F377758

General Info

Members Datasets Scaffolds Average Seq Length
271 181 265 258

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10310355|Ga0307406_103103552
Length 274
Sequence MARLESGTLRPMNLGGQTALVTGASGGLGHAIARALAGRGAHVILTARRVDVLEALAQETGGRAVACDLTDRAAVAKLVEDAGPVDVLVANAALPASGGILSFSVEEVDRALDVNLRAPMVLARLIGEGMIERGGGHIVFVSSLSGKAATVGSSVYSATKFGLRGFAMGLREDLRPRGVGVSTVFPGFIRDAGMFHDAGTKLPPYVGTKKPEDVGAAVVRAIEHDKAEVDVAPIPLRLGAAITGLAPELAAMVQRRMGASDVASQMERGQREKR

Samples

Sample ID Description Type Environment
1 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
2 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
179 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
180 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
181 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 3.32
Rhizosphere 89.67
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10002642 3300003373 Bacteria 4248
2 JGI25407J50210_10046437 3300003373 Bacteria 1106
3 Ga0070683_100183028 3300005329 Bacteria 1989
4 Ga0070683_100356196 3300005329 Bacteria 1393
5 Ga0070683_100740222 3300005329 Bacteria 942
6 Ga0070670_100525022 3300005331 Unclassified 1054
7 Ga0070677_10062214 3300005333 Bacteria 1543
8 Ga0070668_100012117 3300005347 Bacteria 6422
9 Ga0070669_100010079 3300005353 Bacteria 6720
10 Ga0070675_100093247 3300005354 Bacteria 2525
11 Ga0070674_100006349 3300005356 Bacteria 6893
12 Ga0070659_100000037 3300005366 Bacteria 113379
13 Ga0070659_100156078 3300005366 Bacteria 1864
14 Ga0070714_100000091 3300005435 Bacteria 76316
15 Ga0070714_100007748 3300005435 Bacteria 8368
16 Ga0070710_10000004 3300005437 Bacteria 270399
17 Ga0070711_100011723 3300005439 Bacteria 5450
18 Ga0070705_100147812 3300005440 Bacteria 1555
19 Ga0070700_100017007 3300005441 Bacteria 4152
20 Ga0070662_100005540 3300005457 Bacteria 8067
21 Ga0070681_10115877 3300005458 Bacteria 2617
22 Ga0068867_100024148 3300005459 Bacteria 4357
23 Ga0070706_100023144 3300005467 Bacteria 5721
24 Ga0070665_100001101 3300005548 Bacteria 33337
25 Ga0068855_100434429 3300005563 Bacteria 1435
26 Ga0070664_100287821 3300005564 Bacteria 1483
27 Ga0068856_100090490 3300005614 Bacteria 3044
28 Ga0068852_100491991 3300005616 Bacteria 1220
29 Ga0068859_100230969 3300005617 Bacteria 1938
30 Ga0068861_100339518 3300005719 Bacteria 1314
31 Ga0068863_100657350 3300005841 Bacteria 1040
32 Ga0068862_100154537 3300005844 Bacteria 2044
33 Ga0081538_10000229 3300005981 Bacteria 63078
34 Ga0081538_10000441 3300005981 Bacteria 46694
35 Ga0081538_10001126 3300005981 Bacteria 28304
36 Ga0081538_10002919 3300005981 Bacteria 16305
37 Ga0081538_10010492 3300005981 Bacteria 7596
38 Ga0081538_10023818 3300005981 Bacteria 4386
39 Ga0081539_10001978 3300005985 Bacteria 31196
40 Ga0081539_10050543 3300005985 Bacteria 2352
41 Ga0081539_10051506 3300005985 Bacteria 2319
42 Ga0070717_10000019 3300006028 Bacteria 178051
43 Ga0075363_100293547 3300006048 Bacteria 942
44 Ga0075364_10169117 3300006051 Bacteria 1477
45 Ga0075432_10041591 3300006058 Bacteria 1606
46 Ga0070712_100000004 3300006175 Bacteria 215464
47 Ga0070712_100203231 3300006175 Bacteria 1558
48 Ga0075428_100037025 3300006844 Bacteria 5373
49 Ga0075428_100113442 3300006844 Bacteria 2952
50 Ga0075428_100138803 3300006844 Bacteria 2643
51 Ga0075428_100164268 3300006844 Bacteria 2409
52 Ga0075430_100001575 3300006846 Bacteria 18649
53 Ga0075430_100003154 3300006846 Bacteria 13797
54 Ga0075430_100596775 3300006846 Bacteria 911
55 Ga0075431_100005762 3300006847 Bacteria 12252
56 Ga0075431_100035759 3300006847 Bacteria 5114
57 Ga0075431_100517480 3300006847 Bacteria 1183
58 Ga0075429_100002028 3300006880 Bacteria 16853
59 Ga0075429_100038248 3300006880 Bacteria 4177
60 Ga0075429_100117911 3300006880 Bacteria 2320
61 Ga0075429_100195954 3300006880 Bacteria 1770
62 Ga0097620_100230969 3300006931 Bacteria 1938
63 Ga0075435_100300074 3300007076 Unclassified 1374
64 Ga0105240_10077155 3300009093 Bacteria 4106
65 Ga0111539_10044880 3300009094 Bacteria 5293
