F377569

General Info

Members Datasets Scaffolds Average Seq Length
271 167 542 125

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101424157|Ga0070712_1014241571
Length 123
Sequence MSELPELHGYHVHIYYNDATMPTATKLRDSLAAKFPVRVGKNQGIAGPHPVPQMQVIFKTDAFDSVVQWLMFNRDGLDILVHPLTNDEYEDHTSQALWLGTPVALKVETLPHGPYPAHLLPAE

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.41
Metatranscriptomes 9.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.85
Rhizosphere 89.67
Stem 0
Stem Tuber 0
Unclassified 18.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_101424157 3300006175 Bacteria 605
2 Ga0006770J48903_1060832 3300003305 Bacteria 934
3 Ga0007417J51691_1031064 3300003544 Unclassified 662
4 Ga0007417J51691_1049301 3300003544 Bacteria 586
5 Ga0007410J51695_1032064 3300003574 Unclassified 718
6 Ga0007410J51695_1060643 3300003574 Bacteria 1167
7 Ga0007409J51694_1049282 3300003575 Unclassified 968
8 Ga0007416J51690_1027066 3300003577 Unclassified 1080
9 Ga0007429J51699_1064950 3300003579 Bacteria 1183
10 Ga0058860_11725892 3300004801 Bacteria 560
11 Ga0058860_12184950 3300004801 Bacteria 692
12 Ga0070683_101080288 3300005329 Bacteria 771
13 Ga0070680_100727859 3300005336 Bacteria 854
14 Ga0068868_100414593 3300005338 Bacteria 1165
15 Ga0070689_100302313 3300005340 Bacteria 1332
16 Ga0070671_100122454 3300005355 Bacteria 2189
17 Ga0070688_100324196 3300005365 Bacteria 1120
18 Ga0070659_101411379 3300005366 Bacteria 619
19 Ga0070667_100845168 3300005367 Bacteria 851
20 Ga0070709_10285016 3300005434 Bacteria 1202
21 Ga0070709_10308041 3300005434 Bacteria 1158
22 Ga0070714_100392419 3300005435 Bacteria 1310
23 Ga0070714_100451283 3300005435 Bacteria 1221
24 Ga0070714_100919526 3300005435 Bacteria 850
25 Ga0070714_101227514 3300005435 Unclassified 731
26 Ga0070714_101630309 3300005435 Unclassified 630
27 Ga0070713_100059663 3300005436 Unclassified 3187
28 Ga0070713_100455717 3300005436 Bacteria 1202
29 Ga0070713_100734394 3300005436 Bacteria 944
30 Ga0070713_101242037 3300005436 Bacteria 721
31 Ga0070710_10031980 3300005437 Bacteria 2846
32 Ga0070710_10346792 3300005437 Bacteria 982
33 Ga0070710_10592301 3300005437 Bacteria 771
34 Ga0070701_10402223 3300005438 Unclassified 868
35 Ga0070701_10984918 3300005438 Unclassified 587
36 Ga0070711_100119225 3300005439 Bacteria 1949
37 Ga0070711_100272607 3300005439 Bacteria 1336
38 Ga0070711_100541372 3300005439 Bacteria 965
39 Ga0070708_100124527 3300005445 Bacteria 2381
40 Ga0070678_100424382 3300005456 Bacteria 1160
41 Ga0070681_10236609 3300005458 Bacteria 1740
42 Ga0070681_11705778 3300005458 Bacteria 556
43 Ga0070707_100002265 3300005468 Bacteria 18370
44 Ga0070707_101904780 3300005468 Unclassified 562
45 Ga0070698_100778249 3300005471 Bacteria 900
46 Ga0070698_100972576 3300005471 Bacteria 795
47 Ga0070699_100063444 3300005518 Bacteria 3203
48 Ga0070699_100395011 3300005518 Bacteria 1250
49 Ga0070684_101208597 3300005535 Bacteria 711
50 Ga0070684_101253157 3300005535 Bacteria 698
51 Ga0070697_100051490 3300005536 Bacteria 3345
