394 3300005614 Bacteria 1124
22 Ga0068852_100068575 3300005616 Bacteria 3105
23 Ga0068852_100198445 3300005616 Bacteria 1898
24 Ga0068859_100000783 3300005617 Bacteria 32120
25 Ga0068864_100002274 3300005618 Bacteria 15886
26 Ga0068861_100110779 3300005719 Bacteria 2199
27 Ga0068863_100087592 3300005841 Bacteria 2950
28 Ga0068863_100121938 3300005841 Bacteria 2486
29 Ga0068860_100063691 3300005843 Bacteria 3501
30 Ga0068862_100015334 3300005844 Bacteria 6364
31 Ga0068862_100233284 3300005844 Bacteria 1670
32 Ga0075365_10002421 3300006038 Bacteria 9145
33 Ga0075365_10099496 3300006038 Bacteria 1990
34 Ga0075368_10088805 3300006042 Bacteria 1263
35 Ga0075363_100052854 3300006048 Bacteria 2169
36 Ga0075363_100102539 3300006048 Bacteria 1584
37 Ga0075364_10000795 3300006051 Bacteria 16652
38 Ga0075364_10080849 3300006051 Bacteria 2148
39 Ga0075364_10108547 3300006051 Unclassified 1851
40 Ga0075364_10115775 3300006051 Unclassified 1792
41 Ga0075362_10003275 3300006177 Bacteria 5628
42 Ga0075362_10037643 3300006177 Unclassified 2122
43 Ga0075367_10001808 3300006178 Bacteria 9417
44 Ga0075367_10008349 3300006178 Bacteria 5365
45 Ga0075369_10014915 3300006186 Bacteria 3111
46 Ga0075366_10007374 3300006195 Bacteria 6071
47 Ga0075366_10120051 3300006195 Bacteria 1584
48 Ga0075366_10217401 3300006195 Unclassified 1164
49 Ga0075370_10009955 3300006353 Bacteria 4954
50 Ga0075370_10014759 3300006353 Bacteria 4171
51 Ga0075370_10103703 3300006353 Bacteria 1648
52 Ga0097620_100000783 3300006931 Bacteria 32120
53 Ga0105250_10027166 3300009092 Bacteria 2306
54 Ga0105245_10128621 3300009098 Unclassified 2374
55 Ga0105247_10300802 3300009101 Bacteria 1113
56 Ga0105237_10029626 3300009545 Bacteria 5562
57 Ga0105237_10849785 3300009545 Unclassified 919
58 Ga0105238_10020153 3300009551 Bacteria 6787
59 Ga0105238_10058740 3300009551 Bacteria 3855
60 Ga0105238_10066873 3300009551 Bacteria 3595
61 Ga0105239_10006893 3300010375 Bacteria 13107
62 Ga0105239_10066076 3300010375 Bacteria 3973
63 Ga0105239_10613940 3300010375 Unclassified 1241
64 Ga0105246_10307823 3300011119 Bacteria 1282
65 Ga0105246_10472841 3300011119 Bacteria 1058
66 Ga0157371_10008220 3300013102 Bacteria 8340
67 Ga0157370_10003410 3300013104 Bacteria 18668
68 Ga0157370_10070835 3300013104 Bacteria 3291
69 Ga0157370_10085847 3300013104 Bacteria 2957
70 Ga0157369_10006876 3300013105 Bacteria 13126
71 Ga0157369_10020847 3300013105 Bacteria 7327
72 Ga0157374_10076621 3300013296 Bacteria 3162
73 Ga0163162_10028372 3300013306 Bacteria 5538
74 Ga0163163_10300084 3300014325 Bacteria 1659
75 Ga0163163_10428385 3300014325 Bacteria 1382
76 Ga0182008_10022636 3300014497 Bacteria 3218
77 Ga0157379_10004595 3300014968 Bacteria 11843
78 Ga0182007_10025703 3300015262 Bacteria 2048
79 Ga0182005_1027717 3300015265 Bacteria 1544
80 Ga0213876_10010373 3300021384 Bacteria 5002
81 Ga0209130_1000089 3300025284 Bacteria 152711
82 Ga0209025_1020556 3300025294 Bacteria 3604
83 Ga0207696_1060019 3300025711 Bacteria 1071
84 Ga0207682_10139866 3300025893 Bacteria 1086
85 Ga0207688_10275321 3300025901 Bacteria 1024
86 Ga0207647_10013729 3300025904 Bacteria 5610
87 Ga0207705_10020744 3300025909 Bacteria 4690
88 Ga0207695_10020181 3300025913 Bacteria 7640
89 Ga0207671_10022114 3300025914 Bacteria 4813