66 Ga0111539_10074036 3300009094 Bacteria 4014
67 Ga0111539_10923647 3300009094 Bacteria 1015
68 Ga0105245_10141398 3300009098 Bacteria 2267
69 Ga0105243_10015457 3300009148 Bacteria 5769
70 Ga0105237_10000587 3300009545 Bacteria 50736
71 Ga0105238_10144655 3300009551 Bacteria 2354
72 Ga0105249_10060258 3300009553 Bacteria 3481
73 Ga0105239_10012760 3300010375 Bacteria 9348
74 Ga0105246_10024170 3300011119 Bacteria 3944
75 Ga0105246_10163795 3300011119 Bacteria 1696
76 Ga0157378_10119064 3300013297 Bacteria 2431
77 Ga0157372_10570631 3300013307 Bacteria 1319
78 Ga0157375_10836303 3300013308 Bacteria 1068
79 Ga0213875_10061966 3300021388 Bacteria 1750
80 Ga0207426_1001264 3300025302 Bacteria 22084
81 Ga0207426_1010939 3300025302 Bacteria 3490
82 Ga0207692_10000002 3300025898 Bacteria 453100
83 Ga0207688_10013348 3300025901 Bacteria 4463
84 Ga0207699_10202236 3300025906 Bacteria 1347
85 Ga0207684_10022387 3300025910 Bacteria 5393
86 Ga0207695_10033688 3300025913 Bacteria 5581
87 Ga0207671_10043705 3300025914 Bacteria 3313
88 Ga0207693_10000017 3300025915 Bacteria 139308
89 Ga0207663_10000764 3300025916 Bacteria 14377
90 Ga0207652_10432663 3300025921 Bacteria 1186
91 Ga0207681_10005242 3300025923 Bacteria 7962
92 Ga0207694_10104063 3300025924 Bacteria 2252
93 Ga0207659_10031195 3300025926 Bacteria 3646
94 Ga0207664_10000004 3300025929 Bacteria 493014
95 Ga0207664_10003742 3300025929 Bacteria 10213
96 Ga0207664_10186707 3300025929 Bacteria 1783
97 Ga0207690_10000404 3300025932 Bacteria 28563
98 Ga0207706_10022807 3300025933 Bacteria 5615
99 Ga0207706_10071240 3300025933 Bacteria 3057
100 Ga0207706_10083616 3300025933 Bacteria 2806
101 Ga0207706_10385075 3300025933 Bacteria 1217
102 Ga0207709_10076297 3300025935 Bacteria 2145
103 Ga0207669_10019449 3300025937 Bacteria 3536
104 Ga0207661_10092108 3300025944 Bacteria 2526
105 Ga0207679_10156133 3300025945 Bacteria 1863
106 Ga0207667_10456868 3300025949 Bacteria 1297
107 Ga0207651_10629876 3300025960 Bacteria 940
108 Ga0207712_10147843 3300025961 Bacteria 1811
109 Ga0207703_10583820 3300026035 Bacteria 1056
110 Ga0207702_10157433 3300026078 Bacteria 2072
111 Ga0207702_10304401 3300026078 Bacteria 1513
112 Ga0207641_10308954 3300026088 Bacteria 1496
113 Ga0207648_10167491 3300026089 Bacteria 1942
114 Ga0207675_100001761 3300026118 Bacteria 21665
115 Ga0207675_100354629 3300026118 Bacteria 1438
116 Ga0207698_10266664 3300026142 Bacteria 1576
117 Ga0207428_10060959 3300027907 Bacteria 2988
118 Ga0268266_10046315 3300028379 Bacteria 3723
119 Ga0265326_10000032 3300028558 Bacteria 94371
120 Ga0265334_10000002 3300028573 Bacteria 325014
121 Ga0265336_10004441 3300028666 Bacteria 5300
122 Ga0265338_10007282 3300028800 Bacteria 13806
123 Ga0265324_10001186 3300029957 Bacteria 15526
124 Ga0265320_10035717 3300031240 Bacteria 2518
125 Ga0265327_10034943 3300031251 Bacteria 2784
126 Ga0307508_10005092 3300031616 Bacteria 12609
127 Ga0265314_10087697 3300031711 Bacteria 2034
128 Ga0307405_10023331 3300031731 Bacteria 3515
129 Ga0307405_10039038 3300031731 Bacteria 2867
130 Ga0307413_10047820 3300031824 Bacteria 2553
131 Ga0307413_10259115 3300031824 Bacteria 1295
132 Ga0307410_10016908 3300031852 Bacteria 4363
133 Ga0307410_10028047 3300031852 Bacteria 3566
134 Ga0307410_10189964 3300031852 Bacteria 1561
135 Ga0307410_10227444 3300031852 Bacteria 1438
136 Ga0307406_10017018 3300031901 Bacteria 4231
137 Ga0307406_10173377 3300031901 Bacteria 1563
138 Ga0307406_10310355 3300031901 Bacteria 1216
139 Ga0307407_10045425 3300031903 Bacteria 2482
140 Ga0307407_10084905 3300031903 Bacteria 1925
141 Ga0307407_10161982 3300031903 Bacteria 1465
142 Ga0307412_10142259 3300031911 Bacteria 1759
143 Ga0307409_100028421 3300031995 Bacteria 3984
144 Ga0307409_100062983 3300031995 Bacteria 2906
145 Ga0307409_100107527 3300031995 Bacteria 2330
146 Ga0307409_100146476 3300031995 Bacteria 2043
147 Ga0307409_100194963 3300031995 Bacteria 1807
148 Ga0307416_100004892 3300032002 Bacteria 8152
149 Ga0307416_100005913 3300032002 Bacteria 7596