52 Ga0070697_100588267 3300005536 Bacteria 977
53 Ga0070696_101271696 3300005546 Unclassified 624
54 Ga0070665_102479140 3300005548 Unclassified 520
55 Ga0070704_101622453 3300005549 Unclassified 597
56 Ga0068855_100417268 3300005563 Bacteria 1468
57 Ga0068852_101452526 3300005616 Bacteria 708
58 Ga0068863_100354192 3300005841 Bacteria 1430
59 Ga0081455_10500417 3300005937 Bacteria 816
60 Ga0070715_10024575 3300006163 Bacteria 2376
61 Ga0070716_100574977 3300006173 Bacteria 844
62 Ga0070712_100161902 3300006175 Bacteria 1728
63 Ga0070712_100270100 3300006175 Unclassified 1366
64 Ga0070712_100542820 3300006175 Bacteria 979
65 Ga0070712_101280483 3300006175 Unclassified 639
66 Ga0075428_100054404 3300006844 Bacteria 4386
67 Ga0075430_100029416 3300006846 Bacteria 4663
68 Ga0075431_100112945 3300006847 Bacteria 2804
69 Ga0075429_100093426 3300006880 Bacteria 2624
70 Ga0111539_10009208 3300009094 Bacteria 12481
71 Ga0111539_11426032 3300009094 Bacteria 803
72 Ga0105245_11481741 3300009098 Bacteria 729
73 Ga0105247_11185164 3300009101 Unclassified 607
74 Ga0105247_11762381 3300009101 Bacteria 514
75 Ga0105241_10475381 3300009174 Bacteria 1110
76 Ga0105242_11341536 3300009176 Bacteria 740
77 Ga0105248_10424668 3300009177 Bacteria 1497
78 Ga0105248_10436544 3300009177 Bacteria 1475
79 Ga0099796_10034225 3300010159 Bacteria 1677
80 Ga0099796_10169768 3300010159 Bacteria 870
81 Ga0099796_10265884 3300010159 Bacteria 717
82 Ga0105239_12304082 3300010375 Bacteria 627
83 Ga0157373_10210029 3300013100 Bacteria 1373
84 Ga0163162_10451952 3300013306 Bacteria 1417
85 Ga0157375_10280541 3300013308 Bacteria 1829
86 Ga0163163_11005856 3300014325 Bacteria 897
87 Ga0182008_10018291 3300014497 Bacteria 3628
88 Ga0182008_10125940 3300014497 Unclassified 1275
89 Ga0157379_11259220 3300014968 Bacteria 713
90 Ga0157376_11037485 3300014969 Bacteria 844
91 Ga0184602_123153 3300019161 Bacteria 528
92 Ga0184597_101032 3300019162 Bacteria 635
93 Ga0184598_115547 3300019182 Archaea 581
94 Ga0197907_10290068 3300020069 Bacteria 883
95 Ga0197907_10498342 3300020069 Bacteria 1114
96 Ga0206356_11268769 3300020070 Bacteria 1166
97 Ga0206352_10255418 3300020078 Bacteria 572
98 Ga0206352_10702263 3300020078 Bacteria 914
99 Ga0206352_11290627 3300020078 Unclassified 507
100 Ga0206354_10571245 3300020081 Bacteria 814
101 Ga0206353_10104862 3300020082 Bacteria 945
102 Ga0213872_10296490 3300021361 Bacteria 672
103 Ga0213874_10047656 3300021377 Bacteria 1305
104 Ga0213876_10389458 3300021384 Bacteria 741
105 Ga0213876_10605753 3300021384 Unclassified 583
106 Ga0213875_10000122 3300021388 Bacteria 87195
107 Ga0213875_10004381 3300021388 Bacteria 7766
108 Ga0213875_10020810 3300021388 Bacteria 3145
109 Ga0213875_10226959 3300021388 Bacteria 880
110 Ga0213871_10013774 3300021441 Bacteria 1907
111 Ga0213871_10174369 3300021441 Unclassified 663
112 Ga0224712_10112118 3300022467 Bacteria 1171
113 Ga0247553_101020 3300023672 Unclassified 1139
114 Ga0207692_10030291 3300025898 Bacteria 2579
115 Ga0207692_10146151 3300025898 Unclassified 1349