90 Ga0207681_10081882 3300025923 Bacteria 2280
91 Ga0207694_10002634 3300025924 Bacteria 14548
92 Ga0207694_10040263 3300025924 Bacteria 3597
93 Ga0207694_10620145 3300025924 Bacteria 910
94 Ga0207687_10071415 3300025927 Unclassified 2480
95 Ga0207644_10378371 3300025931 Unclassified 1154
96 Ga0207711_10000244 3300025941 Bacteria 58260
97 Ga0207689_10474964 3300025942 Unclassified 1046
98 Ga0207667_10380372 3300025949 Unclassified 1438
99 Ga0207651_10006153 3300025960 Bacteria 6244
100 Ga0207668_10018304 3300025972 Bacteria 4405
101 Ga0207640_10140615 3300025981 Bacteria 1759
102 Ga0207658_10005035 3300025986 Bacteria 9101
103 Ga0207703_10027804 3300026035 Bacteria 4454
104 Ga0207639_10016159 3300026041 Bacteria 5273
105 Ga0207702_10083554 3300026078 Bacteria 2778
106 Ga0207641_10174899 3300026088 Bacteria 1962
107 Ga0207698_10053096 3300026142 Bacteria 3109
108 Ga0207698_10309880 3300026142 Bacteria 1474
109 Ga0207698_10497398 3300026142 Bacteria 1186
110 Ga0209813_10000158 3300027866 Bacteria 22914
111 Ga0209813_10001696 3300027866 Bacteria 4966
112 Ga0209974_10037178 3300027876 Bacteria 1616
113 Ga0268266_10000055 3300028379 Bacteria 291630
114 Ga0268266_10044223 3300028379 Bacteria 3807
115 Ga0268265_10102357 3300028380 Bacteria 2316
116 Ga0268264_10003356 3300028381 Bacteria 13841
117 Ga0268264_10104972 3300028381 Bacteria 2464
118 Ga0307413_10000319 3300031824 Bacteria 14991
119 Ga0307410_10004584 3300031852 Bacteria 7168
120 Ga0307410_10310277 3300031852 Bacteria 1248
121 Ga0307406_10509215 3300031901 Bacteria 977
122 Ga0307407_10281770 3300031903 Bacteria 1151
123 Ga0307412_10439631 3300031911 Unclassified 1072
124 Ga0307409_100230396 3300031995 Bacteria 1679
125 Ga0307409_100328801 3300031995 Unclassified 1433
126 Ga0307416_100025962 3300032002 Bacteria 4308
127 Ga0307416_100475837 3300032002 Bacteria 1308
128 Ga0307414_10049583 3300032004 Plasmid 2904
129 Ga0307411_10001575 3300032005 Bacteria 9463
130 Ga0307411_10498282 3300032005 Bacteria 1029
131 Ga0307415_100413851 3300032126 Bacteria 1155
132 Ga0237819_00932 3300038705 Bacteria 8990
133 Ga0237819_11380 3300038705 Bacteria 1129
134 Ga0237816_00745 3300039145 Bacteria 2725
135 Ga0436365_1912822 3300039437 Bacteria 6964
136 Ga0451791_1120109 3300041451 Bacteria 1315
137 Ga0439434_0042039 3300042435 Bacteria 1405
138 Ga0495606_0002073 3300046507 Bacteria 24490
139 Ga0495671_0091451 3300046692 Unclassified 1489
140 Ga0495672_0057632 3300047320 Unclassified 2255
141 Ga0495686_0000920 3300047472 Bacteria 36782
142 Ga0495686_0002178 3300047472 Bacteria 19063
143 Ga0495686_0015747 3300047472 Bacteria 5151
144 Ga0495686_0051759 3300047472 Bacteria 2576
145 Ga0496110_0703676 3300048913 Bacteria 912
146 Ga0496111_0271117 3300048914 Bacteria 1259
147 Ga0496113_0353894 3300048916 Bacteria 1178
148 Ga0496114_0419228 3300048917 Bacteria 1186
149 Ga0496117_0174747 3300048920 Bacteria 1242
150 Ga0496118_0006137 3300048921 Bacteria 13341
151 Ga0496119_0109800 3300048922 Bacteria 1533
152 Ga0496121_0014024 3300048924 Bacteria 8555
153 Ga0496121_0015059 3300048924 Bacteria 8140
154 Ga0496122_0003964 3300048925 Bacteria 18914
155 Ga0496122_0064547 3300048925 Bacteria 2663
156 Ga0496123_0002609 3300048926 Bacteria 21896