150 Ga0307416_100046168 3300032002 Bacteria 3436
151 Ga0307416_100131421 3300032002 Bacteria 2254
152 Ga0307416_100532666 3300032002 Bacteria 1245
153 Ga0307414_10090989 3300032004 Bacteria 2266
154 Ga0307414_10143324 3300032004 Bacteria 1874
155 Ga0307415_100055145 3300032126 Bacteria 2718
156 Ga0307415_100089855 3300032126 Bacteria 2220
157 Ga0307415_100209384 3300032126 Bacteria 1554
158 Ga0373947_0011854 3300035725 Bacteria 4996
159 Ga0373937_0746887 3300036401 Bacteria 926
160 Ga0373925_0260476 3300037068 Unclassified 1393
161 Ga0436364_0415676 3300037853 Bacteria 2958
162 Ga0436364_0778690 3300037853 Bacteria 4816
163 Ga0466966_0182278 3300044684 Bacteria 1274
164 Ga0466963_0069318 3300044694 Bacteria 2370
165 Ga0466957_0176037 3300044842 Bacteria 1395
166 Ga0466960_0027822 3300044901 Bacteria 2583
167 Ga0466967_0038065 3300045976 Bacteria 4122
168 Ga0466967_0093413 3300045976 Bacteria 2737
169 Ga0466967_0114754 3300045976 Bacteria 2480
170 Ga0466967_0159398 3300045976 Bacteria 2116
171 Ga0466967_0292827 3300045976 Bacteria 1564
172 Ga0466967_0406620 3300045976 Bacteria 1325
173 Ga0495653_0001515 3300046463 Bacteria 18158
174 Ga0495618_0000115 3300046514 Bacteria 58375
175 Ga0495630_0000576 3300046517 Bacteria 26792
176 Ga0495645_0000012 3300046543 Bacteria 209044
177 Ga0495645_0000375 3300046543 Bacteria 31078
178 Ga0495635_0217546 3300046663 Bacteria 1293
179 Ga0495657_0000007 3300046675 Bacteria 222471
180 Ga0495646_0210210 3300046680 Bacteria 1056
181 Ga0495658_0308197 3300046683 Unclassified 1002
182 Ga0495624_0048295 3300046690 Unclassified 2702
183 Ga0495600_0112371 3300046809 Bacteria 1774
184 Ga0495672_0011288 3300047320 Bacteria 6314
185 Ga0496102_0000016 3300048905 Bacteria 286787
186 Ga0496102_0679705 3300048905 Bacteria 952
187 Ga0496103_0000015 3300048906 Bacteria 287966
188 Ga0496107_0026146 3300048910 Bacteria 4137
189 Ga0496108_0279016 3300048911 Bacteria 1455
190 Ga0496109_0098551 3300048912 Bacteria 2710
191 Ga0496111_0170062 3300048914 Bacteria 1619
192 Ga0496111_0378880 3300048914 Bacteria 1046
193 Ga0496116_0000055 3300048919 Bacteria 286923
194 Ga0496117_0000006 3300048920 Bacteria 758420
195 Ga0496118_0000004 3300048921 Bacteria 758420
196 Ga0496119_0046214 3300048922 Bacteria 2721
197 Ga0496121_0247384 3300048924 Bacteria 1238
198 Ga0496126_0000675 3300048929 Bacteria 62838
199 Ga0496126_0179027 3300048929 Bacteria 1802
200 Ga0501031_0010564 3300049568 Bacteria 6010
201 Ga0501031_0030140 3300049568 Bacteria 3538
202 Ga0501031_0272672 3300049568 Bacteria 1098
203 Ga0501032_0085880 3300049569 Bacteria 2091
204 Ga0501034_0024738 3300049571 Bacteria 6108
205 Ga0501036_0023396 3300049572 Bacteria 5205
206 Ga0501036_0196015 3300049572 Bacteria 1699
207 Ga0501038_0071014 3300049574 Bacteria 2954
208 Ga0501038_0082986 3300049574 Bacteria 2698
209 Ga0501039_0181421 3300049575 Bacteria 1655
210 Ga0501040_0053352 3300049576 Bacteria 2769
211 Ga0501040_0231950 3300049576 Bacteria 1315
212 Ga0501042_0138021 3300049578 Bacteria 1757
213 Ga0501042_0233348 3300049578 Bacteria 1327
214 Ga0501043_0012152 3300049579 Bacteria 6729
215 Ga0501046_0006022 3300049580 Bacteria 10785
216 Ga0501046_0188753 3300049580 Bacteria 1538
217 Ga0501048_0069212 3300049582 Bacteria 2493
218 Ga0501048_0108549 3300049582 Bacteria 1959
219 Ga0501048_0376920 3300049582 Bacteria 1013
220 Ga0501067_0003216 3300049583 Bacteria 8999
221 Ga0501068_0294404 3300049584 Bacteria 1038
222 Ga0501069_0026863 3300049585 Bacteria 3153
223 Ga0501070_0036194 3300049586 Bacteria 4122
224 Ga0501070_0303218 3300049586 Bacteria 1301
225 Ga0501071_0021347 3300049587 Bacteria 4507
226 Ga0501071_0044633 3300049587 Bacteria 3179
227 Ga0501071_0155781 3300049587 Bacteria 1706
228 Ga0501071_0458285 3300049587 Bacteria 976
229 Ga0501073_0010452 3300049589 Bacteria 6805
230 Ga0501074_0005027 3300049590 Bacteria 9489
231 Ga0501075_0226975 3300049591 Bacteria 1424
232 Ga0501076_0247310 3300049592 Bacteria 1459
233 Ga0501077_0041951 3300049593 Bacteria 2912