116 Ga0207692_10257006 3300025898 Bacteria 1049
117 Ga0207685_10130719 3300025905 Bacteria 1114
118 Ga0207699_10041133 3300025906 Bacteria 2667
119 Ga0207699_10898343 3300025906 Unclassified 653
120 Ga0207684_10478264 3300025910 Bacteria 1068
121 Ga0207684_10660474 3300025910 Unclassified 890
122 Ga0207707_10150752 3300025912 Bacteria 2033
123 Ga0207693_10070892 3300025915 Bacteria 2727
124 Ga0207693_10163260 3300025915 Bacteria 1753
125 Ga0207693_10236734 3300025915 Bacteria 1433
126 Ga0207693_11162740 3300025915 Unclassified 583
127 Ga0207663_10086960 3300025916 Bacteria 2063
128 Ga0207663_10326057 3300025916 Bacteria 1155
129 Ga0207663_10629396 3300025916 Bacteria 845
130 Ga0207660_10965695 3300025917 Unclassified 695
131 Ga0207662_10050539 3300025918 Bacteria 2470
132 Ga0207652_10683699 3300025921 Bacteria 916
133 Ga0207646_10012377 3300025922 Bacteria 8204
134 Ga0207700_10012043 3300025928 Bacteria 5554
135 Ga0207700_10517616 3300025928 Bacteria 1057
136 Ga0207700_10856485 3300025928 Bacteria 813
137 Ga0207664_10084816 3300025929 Bacteria 2584
138 Ga0207664_10119812 3300025929 Bacteria 2201
139 Ga0207664_10548287 3300025929 Bacteria 1037
140 Ga0207664_10973255 3300025929 Unclassified 761
141 Ga0207644_10508346 3300025931 Bacteria 994
142 Ga0207704_10548012 3300025938 Bacteria 939
143 Ga0207665_10324887 3300025939 Bacteria 1155
144 Ga0207665_10539938 3300025939 Unclassified 905
145 Ga0207661_10650187 3300025944 Bacteria 969
146 Ga0207661_11142191 3300025944 Bacteria 717
147 Ga0207712_11032575 3300025961 Bacteria 730
148 Ga0207640_11793507 3300025981 Unclassified 554
149 Ga0207703_10379750 3300026035 Bacteria 1307
150 Ga0207703_11532855 3300026035 Bacteria 641
151 Ga0207708_10498299 3300026075 Bacteria 1020
152 Ga0207641_11125624 3300026088 Bacteria 784
153 Ga0207683_10612101 3300026121 Bacteria 1008
154 Ga0207428_10074686 3300027907 Bacteria 2658
155 Ga0265338_10015998 3300028800 Bacteria 8198
156 Ga0307408_100818977 3300031548 Unclassified 846
157 Ga0307405_10016853 3300031731 Bacteria 3995
158 Ga0307407_11197287 3300031903 Unclassified 593
159 Ga0307412_11879808 3300031911 Bacteria 552
160 Ga0307416_100754197 3300032002 Bacteria 1066
161 Ga0307414_10039697 3300032004 Bacteria 3173
162 Ga0307414_11692497 3300032004 Unclassified 590
163 Ga0307415_100818983 3300032126 Bacteria 851
164 Ga0307415_101422426 3300032126 Bacteria 661
165 Ga0373930_0048978 3300034816 Bacteria 918
166 Ga0373926_0042426 3300035083 Bacteria 1627
167 Ga0373934_0019843 3300035086 Bacteria 2583
168 Ga0373949_0088570 3300035090 Archaea 834
169 Ga0373923_0273282 3300035111 Bacteria 795
170 Ga0373936_0457296 3300035113 Bacteria 591
171 Ga0373941_0084408 3300035115 Bacteria 1078
172 Ga0373945_0228855 3300035116 Unclassified 780
173 Ga0373953_0028017 3300035117 Unclassified 2169
174 Ga0373954_0047181 3300035118 Bacteria 2015
175 Ga0373956_0015617 3300035119 Bacteria 3182
176 Ga0373957_0004798 3300035120 Bacteria 4142
177 Ga0373957_0318568 3300035120 Bacteria 661