157 Ga0496123_0085584 3300048926 Bacteria 1896
158 Ga0496124_0000397 3300048927 Bacteria 79293
159 Ga0496124_0453031 3300048927 Bacteria 874
160 Ga0496125_0000294 3300048928 Bacteria 98233
161 Ga0496125_0002886 3300048928 Bacteria 21646
162 Ga0496126_0094744 3300048929 Bacteria 2620
163 Ga0501290_000122 3300049513 Bacteria 11951
164 Ga0501290_003362 3300049513 Bacteria 2023
165 Ga0501292_000002 3300049515 Bacteria 188289
166 Ga0501294_000666 3300049517 Bacteria 3868
167 Ga0501300_000788 3300049523 Bacteria 4801
168 Ga0501300_004738 3300049523 Bacteria 2011
169 Ga0501032_0000524 3300049569 Bacteria 31194
170 Ga0501032_0256141 3300049569 Bacteria 1135
171 Ga0501033_0000732 3300049570 Bacteria 30126
172 Ga0501033_0251590 3300049570 Bacteria 1252
173 Ga0501034_0001550 3300049571 Bacteria 30141
174 Ga0501034_0031724 3300049571 Bacteria 5367
175 Ga0501034_0040875 3300049571 Bacteria 4692
176 Ga0501034_0054146 3300049571 Bacteria 4039
177 Ga0501034_0088967 3300049571 Bacteria 3085
178 Ga0501034_0114447 3300049571 Bacteria 2686
179 Ga0501034_0255531 3300049571 Bacteria 1696
180 Ga0501034_0451988 3300049571 Bacteria 1202
181 Ga0501036_0000414 3300049572 Bacteria 30141
182 Ga0501036_0175293 3300049572 Bacteria 1806
183 Ga0501037_0000509 3300049573 Bacteria 31179
184 Ga0501038_0000684 3300049574 Bacteria 30141
185 Ga0501039_0000437 3300049575 Bacteria 30141
186 Ga0501040_0018509 3300049576 Bacteria 4625
187 Ga0501043_0002307 3300049579 Bacteria 16171
188 Ga0501047_0008784 3300049581 Bacteria 9534
189 Ga0501070_0066682 3300049586 Bacteria 2981
190 Ga0501070_0737179 3300049586 Bacteria 777
191 Ga0501073_0111999 3300049589 Bacteria 1893
192 Ga0501202_001594 3300049652 Bacteria 3669
193 Ga0501206_001646 3300049653 Bacteria 2796
194 Ga0501222_001205 3300049662 Bacteria 3650
195 Ga0501223_000104 3300049663 Bacteria 24070
196 Ga0501223_003262 3300049663 Bacteria 3543
197 Ga0501224_000516 3300049664 Bacteria 4699
198 Ga0501227_010054 3300049665 Bacteria 2046
199 Ga0501227_010190 3300049665 Bacteria 2034
200 Ga0501235_000722 3300049669 Bacteria 6735
201 Ga0501257_000041 3300049686 Bacteria 36608
202 Ga0501257_052535 3300049686 Bacteria 1018
203 Ga0501261_000025 3300049690 Bacteria 36093
204 Ga0501221_002093 3300049704 Bacteria 3320
205 Ga0501225_0003116 3300049705 Bacteria 5065
206 Ga0501245_002082 3300049708 Bacteria 2655
207 Ga0501279_000003 3300049775 Bacteria 188296
208 Ga0501280_000009 3300049776 Bacteria 66042
209 Ga0501280_000355 3300049776 Bacteria 11410
210 Ga0501281_00013 3300049777 Bacteria 24830
211 Ga0501283_001781 3300049779 Bacteria 2794
212 Ga0501035_0000986 3300049822 Bacteria 30120
213 Ga0501044_0001253 3300049823 Bacteria 30141
214 nmdc:mga03683_7120_c1 3300050489 Bacteria 3867
215 nmdc:mga03n38_37071_c1 3300050490 Bacteria 2101
216 nmdc:mga03n38_43522_c1 3300050490 Bacteria 1968
217 nmdc:mga03n38_81672_c1 3300050490 Bacteria 1520
218 nmdc:mga00v17_102125_c1 3300050491 Unclassified 1811
219 nmdc:mga00v17_2176_c1 3300050491 Bacteria 10066
220 nmdc:mga00v17_34482_c1 3300050491 Bacteria 3007
221 nmdc:mga00v17_34483_c1 3300050491 Bacteria 3007
222 nmdc:mga0yw44_136164_c1 3300050492 Bacteria 1593
223 nmdc:mga0yw44_198_c1 3300050492 Bacteria 21245
224 nmdc:mga0k408_408693_c1 3300050493 Bacteria 808