234 Ga0501080_0019382 3300049742 Bacteria 6303
235 Ga0501081_0196565 3300049743 Bacteria 1462
236 Ga0501083_0021782 3300049744 Bacteria 4451
237 Ga0501035_0077793 3300049822 Bacteria 2931
238 Ga0501045_0014982 3300049824 Bacteria 5502
239 Ga0501045_0074407 3300049824 Bacteria 2501
240 Ga0501045_0142353 3300049824 Bacteria 1783
241 nmdc:mga00v17_140584_c1 3300050491 Bacteria 1547
242 nmdc:mga0yw44_81345_c1 3300050492 Bacteria 2030
243 nmdc:mga05p37_408566_c1 3300050507 Bacteria 1583
244 nmdc:mga09592_113439_c1 3300050508 Bacteria 2326
245 nmdc:mga09592_114922_c1 3300050508 Bacteria 2310
246 nmdc:mga09592_38016_c1 3300050508 Bacteria 4039
247 nmdc:mga0qj67_14840_c1 3300050509 Bacteria 5894
248 nmdc:mga0qj67_364528_c1 3300050509 Bacteria 1167
249 nmdc:mga0qj67_5477_c1 3300050509 Bacteria 9278
250 nmdc:mga06r32_136659_c1 3300050510 Bacteria 2426
251 nmdc:mga06r32_140409_c1 3300050510 Bacteria 2392
252 nmdc:mga08y16_188400_c1 3300050511 Bacteria 2140
253 nmdc:mga08y16_6053_c1 3300050511 Bacteria 12679
254 Ga0495601_0000299 3300053077 Bacteria 26315
255 Ga0495601_0010929 3300053077 Bacteria 5418
256 Ga0495601_0136563 3300053077 Bacteria 1599
257 Ga0495612_0000033 3300053078 Bacteria 77643
258 Ga0495655_0088013 3300053083 Unclassified 900
259 Ga0495619_0011935 3300053085 Bacteria 5473
260 Ga0495619_0152572 3300053085 Bacteria 1594
261 Ga0501084_0026063 3300054114 Bacteria 4877
262 Ga0501084_0033659 3300054114 Bacteria 4287
263 Ga0501082_0009736 3300060353 Bacteria 8279
264 Ga0501082_0022712 3300060353 Bacteria 5402
265 Ga0530510_0012574 3300061734 Bacteria 5950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100183028 Ga0070683_1001830282 219
2 3300005458 Ga0070681_10115877 Ga0070681_101158772 222
3 3300006844 Ga0075428_100164268 Ga0075428_1001642682 224
4 3300006846 Ga0075430_100001575 Ga0075430_10000157519 224
5 3300006847 Ga0075431_100005762 Ga0075431_1000057623 224
6 3300006880 Ga0075429_100038248 Ga0075429_10003824810 224
7 3300050509 nmdc:mga0qj67_5477_c1 nmdc:mga0qj67_5477_c1_3846_4667 224
8 3300050510 nmdc:mga06r32_136659_c1 nmdc:mga06r32_136659_c1_630_1451 224
9 3300005548 Ga0070665_100001101 Ga0070665_10000110134 225
10 3300028379 Ga0268266_10046315 Ga0268266_100463152 225
11 3300048912 Ga0496109_0098551 Ga0496109_0098551_500_1294 225
12 3300053085 Ga0495619_0152572 Ga0495619_0152572_712_1476 226
13 3300009094 Ga0111539_10923647 Ga0111539_109236472 229
14 3300005985 Ga0081539_10050543 Ga0081539_100505432 230
15 3300046683 Ga0495658_0308197 Ga0495658_0308197_13_708 231
16 3300049578 Ga0501042_0233348 Ga0501042_0233348_16_711 231
17 3300005356 Ga0070674_100006349 Ga0070674_1000063498 233
18 3300005459 Ga0068867_100024148 Ga0068867_1000241482 233
19 3300005719 Ga0068861_100339518 Ga0068861_1003395182 233
20 3300009148 Ga0105243_10015457 Ga0105243_100154572 233
21 3300025935 Ga0207709_10076297 Ga0207709_100762972 233
22 3300025937 Ga0207669_10019449 Ga0207669_100194493 233
23 3300026118 Ga0207675_100354629 Ga0207675_1003546292 233
24 3300003373 JGI25407J50210_10046437 JGI25407J50210_100464371 234
25 3300005981 Ga0081538_10001126 Ga0081538_1000112618 234
26 3300046463 Ga0495653_0001515 Ga0495653_0001515_11205_11999 234
27 3300036401 Ga0373937_0746887 Ga0373937_0746887_12_803 235
28 3300044694 Ga0466963_0069318 Ga0466963_0069318_1560_2348 235
29 3300045976 Ga0466967_0292827 Ga0466967_0292827_752_1540 235
30 3300031995 Ga0307409_100194963 Ga0307409_1001949632 236
31 3300032002 Ga0307416_100532666 Ga0307416_1005326662 236
32 3300025906 Ga0207699_10202236 Ga0207699_102022361 237
33 3300005981 Ga0081538_10023818 Ga0081538_100238187 238
34 3300005985 Ga0081539_10051506 Ga0081539_100515062 239
35 3300006028 Ga0070717_10000019 Ga0070717_1000001983 239
36 3300031240 Ga0265320_10035717 Ga0265320_100357172 239
37 3300046543 Ga0495645_0000375 Ga0495645_0000375_13729_14520 239
38 3300005985 Ga0081539_10001978 Ga0081539_1000197826 241
39 3300053083 Ga0495655_0088013 Ga0495655_0088013_60_851 242