178 Ga0373931_0191601 3300035691 Bacteria 1217
179 Ga0373935_0314336 3300035692 Bacteria 1110
180 Ga0373935_0602268 3300035692 Bacteria 804
181 Ga0373933_0008276 3300035724 Bacteria 5678
182 Ga0373933_0018013 3300035724 Bacteria 3967
183 Ga0373933_0707022 3300035724 Bacteria 663
184 Ga0373947_0029648 3300035725 Bacteria 3211
185 Ga0373947_0493520 3300035725 Bacteria 832
186 Ga0373937_0002511 3300036401 Bacteria 15237
187 Ga0373937_0226423 3300036401 Bacteria 1760
188 Ga0373937_1327141 3300036401 Unclassified 667
189 Ga0373925_0122755 3300037068 Bacteria 2018
190 Ga0436364_0176856 3300037853 Bacteria 3059
191 Ga0436364_0350701 3300037853 Bacteria 1662
192 Ga0436364_0423755 3300037853 Bacteria 87339
193 Ga0436364_0694571 3300037853 Bacteria 905
194 Ga0436364_1245271 3300037853 Bacteria 49699
195 Ga0436364_1266685 3300037853 Bacteria 807
196 Ga0436365_0138179 3300039437 Bacteria 1175
197 Ga0436365_0171998 3300039437 Bacteria 3255
198 Ga0436365_1795561 3300039437 Bacteria 681
199 Ga0436360_0233254 3300039438 Bacteria 2416
200 Ga0436360_0351247 3300039438 Bacteria 2615
201 Ga0436360_0509026 3300039438 Bacteria 596
202 Ga0436360_0824879 3300039438 Bacteria 1137
203 Ga0436360_0962249 3300039438 Unclassified 532
204 Ga0436360_1253634 3300039438 Bacteria 554
205 Ga0436361_0151399 3300039447 Bacteria 1929
206 Ga0436361_0633043 3300039447 Bacteria 855
207 Ga0436361_0637341 3300039447 Bacteria 606
208 Ga0436361_0902906 3300039447 Bacteria 955
209 Ga0436361_0946458 3300039447 Bacteria 1579
210 Ga0436361_1082137 3300039447 Bacteria 1166
211 Ga0436361_1082487 3300039447 Bacteria 1587
212 Ga0436361_1085193 3300039447 Bacteria 801
213 Ga0436361_1173603 3300039447 Bacteria 595
214 Ga0436363_0284975 3300039450 Unclassified 777
215 Ga0436363_0334537 3300039450 Unclassified 510
216 Ga0436363_0971507 3300039450 Bacteria 566
217 Ga0436363_0988962 3300039450 Bacteria 738
218 Ga0436363_1174593 3300039450 Bacteria 2537
219 Ga0436362_0038761 3300039453 Bacteria 730
220 Ga0436362_0048256 3300039453 Unclassified 515
221 Ga0436362_0100477 3300039453 Bacteria 581
222 Ga0436362_0199228 3300039453 Bacteria 1289
223 Ga0436362_0240974 3300039453 Bacteria 933
224 Ga0436362_0510413 3300039453 Bacteria 912
225 Ga0436362_0573338 3300039453 Unclassified 833
226 Ga0436362_0880180 3300039453 Bacteria 983
227 Ga0436362_1185482 3300039453 Bacteria 1606
228 Ga0436362_1279008 3300039453 Unclassified 607
229 Ga0439441_054819 3300042001 Unclassified 828
230 Ga0466963_0865383 3300044694 Bacteria 637
231 Ga0466967_1668030 3300045976 Bacteria 635
232 Ga0466967_1925186 3300045976 Bacteria 588
233 Ga0495592_0030652 3300046454 Bacteria 4068
234 Ga0495651_0983886 3300046462 Bacteria 512
235 Ga0495580_0324508 3300046472 Bacteria 1046
236 Ga0495618_0136906 3300046514 Bacteria 1567
237 Ga0495628_0466128 3300046516 Bacteria 916
238 Ga0495640_0097764 3300046533 Bacteria 1930
239 Ga0495586_0300831 3300046535 Bacteria 919
240 Ga0495621_0101338 3300046539 Unclassified 1096
241 Ga0495667_0178751 3300046559 Bacteria 1362
242 Ga0495634_0273647 3300046642 Bacteria 1027