225 nmdc:mga0k408_5007_c1 3300050493 Bacteria 7017
226 nmdc:mga06z11_549_c1 3300050494 Bacteria 13773
227 nmdc:mga06z11_77054_c1 3300050494 Bacteria 1779
228 nmdc:mga06z11_971_c1 3300050494 Bacteria 10453
229 nmdc:mga04h51_73_c1 3300050495 Bacteria 32039
230 nmdc:mga04h51_8582_c1 3300050495 Bacteria 2737
231 nmdc:mga07m45_2062_c1 3300050496 Bacteria 6413
232 nmdc:mga07m45_273808_c1 3300050496 Bacteria 982
233 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
234 nmdc:mga0sz30_2016_c1 3300050516 Bacteria 7255
235 nmdc:mga0sz30_25412_c1 3300050516 Bacteria 1389
236 Ga0500643_001667 3300053087 Bacteria 12375
237 Ga0500643_008609 3300053087 Bacteria 3995
238 Ga0500646_0005291 3300053090 Bacteria 3263
239 Ga0500566_0000542 3300053094 Bacteria 21143
240 Ga0500593_000036 3300053117 Bacteria 47889
241 Ga0500607_000006 3300053121 Bacteria 136863
242 Ga0500608_079757 3300053122 Bacteria 1546
243 Ga0500559_0000125 3300053136 Bacteria 59849
244 Ga0500573_0000042 3300053140 Bacteria 103567
245 Ga0500604_0000015 3300053151 Bacteria 92018
246 Ga0500616_0046083 3300053153 Bacteria 2319
247 Ga0500616_0084069 3300053153 Bacteria 1593
248 Ga0500637_0002350 3300053178 Bacteria 8381
249 Ga0500645_004069 3300053730 Bacteria 5730
250 2644209253 2643221637 Bacteria 5345260
251 2644652755 2643221718 Bacteria 5345506
252 2644743680 2643221736 Bacteria 6608466
253 2715500088 2713897090 Bacteria 3353799
254 2774873227 2773857925 Bacteria 6472445
255 2774873684 2773857925 Bacteria 6472445
256 2776262414 2775506901 Bacteria 9631051
257 2834578312 2834578030 Bacteria 3530182
258 2835315168 2835312727 Bacteria 7413381
259 2842923098 2842922631 Bacteria 5824079
260 2855020656 2855020534 Bacteria 3204685
261 2899261096 2899259804 Bacteria 3320927
262 2899276731 2899275550 Bacteria 3958688
263 2903451863 2903448605 Bacteria 7357801
264 2928526037 2928521798 Bacteria 4960112
265 2928973633 2928972540 Bacteria 3058286
266 2928974483 2928972540 Bacteria 3058286
267 2968088493 2968083720 Bacteria 7351627
268 2977241032 2977240413 Bacteria 3191065
269 2977243402 2977240413 Bacteria 3191065
270 8002286725 8002285264 Bacteria 6717907
271 8057133814 8057132660 Bacteria 4061191
272 Ga0307416_100100396
273 JGI24741J21665_1005394
274 JGI24740J21852_10002342
275 JGI24739J22299_10060304
276 JGI25159J45721_1000859
277 Ga0065165_1000044
278 Ga0065165_1004106
279 Ga0070658_10013918
280 Ga0070668_100028577
281 Ga0070671_100342329
282 Ga0070674_100143792
283 Ga0070667_100010891
284 Ga0070663_100039905
285 Ga0068853_100004832
286 Ga0070686_100001601
287 Ga0070665_100000080
288 Ga0070665_100129078
289 Ga0070664_100568195
290 Ga0068857_100156599
291 Ga0068854_100146290
292 Ga0068856_100598394
293 Ga0068852_100068575
294 Ga0068852_100198445
295 Ga0068859_100000783
296 Ga0068864_100002274
297 Ga0068861_100110779
298 Ga0068863_100087592
299 Ga0068863_100121938
300 Ga0068860_100063691
301 Ga0068862_100015334
302 Ga0068862_100233284
303 Ga0075365_10002421
304 Ga0075365_10099496
305 Ga0075368_10088805
306 Ga0075363_100052854
307 Ga0075363_100102539
308 Ga0075364_10000795
309 Ga0075364_10080849
310 Ga0075364_10108547
311 Ga0075364_10115775
312 Ga0075362_10003275
313 Ga0075362_10037643
314 Ga0075367_10001808
315 Ga0075367_10008349
316 Ga0075369_10014915