40 3300031995 Ga0307409_100146476 Ga0307409_1001464762 243
41 3300049576 Ga0501040_0231950 Ga0501040_0231950_94_828 243
42 3300031616 Ga0307508_10005092 Ga0307508_100050927 244
43 3300005331 Ga0070670_100525022 Ga0070670_1005250221 246
44 3300005617 Ga0068859_100230969 Ga0068859_1002309692 246
45 3300006931 Ga0097620_100230969 Ga0097620_1002309691 246
46 3300046680 Ga0495646_0210210 Ga0495646_0210210_115_909 246
47 3300049743 Ga0501081_0196565 Ga0501081_0196565_591_1391 248
48 3300009093 Ga0105240_10077155 Ga0105240_100771554 249
49 3300025913 Ga0207695_10033688 Ga0207695_100336885 249
50 3300048914 Ga0496111_0170062 Ga0496111_0170062_61_861 249
51 3300053085 Ga0495619_0011935 Ga0495619_0011935_1497_2288 250
52 3300005981 Ga0081538_10002919 Ga0081538_1000291912 251
53 3300006844 Ga0075428_100037025 Ga0075428_1000370255 253
54 3300006880 Ga0075429_100195954 Ga0075429_1001959542 253
55 3300009094 Ga0111539_10044880 Ga0111539_100448804 253
56 3300027907 Ga0207428_10060959 Ga0207428_100609593 253
57 3300050508 nmdc:mga09592_114922_c1 nmdc:mga09592_114922_c1_443_1234 253
58 3300050511 nmdc:mga08y16_6053_c1 nmdc:mga08y16_6053_c1_1114_1905 253
59 3300049587 Ga0501071_0458285 Ga0501071_0458285_20_787 255
60 3300005347 Ga0070668_100012117 Ga0070668_1000121179 256
61 3300005353 Ga0070669_100010079 Ga0070669_1000100792 256
62 3300005457 Ga0070662_100005540 Ga0070662_1000055405 256
63 3300006058 Ga0075432_10041591 Ga0075432_100415912 256
64 3300006175 Ga0070712_100203231 Ga0070712_1002032311 256
65 3300006844 Ga0075428_100113442 Ga0075428_1001134422 256
66 3300006844 Ga0075428_100138803 Ga0075428_1001388032 256
67 3300006847 Ga0075431_100517480 Ga0075431_1005174802 256
68 3300007076 Ga0075435_100300074 Ga0075435_1003000741 256
69 3300009553 Ga0105249_10060258 Ga0105249_100602584 256
70 3300013307 Ga0157372_10570631 Ga0157372_105706312 256
71 3300025901 Ga0207688_10013348 Ga0207688_100133482 256
72 3300025933 Ga0207706_10022807 Ga0207706_100228074 256
73 3300026118 Ga0207675_100001761 Ga0207675_1000017619 256
74 3300031731 Ga0307405_10039038 Ga0307405_100390382 256
75 3300031824 Ga0307413_10259115 Ga0307413_102591151 256
76 3300031852 Ga0307410_10028047 Ga0307410_100280473 256
77 3300031852 Ga0307410_10227444 Ga0307410_102274441 256
78 3300031901 Ga0307406_10173377 Ga0307406_101733772 256
79 3300031903 Ga0307407_10084905 Ga0307407_100849051 256
80 3300031903 Ga0307407_10161982 Ga0307407_101619822 256
81 3300031911 Ga0307412_10142259 Ga0307412_101422592 256
82 3300031995 Ga0307409_100062983 Ga0307409_1000629831 256
83 3300032002 Ga0307416_100004892 Ga0307416_1000048923 256
84 3300032126 Ga0307415_100089855 Ga0307415_1000898552 256
85 3300050507 nmdc:mga05p37_408566_c1 nmdc:mga05p37_408566_c1_61_834 256
86 3300050509 nmdc:mga0qj67_364528_c1 nmdc:mga0qj67_364528_c1_99_872 256
87 3300005441 Ga0070700_100017007 Ga0070700_1000170073 257
88 3300025921 Ga0207652_10432663 Ga0207652_104326632 257
89 3300025961 Ga0207712_10147843 Ga0207712_101478431 257
90 3300006048 Ga0075363_100293547 Ga0075363_1002935471 259
91 3300006051 Ga0075364_10169117 Ga0075364_101691173 259
92 3300050491 nmdc:mga00v17_140584_c1 nmdc:mga00v17_140584_c1_65_859 259
93 iso_pu_bacteria 2902792274 2902792575 259
94 iso_pu_bacteria 2997600082 2997600710 259
95 iso_pu_bacteria 8047893842 8047894271 259
96 iso_pu_bacteria 8048127548 8048130277 259
97 iso_pu_bacteria 8048369669 8048371287 259
98 iso_pu_bacteria 8048379754 8048380089 259
99 3300045976 Ga0466967_0114754 Ga0466967_0114754_236_1033 261
100 3300005329 Ga0070683_100356196 Ga0070683_1003561962 262
101 3300005366 Ga0070659_100000037 Ga0070659_10000003712 262
102 3300005435 Ga0070714_100000091 Ga0070714_10000009121 262
103 3300005435 Ga0070714_100007748 Ga0070714_1000077484 262
104 3300005437 Ga0070710_10000004 Ga0070710_10000004231 262
105 3300005440 Ga0070705_100147812 Ga0070705_1001478122 262
106 3300005563 Ga0068855_100434429 Ga0068855_1004344292 262
107 3300005614 Ga0068856_100090490 Ga0068856_1000904903 262