243 Ga0495635_0382580 3300046663 Bacteria 936
244 Ga0495599_0606310 3300046678 Bacteria 637
245 Ga0495646_0342802 3300046680 Unclassified 784
246 Ga0495600_0015616 3300046809 Bacteria 4807
247 Ga0495604_0786842 3300047317 Bacteria 600
248 Ga0495680_0013503 3300047322 Bacteria 7123
249 Ga0495684_0955515 3300047471 Bacteria 548
250 Ga0495602_0439441 3300048088 Bacteria 923
251 Ga0496106_0574444 3300048909 Bacteria 904
252 Ga0496108_1129422 3300048911 Unclassified 665
253 Ga0496109_0461495 3300048912 Bacteria 1200
254 Ga0496110_1669387 3300048913 Unclassified 547
255 Ga0496113_0153892 3300048916 Bacteria 1815
256 Ga0501036_1404761 3300049572 Bacteria 566
257 Ga0501072_1522221 3300049588 Bacteria 516
258 nmdc:mga09592_191151_c1 3300050508 Unclassified 1772
259 nmdc:mga08y16_106408_c1 3300050511 Bacteria 2920
260 nmdc:mga08y16_2070345_c1 3300050511 Unclassified 517
261 nmdc:mga0n895_2241761_c1 3300050512 Bacteria 501
262 nmdc:mga08x19_1157694_c1 3300050514 Bacteria 548
263 nmdc:mga08x19_436960_c1 3300050514 Bacteria 920
264 nmdc:mga08x19_62475_c1 3300050514 Bacteria 2415
265 Ga0495601_0084698 3300053077 Bacteria 2036
266 Ga0495595_0029217 3300053084 Bacteria 2466
267 Ga0495619_0009251 3300053085 Bacteria 6225
268 Ga0495619_0030183 3300053085 Bacteria 3508
269 Ga0587062_127562 3300059639 Bacteria 520
270 Ga0587076_058891 3300059645 Unclassified 769
271 Ga0587111_0092745 3300060346 Bacteria 740
272 Ga0070712_101424157
273 Ga0006770J48903_1060832
274 Ga0007417J51691_1031064
275 Ga0007417J51691_1049301
276 Ga0007410J51695_1032064
277 Ga0007410J51695_1060643
278 Ga0007409J51694_1049282
279 Ga0007416J51690_1027066
280 Ga0007429J51699_1064950
281 Ga0058860_11725892
282 Ga0058860_12184950
283 Ga0070683_101080288
284 Ga0070680_100727859
285 Ga0068868_100414593
286 Ga0070689_100302313
287 Ga0070671_100122454
288 Ga0070688_100324196
289 Ga0070659_101411379
290 Ga0070667_100845168
291 Ga0070709_10285016
292 Ga0070709_10308041
293 Ga0070714_100392419
294 Ga0070714_100451283
295 Ga0070714_100919526
296 Ga0070714_101227514
297 Ga0070714_101630309
298 Ga0070713_100059663
299 Ga0070713_100455717
300 Ga0070713_100734394
301 Ga0070713_101242037
302 Ga0070710_10031980
303 Ga0070710_10346792
304 Ga0070710_10592301
305 Ga0070701_10402223
306 Ga0070701_10984918
307 Ga0070711_100119225
308 Ga0070711_100272607
309 Ga0070711_100541372
310 Ga0070708_100124527
311 Ga0070678_100424382
312 Ga0070681_10236609
313 Ga0070681_11705778
314 Ga0070707_100002265
315 Ga0070707_101904780
316 Ga0070698_100778249
317 Ga0070698_100972576
318 Ga0070699_100063444
319 Ga0070699_100395011
320 Ga0070684_101208597
321 Ga0070684_101253157
322 Ga0070697_100051490
323 Ga0070697_100588267
324 Ga0070696_101271696
325 Ga0070665_102479140
326 Ga0070704_101622453
327 Ga0068855_100417268
328 Ga0068852_101452526
329 Ga0068863_100354192
330 Ga0081455_10500417
331 Ga0070715_10024575
332 Ga0070716_100574977
333 Ga0070712_100161902
334 Ga0070712_100270100
335 Ga0070712_100542820
336 Ga0070712_101280483
337 Ga0075428_100054404