317 Ga0075366_10007374
318 Ga0075366_10120051
319 Ga0075366_10217401
320 Ga0075370_10009955
321 Ga0075370_10014759
322 Ga0075370_10103703
323 Ga0097620_100000783
324 Ga0105250_10027166
325 Ga0105245_10128621
326 Ga0105247_10300802
327 Ga0105237_10029626
328 Ga0105237_10849785
329 Ga0105238_10020153
330 Ga0105238_10058740
331 Ga0105238_10066873
332 Ga0105239_10006893
333 Ga0105239_10066076
334 Ga0105239_10613940
335 Ga0105246_10307823
336 Ga0105246_10472841
337 Ga0157371_10008220
338 Ga0157370_10003410
339 Ga0157370_10070835
340 Ga0157370_10085847
341 Ga0157369_10006876
342 Ga0157369_10020847
343 Ga0157374_10076621
344 Ga0163162_10028372
345 Ga0163163_10300084
346 Ga0163163_10428385
347 Ga0182008_10022636
348 Ga0157379_10004595
349 Ga0182007_10025703
350 Ga0182005_1027717
351 Ga0213876_10010373
352 Ga0209130_1000089
353 Ga0209025_1020556
354 Ga0207696_1060019
355 Ga0207682_10139866
356 Ga0207688_10275321
357 Ga0207647_10013729
358 Ga0207705_10020744
359 Ga0207695_10020181
360 Ga0207671_10022114
361 Ga0207681_10081882
362 Ga0207694_10002634
363 Ga0207694_10040263
364 Ga0207694_10620145
365 Ga0207687_10071415
366 Ga0207644_10378371
367 Ga0207711_10000244
368 Ga0207689_10474964
369 Ga0207667_10380372
370 Ga0207651_10006153
371 Ga0207668_10018304
372 Ga0207640_10140615
373 Ga0207658_10005035
374 Ga0207703_10027804
375 Ga0207639_10016159
376 Ga0207702_10083554
377 Ga0207641_10174899
378 Ga0207698_10053096
379 Ga0207698_10309880
380 Ga0207698_10497398
381 Ga0209813_10000158
382 Ga0209813_10001696
383 Ga0209974_10037178
384 Ga0268266_10000055
385 Ga0268266_10044223
386 Ga0268265_10102357
387 Ga0268264_10003356
388 Ga0268264_10104972
389 Ga0307413_10000319
390 Ga0307410_10004584
391 Ga0307410_10310277
392 Ga0307406_10509215
393 Ga0307407_10281770
394 Ga0307412_10439631
395 Ga0307409_100230396
396 Ga0307409_100328801
397 Ga0307416_100025962
398 Ga0307416_100475837
399 Ga0307414_10049583
400 Ga0307411_10001575
401 Ga0307411_10498282
402 Ga0307415_100413851
403 Ga0237819_00932
404 Ga0237819_11380
405 Ga0237816_00745
406 Ga0436365_1912822
407 Ga0451791_1120109
408 Ga0439434_0042039
409 Ga0495606_0002073
410 Ga0495671_0091451
411 Ga0495672_0057632
412 Ga0495686_0000920
413 Ga0495686_0002178
414 Ga0495686_0015747
415 Ga0495686_0051759
416 Ga0496110_0703676
417 Ga0496111_0271117
418 Ga0496113_0353894
419 Ga0496114_0419228
420 Ga0496117_0174747
421 Ga0496118_0006137
422 Ga0496119_0109800
423 Ga0496121_0014024
424 Ga0496121_0015059
425 Ga0496122_0003964
426 Ga0496122_0064547
427 Ga0496123_0002609
428 Ga0496123_0085584
429 Ga0496124_0000397
430 Ga0496124_0453031
431 Ga0496125_0000294
432 Ga0496125_0002886
433 Ga0496126_0094744
434 Ga0501290_000122
435 Ga0501290_003362
436 Ga0501292_000002
437 Ga0501294_000666
438 Ga0501300_000788
439 Ga0501300_004738
440 Ga0501032_0000524
441 Ga0501032_0256141
442 Ga0501033_0000732
443 Ga0501033_0251590
444 Ga0501034_0001550
445 Ga0501034_0031724
446 Ga0501034_0040875
447 Ga0501034_0054146
448 Ga0501034_0088967
449 Ga0501034_0114447
450 Ga0501034_0255531
451 Ga0501034_0451988
452 Ga0501036_0000414
453 Ga0501036_0175293
454 Ga0501037_0000509
455 Ga0501038_0000684
456 Ga0501039_0000437
457 Ga0501040_0018509
458 Ga0501043_0002307
459 Ga0501047_0008784
460 Ga0501070_0066682