108 3300005841 Ga0068863_100657350 Ga0068863_1006573502 262
109 3300006175 Ga0070712_100000004 Ga0070712_100000004127 262
110 3300006846 Ga0075430_100003154 Ga0075430_10000315410 262
111 3300006847 Ga0075431_100035759 Ga0075431_1000357596 262
112 3300006880 Ga0075429_100002028 Ga0075429_1000020289 262
113 3300006880 Ga0075429_100117911 Ga0075429_1001179111 262
114 3300009094 Ga0111539_10074036 Ga0111539_100740362 262
115 3300011119 Ga0105246_10024170 Ga0105246_100241703 262
116 3300021388 Ga0213875_10061966 Ga0213875_100619662 262
117 3300025898 Ga0207692_10000002 Ga0207692_1000000251 262
118 3300025915 Ga0207693_10000017 Ga0207693_1000001792 262
119 3300025923 Ga0207681_10005242 Ga0207681_100052427 262
120 3300025929 Ga0207664_10000004 Ga0207664_10000004401 262
121 3300025929 Ga0207664_10003742 Ga0207664_100037424 262
122 3300025929 Ga0207664_10186707 Ga0207664_101867072 262
123 3300025932 Ga0207690_10000404 Ga0207690_1000040415 262
124 3300025944 Ga0207661_10092108 Ga0207661_100921083 262
125 3300025949 Ga0207667_10456868 Ga0207667_104568682 262
126 3300026035 Ga0207703_10583820 Ga0207703_105838201 262
127 3300026078 Ga0207702_10157433 Ga0207702_101574332 262
128 3300028558 Ga0265326_10000032 Ga0265326_1000003284 262
129 3300028573 Ga0265334_10000002 Ga0265334_10000002100 262
130 3300028666 Ga0265336_10004441 Ga0265336_100044412 262
131 3300028800 Ga0265338_10007282 Ga0265338_100072823 262
132 3300029957 Ga0265324_10001186 Ga0265324_100011862 262
133 3300031251 Ga0265327_10034943 Ga0265327_100349432 262
134 3300035725 Ga0373947_0011854 Ga0373947_0011854_3395_4207 262
135 3300037068 Ga0373925_0260476 Ga0373925_0260476_49_861 262
136 3300037853 Ga0436364_0415676 Ga0436364_0415676_223_1014 262
137 3300037853 Ga0436364_0778690 Ga0436364_0778690_3954_4745 262
138 3300044842 Ga0466957_0176037 Ga0466957_0176037_349_1140 262
139 3300046690 Ga0495624_0048295 Ga0495624_0048295_45_857 262
140 3300048905 Ga0496102_0679705 Ga0496102_0679705_126_914 262
141 3300048910 Ga0496107_0026146 Ga0496107_0026146_1506_2294 262
142 3300050508 nmdc:mga09592_113439_c1 nmdc:mga09592_113439_c1_100_891 262
143 3300050508 nmdc:mga09592_38016_c1 nmdc:mga09592_38016_c1_569_1366 262
144 3300050509 nmdc:mga0qj67_14840_c1 nmdc:mga0qj67_14840_c1_320_1117 262
145 3300050510 nmdc:mga06r32_140409_c1 nmdc:mga06r32_140409_c1_840_1637 262
146 3300053077 Ga0495601_0136563 Ga0495601_0136563_278_1090 262
147 3300005329 Ga0070683_100740222 Ga0070683_1007402221 263
148 3300005333 Ga0070677_10062214 Ga0070677_100622142 263
149 3300005354 Ga0070675_100093247 Ga0070675_1000932473 263
150 3300005366 Ga0070659_100156078 Ga0070659_1001560782 263
151 3300005439 Ga0070711_100011723 Ga0070711_1000117232 263
152 3300005467 Ga0070706_100023144 Ga0070706_1000231445 263
153 3300005564 Ga0070664_100287821 Ga0070664_1002878212 263
154 3300005616 Ga0068852_100491991 Ga0068852_1004919912 263
155 3300005844 Ga0068862_100154537 Ga0068862_1001545373 263
156 3300006846 Ga0075430_100596775 Ga0075430_1005967751 263
157 3300009098 Ga0105245_10141398 Ga0105245_101413982 263
158 3300009545 Ga0105237_10000587 Ga0105237_1000058713 263
159 3300009551 Ga0105238_10144655 Ga0105238_101446553 263
160 3300010375 Ga0105239_10012760 Ga0105239_100127606 263
161 3300011119 Ga0105246_10163795 Ga0105246_101637952 263
162 3300013297 Ga0157378_10119064 Ga0157378_101190641 263
163 3300013308 Ga0157375_10836303 Ga0157375_108363032 263
164 3300025302 Ga0207426_1001264 Ga0207426_10012647 263
165 3300025302 Ga0207426_1010939 Ga0207426_10109392 263
166 3300025910 Ga0207684_10022387 Ga0207684_100223875 263
167 3300025914 Ga0207671_10043705 Ga0207671_100437053 263
168 3300025916 Ga0207663_10000764 Ga0207663_100007645 263
169 3300025924 Ga0207694_10104063 Ga0207694_101040633 263
170 3300025926 Ga0207659_10031195 Ga0207659_100311954 263
171 3300025933 Ga0207706_10071240 Ga0207706_100712403 263
172 3300025933 Ga0207706_10083616 Ga0207706_100836162 263
173 3300025933 Ga0207706_10385075 Ga0207706_103850752 263