338 Ga0075430_100029416
339 Ga0075431_100112945
340 Ga0075429_100093426
341 Ga0111539_10009208
342 Ga0111539_11426032
343 Ga0105245_11481741
344 Ga0105247_11185164
345 Ga0105247_11762381
346 Ga0105241_10475381
347 Ga0105242_11341536
348 Ga0105248_10424668
349 Ga0105248_10436544
350 Ga0099796_10034225
351 Ga0099796_10169768
352 Ga0099796_10265884
353 Ga0105239_12304082
354 Ga0157373_10210029
355 Ga0163162_10451952
356 Ga0157375_10280541
357 Ga0163163_11005856
358 Ga0182008_10018291
359 Ga0182008_10125940
360 Ga0157379_11259220
361 Ga0157376_11037485
362 Ga0184602_123153
363 Ga0184597_101032
364 Ga0184598_115547
365 Ga0197907_10290068
366 Ga0197907_10498342
367 Ga0206356_11268769
368 Ga0206352_10255418
369 Ga0206352_10702263
370 Ga0206352_11290627
371 Ga0206354_10571245
372 Ga0206353_10104862
373 Ga0213872_10296490
374 Ga0213874_10047656
375 Ga0213876_10389458
376 Ga0213876_10605753
377 Ga0213875_10000122
378 Ga0213875_10004381
379 Ga0213875_10020810
380 Ga0213875_10226959
381 Ga0213871_10013774
382 Ga0213871_10174369
383 Ga0224712_10112118
384 Ga0247553_101020
385 Ga0207692_10030291
386 Ga0207692_10146151
387 Ga0207692_10257006
388 Ga0207685_10130719
389 Ga0207699_10041133
390 Ga0207699_10898343
391 Ga0207684_10478264
392 Ga0207684_10660474
393 Ga0207707_10150752
394 Ga0207693_10070892
395 Ga0207693_10163260
396 Ga0207693_10236734
397 Ga0207693_11162740
398 Ga0207663_10086960
399 Ga0207663_10326057
400 Ga0207663_10629396
401 Ga0207660_10965695
402 Ga0207662_10050539
403 Ga0207652_10683699
404 Ga0207646_10012377
405 Ga0207700_10012043
406 Ga0207700_10517616
407 Ga0207700_10856485
408 Ga0207664_10084816
409 Ga0207664_10119812
410 Ga0207664_10548287
411 Ga0207664_10973255
412 Ga0207644_10508346
413 Ga0207704_10548012
414 Ga0207665_10324887
415 Ga0207665_10539938
416 Ga0207661_10650187
417 Ga0207661_11142191
418 Ga0207712_11032575
419 Ga0207640_11793507
420 Ga0207703_10379750
421 Ga0207703_11532855
422 Ga0207708_10498299
423 Ga0207641_11125624
424 Ga0207683_10612101
425 Ga0207428_10074686
426 Ga0265338_10015998
427 Ga0307408_100818977
428 Ga0307405_10016853
429 Ga0307407_11197287
430 Ga0307412_11879808
431 Ga0307416_100754197
432 Ga0307414_10039697
433 Ga0307414_11692497
434 Ga0307415_100818983
435 Ga0307415_101422426
436 Ga0373930_0048978
437 Ga0373926_0042426
438 Ga0373934_0019843
439 Ga0373949_0088570
440 Ga0373923_0273282
441 Ga0373936_0457296
442 Ga0373941_0084408
443 Ga0373945_0228855
444 Ga0373953_0028017
445 Ga0373954_0047181
446 Ga0373956_0015617
447 Ga0373957_0004798
448 Ga0373957_0318568
449 Ga0373931_0191601
450 Ga0373935_0314336
451 Ga0373935_0602268
452 Ga0373933_0008276
453 Ga0373933_0018013
454 Ga0373933_0707022
455 Ga0373947_0029648
456 Ga0373947_0493520
457 Ga0373937_0002511
458 Ga0373937_0226423
459 Ga0373937_1327141
460 Ga0373925_0122755
461 Ga0436364_0176856
462 Ga0436364_0350701
463 Ga0436364_0423755
464 Ga0436364_0694571
465 Ga0436364_1245271
466 Ga0436364_1266685
467 Ga0436365_0138179
468 Ga0436365_0171998
469 Ga0436365_1795561
470 Ga0436360_0233254