461 Ga0501070_0737179
462 Ga0501073_0111999
463 Ga0501202_001594
464 Ga0501206_001646
465 Ga0501222_001205
466 Ga0501223_000104
467 Ga0501223_003262
468 Ga0501224_000516
469 Ga0501227_010054
470 Ga0501227_010190
471 Ga0501235_000722
472 Ga0501257_000041
473 Ga0501257_052535
474 Ga0501261_000025
475 Ga0501221_002093
476 Ga0501225_0003116
477 Ga0501245_002082
478 Ga0501279_000003
479 Ga0501280_000009
480 Ga0501280_000355
481 Ga0501281_00013
482 Ga0501283_001781
483 Ga0501035_0000986
484 Ga0501044_0001253
485 nmdc:mga03683_7120_c1
486 nmdc:mga03n38_37071_c1
487 nmdc:mga03n38_43522_c1
488 nmdc:mga03n38_81672_c1
489 nmdc:mga00v17_102125_c1
490 nmdc:mga00v17_2176_c1
491 nmdc:mga00v17_34482_c1
492 nmdc:mga00v17_34483_c1
493 nmdc:mga0yw44_136164_c1
494 nmdc:mga0yw44_198_c1
495 nmdc:mga0k408_408693_c1
496 nmdc:mga0k408_5007_c1
497 nmdc:mga06z11_549_c1
498 nmdc:mga06z11_77054_c1
499 nmdc:mga06z11_971_c1
500 nmdc:mga04h51_73_c1
501 nmdc:mga04h51_8582_c1
502 nmdc:mga07m45_2062_c1
503 nmdc:mga07m45_273808_c1
504 nmdc:mga07m45_5_c2
505 nmdc:mga0sz30_2016_c1
506 nmdc:mga0sz30_25412_c1
507 Ga0500643_001667
508 Ga0500643_008609
509 Ga0500646_0005291
510 Ga0500566_0000542
511 Ga0500593_000036
512 Ga0500607_000006
513 Ga0500608_079757
514 Ga0500559_0000125
515 Ga0500573_0000042
516 Ga0500604_0000015
517 Ga0500616_0046083
518 Ga0500616_0084069
519 Ga0500637_0002350
520 Ga0500645_004069
521 2644209253
522 2644652755
523 2644743680
524 2715500088
525 2774873227
526 2774873684
527 2776262414
528 2834578312
529 2835315168
530 2842923098
531 2855020656
532 2899261096
533 2899276731
534 2903451863
535 2928526037
536 2928973633
537 2928974483
538 2968088493
539 2977241032
540 2977243402
541 8002286725
542 8057133814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00325

Crp

Bacterial regulatory proteins, crp family

218

249

0.97

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

73

160

0.95

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

192

267

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.9265 29 227
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9195 29 224
8qto-assembly1.cif.gz_A-2 crystal structure of holo-l28h-fnr of a. fischeri 0.9108 8 227
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9099 8 226
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.8884 29 227
ID Description Score Start End Superfamily
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.927 29 144 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9025 29 144 2.60.120.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8905 29 144 2.60.120.10
5e44A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8873 9 144 2.60.120.10
5e44A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8805 146 226 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A653J5C4-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9828 2 239 GO:0003677
GO:0006355
AF-A0A2W5QYJ5-F1-model_v4 deleted 0.9813 1 239
AF-A0A1Y6ET54-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.9774 2 233 GO:0003677
GO:0006355
GO:0016301
AF-A0A4Q5QDY6-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9759 29 232 GO:0003677
GO:0006355
AF-A0A1M3KQD0-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9757 2 239 GO:0003677
GO:0003700
GO:0005829

Map