174 3300025945 Ga0207679_10156133 Ga0207679_101561332 263
175 3300025960 Ga0207651_10629876 Ga0207651_106298762 263
176 3300026078 Ga0207702_10304401 Ga0207702_103044012 263
177 3300026088 Ga0207641_10308954 Ga0207641_103089542 263
178 3300026089 Ga0207648_10167491 Ga0207648_101674912 263
179 3300026142 Ga0207698_10266664 Ga0207698_102666642 263
180 3300031711 Ga0265314_10087697 Ga0265314_100876972 263
181 3300031901 Ga0307406_10310355 Ga0307406_103103552 263
182 3300031903 Ga0307407_10045425 Ga0307407_100454253 263
183 3300031995 Ga0307409_100028421 Ga0307409_1000284214 263
184 3300032002 Ga0307416_100046168 Ga0307416_1000461682 263
185 3300032004 Ga0307414_10143324 Ga0307414_101433242 263
186 3300032126 Ga0307415_100055145 Ga0307415_1000551452 263
187 3300032126 Ga0307415_100209384 Ga0307415_1002093842 263
188 3300044684 Ga0466966_0182278 Ga0466966_0182278_286_1077 263
189 3300044901 Ga0466960_0027822 Ga0466960_0027822_1533_2324 263
190 3300045976 Ga0466967_0038065 Ga0466967_0038065_2754_3548 263
191 3300045976 Ga0466967_0093413 Ga0466967_0093413_1216_2007 263
192 3300045976 Ga0466967_0159398 Ga0466967_0159398_12_803 263
193 3300045976 Ga0466967_0406620 Ga0466967_0406620_462_1253 263
194 3300046514 Ga0495618_0000115 Ga0495618_0000115_6726_7550 263
195 3300046517 Ga0495630_0000576 Ga0495630_0000576_15409_16203 263
196 3300046543 Ga0495645_0000012 Ga0495645_0000012_115899_116693 263
197 3300046663 Ga0495635_0217546 Ga0495635_0217546_436_1227 263
198 3300046675 Ga0495657_0000007 Ga0495657_0000007_92703_93497 263
199 3300046809 Ga0495600_0112371 Ga0495600_0112371_751_1542 263
200 3300047320 Ga0495672_0011288 Ga0495672_0011288_3058_3852 263
201 3300048905 Ga0496102_0000016 Ga0496102_0000016_254302_255093 263
202 3300048906 Ga0496103_0000015 Ga0496103_0000015_31682_32473 263
203 3300048911 Ga0496108_0279016 Ga0496108_0279016_216_1007 263
204 3300048914 Ga0496111_0378880 Ga0496111_0378880_13_804 263
205 3300048919 Ga0496116_0000055 Ga0496116_0000055_31869_32660 263
206 3300048920 Ga0496117_0000006 Ga0496117_0000006_725935_726726 263
207 3300048921 Ga0496118_0000004 Ga0496118_0000004_725935_726726 263
208 3300048922 Ga0496119_0046214 Ga0496119_0046214_370_1161 263
209 3300048924 Ga0496121_0247384 Ga0496121_0247384_34_825 263
210 3300048929 Ga0496126_0000675 Ga0496126_0000675_57500_58291 263
211 3300048929 Ga0496126_0179027 Ga0496126_0179027_577_1368 263
212 3300049568 Ga0501031_0010564 Ga0501031_0010564_4059_4850 263
213 3300049568 Ga0501031_0030140 Ga0501031_0030140_2514_3305 263
214 3300049568 Ga0501031_0272672 Ga0501031_0272672_221_1012 263
215 3300049569 Ga0501032_0085880 Ga0501032_0085880_1018_1809 263
216 3300049571 Ga0501034_0024738 Ga0501034_0024738_2806_3597 263
217 3300049572 Ga0501036_0023396 Ga0501036_0023396_1656_2447 263
218 3300049572 Ga0501036_0196015 Ga0501036_0196015_486_1277 263
219 3300049574 Ga0501038_0071014 Ga0501038_0071014_1595_2386 263
220 3300049574 Ga0501038_0082986 Ga0501038_0082986_519_1310 263
221 3300049575 Ga0501039_0181421 Ga0501039_0181421_850_1641 263
222 3300049576 Ga0501040_0053352 Ga0501040_0053352_1940_2731 263
223 3300049578 Ga0501042_0138021 Ga0501042_0138021_65_856 263
224 3300049579 Ga0501043_0012152 Ga0501043_0012152_1038_1829 263
225 3300049580 Ga0501046_0006022 Ga0501046_0006022_9136_9927 263
226 3300049580 Ga0501046_0188753 Ga0501046_0188753_494_1285 263
227 3300049582 Ga0501048_0069212 Ga0501048_0069212_730_1521 263
228 3300049582 Ga0501048_0108549 Ga0501048_0108549_188_979 263
229 3300049582 Ga0501048_0376920 Ga0501048_0376920_156_947 263
230 3300049583 Ga0501067_0003216 Ga0501067_0003216_3458_4249 263
231 3300049584 Ga0501068_0294404 Ga0501068_0294404_36_827 263
232 3300049585 Ga0501069_0026863 Ga0501069_0026863_2214_3005 263
233 3300049586 Ga0501070_0036194 Ga0501070_0036194_66_857 263
234 3300049586 Ga0501070_0303218 Ga0501070_0303218_263_1054 263
235 3300049587 Ga0501071_0021347 Ga0501071_0021347_2827_3618 263
236 3300049587 Ga0501071_0044633 Ga0501071_0044633_1917_2708 263