471 Ga0436360_0351247
472 Ga0436360_0509026
473 Ga0436360_0824879
474 Ga0436360_0962249
475 Ga0436360_1253634
476 Ga0436361_0151399
477 Ga0436361_0633043
478 Ga0436361_0637341
479 Ga0436361_0902906
480 Ga0436361_0946458
481 Ga0436361_1082137
482 Ga0436361_1082487
483 Ga0436361_1085193
484 Ga0436361_1173603
485 Ga0436363_0284975
486 Ga0436363_0334537
487 Ga0436363_0971507
488 Ga0436363_0988962
489 Ga0436363_1174593
490 Ga0436362_0038761
491 Ga0436362_0048256
492 Ga0436362_0100477
493 Ga0436362_0199228
494 Ga0436362_0240974
495 Ga0436362_0510413
496 Ga0436362_0573338
497 Ga0436362_0880180
498 Ga0436362_1185482
499 Ga0436362_1279008
500 Ga0439441_054819
501 Ga0466963_0865383
502 Ga0466967_1668030
503 Ga0466967_1925186
504 Ga0495592_0030652
505 Ga0495651_0983886
506 Ga0495580_0324508
507 Ga0495618_0136906
508 Ga0495628_0466128
509 Ga0495640_0097764
510 Ga0495586_0300831
511 Ga0495621_0101338
512 Ga0495667_0178751
513 Ga0495634_0273647
514 Ga0495635_0382580
515 Ga0495599_0606310
516 Ga0495646_0342802
517 Ga0495600_0015616
518 Ga0495604_0786842
519 Ga0495680_0013503
520 Ga0495684_0955515
521 Ga0495602_0439441
522 Ga0496106_0574444
523 Ga0496108_1129422
524 Ga0496109_0461495
525 Ga0496110_1669387
526 Ga0496113_0153892
527 Ga0501036_1404761
528 Ga0501072_1522221
529 nmdc:mga09592_191151_c1
530 nmdc:mga08y16_106408_c1
531 nmdc:mga08y16_2070345_c1
532 nmdc:mga0n895_2241761_c1
533 nmdc:mga08x19_1157694_c1
534 nmdc:mga08x19_436960_c1
535 nmdc:mga08x19_62475_c1
536 Ga0495601_0084698
537 Ga0495595_0029217
538 Ga0495619_0009251
539 Ga0495619_0030183
540 Ga0587062_127562
541 Ga0587076_058891
542 Ga0587111_0092745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08883

DOPA_dioxygen

Dopa 4,5-dioxygenase family

10

109

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.9937 12 115
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.9417 12 115
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.8914 12 115
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.834 12 115
1zn0-assembly1.cif.gz_B coordinates of rrf and ef-g fitted into cryo-em map of the 50s subunit bound with both ef-g (gdpnp) and rrf 0.6559 14 91
ID Description Score Start End Superfamily
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9934 12 115 3.30.70.1240
af_Q59TT2_5_125_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.949 12 116 3.30.70.1240
2p8iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9288 12 115 3.30.70.1240
af_A0A1D8PEW7_24_150_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9265 12 114 3.30.70.1240
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.8894 12 115 3.30.70.1240
ID Description Score Start End GO Terms
AF-A0A3S0RB48-F1-model_v4 4,5-dioxygenase 0.9998 12 116 GO:0051213
AF-A0A1Z4R3S1-F1-model_v4 DOPA-dioxygenase-like protein 0.997 12 115 GO:0051213
AF-A0A433VGC9-F1-model_v4 DOPA 4,5-dioxygenase 0.9963 11 115 GO:0051213
AF-K9PD49-F1-model_v4 Dopa 45-dioxygenase 0.9949 12 115 GO:0051213
AF-A0A2N6JUM2-F1-model_v4 4,5-dioxygenase 0.9946 12 85 GO:0051213

Map