237 3300049587 Ga0501071_0155781 Ga0501071_0155781_698_1489 263
238 3300049589 Ga0501073_0010452 Ga0501073_0010452_4774_5565 263
239 3300049590 Ga0501074_0005027 Ga0501074_0005027_8430_9221 263
240 3300049591 Ga0501075_0226975 Ga0501075_0226975_60_851 263
241 3300049592 Ga0501076_0247310 Ga0501076_0247310_487_1293 263
242 3300049593 Ga0501077_0041951 Ga0501077_0041951_1176_1967 263
243 3300049742 Ga0501080_0019382 Ga0501080_0019382_2782_3573 263
244 3300049744 Ga0501083_0021782 Ga0501083_0021782_83_874 263
245 3300049822 Ga0501035_0077793 Ga0501035_0077793_1655_2446 263
246 3300049824 Ga0501045_0014982 Ga0501045_0014982_1158_1949 263
247 3300049824 Ga0501045_0074407 Ga0501045_0074407_1372_2163 263
248 3300049824 Ga0501045_0142353 Ga0501045_0142353_955_1746 263
249 3300050492 nmdc:mga0yw44_81345_c1 nmdc:mga0yw44_81345_c1_151_942 263
250 3300050511 nmdc:mga08y16_188400_c1 nmdc:mga08y16_188400_c1_757_1548 263
251 3300053077 Ga0495601_0000299 Ga0495601_0000299_7274_8068 263
252 3300053077 Ga0495601_0010929 Ga0495601_0010929_1856_2647 263
253 3300053078 Ga0495612_0000033 Ga0495612_0000033_7445_8239 263
254 3300054114 Ga0501084_0026063 Ga0501084_0026063_1204_1995 263
255 3300054114 Ga0501084_0033659 Ga0501084_0033659_3436_4227 263
256 3300060353 Ga0501082_0009736 Ga0501082_0009736_3292_4083 263
257 3300060353 Ga0501082_0022712 Ga0501082_0022712_2954_3745 263
258 3300061734 Ga0530510_0012574 Ga0530510_0012574_4880_5671 263
259 3300003373 JGI25407J50210_10002642 JGI25407J50210_100026423 265
260 3300005981 Ga0081538_10000229 Ga0081538_100002295 265
261 3300005981 Ga0081538_10000441 Ga0081538_1000044110 265
262 3300005981 Ga0081538_10010492 Ga0081538_100104926 265
263 3300031731 Ga0307405_10023331 Ga0307405_100233316 265
264 3300031824 Ga0307413_10047820 Ga0307413_100478202 265
265 3300031852 Ga0307410_10016908 Ga0307410_100169085 265
266 3300031852 Ga0307410_10189964 Ga0307410_101899642 265
267 3300031901 Ga0307406_10017018 Ga0307406_100170185 265
268 3300031995 Ga0307409_100107527 Ga0307409_1001075271 265
269 3300032002 Ga0307416_100005913 Ga0307416_1000059136 265
270 3300032002 Ga0307416_100131421 Ga0307416_1001314212 265
271 3300032004 Ga0307414_10090989 Ga0307414_100909892 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

17

202

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

23

226

0.91

PF08659

KR

KR domain

17

183

0.89

PF04321

RmlD_sub_bind

RmlD substrate binding domain

17

143

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

19

161

0.76

PF13460

NAD_binding_10

NAD(P)H-binding

23

225

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.9193 1 220
3gvc-assembly2.cif.gz_D-3 crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis 0.9179 2 222
2d1y-assembly1.cif.gz_D crystal structure of tt0321 from thermus thermophilus hb8 0.917 4 220
6b9u-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh 0.9162 3 222
4i08-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph 0.9151 2 222
ID Description Score Start End Superfamily
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9466 2 153 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 2 182 3.40.50.720
af_Q3B7V0_30_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9273 1 248 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9246 8 224 3.40.50.720
af_Q9VIG6_88_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9236 8 231 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V9ED12-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9931 58 262 GO:0016020
GO:0016491
AF-A0A838IBL6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.992 1 262 GO:0016020
GO:0016491
AF-A0A838IBL6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9882 1 262 GO:0016020
GO:0016491
AF-A0A7V9HDY9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9866 1 261 GO:0016020
GO:0016491
AF-A0A7V9H7E4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.986 1 261 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.33 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map