F377311

General Info

Members Datasets Scaffolds Average Seq Length
270 193 540 333

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221716|2644641620
Length 389
Sequence KKLVIILTFVKFRFDKSLCNFATLKNLKSKLRILATQHLRTSKKMKYTTIPNTDIKVSKINLGTMTFGQQNTEAEGHAQMDYALEQGVNFFDTAEMYSVPANEATYGSTEKIIGTWFKKTGNRDKVVLASKIAGPNANFGYMREKLDFSPASIKYALENSLKRLQTDYVDLYQMHWPERKTNYFGQRGFNGYEDAWEDHFGEILETFDGLIKEGKIKHIGVSNENAWGMMRLLEESKYNNLPRIKTVQNPYNLLNRLFEVGSAEVSKYENVGLLAYSPLAFGILTGKFLTGEEHPNSRIKLFPQYTRYNSEQCTQATKLYQEIAKKHGLSLTELAMGFVLQQPFLTSAIIGATTMEQLKENIATIDVVLSKEIIAEINHVQAIIPDPAP

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
83 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
84 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
92 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
93 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
96 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
141 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
144 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
145 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
150 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
151 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
152 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
153 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
163 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
164 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
165 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
166 2643221629 Devosia sp. Root105 Isolate Unclassified
167 2643221662 Devosia sp. Root413D1 Isolate Unclassified
168 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
169 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
170 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
171 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
172 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
173 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
174 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
175 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
176 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
177 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
178 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
179 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
180 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
181 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
182 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
183 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
184 2909042592 Labrys sp. LIt4 Isolate Nodule
185 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
186 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
187 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
188 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
189 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
190 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
191 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
192 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
193 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.41
Metatranscriptomes 0.74
Isolates 11.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.93
Nodule 1.85
Rhizoplane 0.74
Rhizosphere 73.33
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10192237 3300003323 Bacteria 6448
2 rootH1_10300926 3300003323 Bacteria 1649
3 Ga0006562J51391_1028965 3300003578 Bacteria 1250
4 Ga0065714_10008239 3300005288 Bacteria 3562
5 Ga0065714_10079997 3300005288 Bacteria 2471
6 Ga0065714_10089441 3300005288 Bacteria 1974
7 Ga0065714_10094471 3300005288 Bacteria 1815
8 Ga0070658_10000279 3300005327 Bacteria 44799
9 Ga0070670_100000948 3300005331 Bacteria 22791
10 Ga0070669_100072859 3300005353 Bacteria 2544
11 Ga0070675_100004964 3300005354 Bacteria 10154
12 Ga0070659_100225427 3300005366 Bacteria 1548
13 Ga0070667_100034258 3300005367 Bacteria 4248
14 Ga0070667_100145854 3300005367 Bacteria 2076
15 Ga0070667_100414063 3300005367 Bacteria 1228
16 Ga0070714_100016495 3300005435 Bacteria 5967
17 Ga0068855_100234623 3300005563 Bacteria 2052
18 Ga0068857_100076595 3300005577 Bacteria 2983
19 Ga0068856_100169027 3300005614 Bacteria 2198
20 Ga0068856_100508941 3300005614 Bacteria 1225
21 Ga0068859_100011934 3300005617 Bacteria 8728
22 Ga0068858_100013452 3300005842 Bacteria 7721
23 Ga0068862_100120213 3300005844 Bacteria 2315
24 Ga0081455_10006480 3300005937 Bacteria 12549
25 Ga0081455_10173397 3300005937 Bacteria 1640
26 Ga0081538_10015708 3300005981 Bacteria 5846
27 Ga0070717_10000399 3300006028 Bacteria 27821
28 Ga0075362_10093806 3300006177 Bacteria 1396
29 Ga0097621_100050461 3300006237 Bacteria 3384
30 Ga0075428_100123658 3300006844 Bacteria 2816
31 Ga0075428_100418623 3300006844 Bacteria 1435
32 Ga0075431_100047095 3300006847 Bacteria 4445
33 Ga0075433_10026072 3300006852 Bacteria 4944
34 Ga0075434_100043923 3300006871 Bacteria 4433
35 Ga0075429_100032152 3300006880 Bacteria 4560
36 Ga0097620_100011934 3300006931 Bacteria 8728
37 Ga0099826_10009934 3300006948 Bacteria 7112
38 Ga0075435_100091333 3300007076 Bacteria 2513
39 Ga0105244_10000062 3300009036 Bacteria 122951
40 Ga0105240_10042163 3300009093 Bacteria 5818
41 Ga0105247_10052840 3300009101 Bacteria 2506
42 Ga0105247_10066776 3300009101 Bacteria 2240
43 Ga0105243_10236633 3300009148 Bacteria 1623
44 Ga0105248_10122365 3300009177 Bacteria 2935
45 Ga0105237_10000275 3300009545 Bacteria 72320
46 Ga0105237_10682864 3300009545 Bacteria 1033
47 Ga0105238_10090883 3300009551 Bacteria 3041
48 Ga0105238_10595292 3300009551 Bacteria 1113
49 Ga0105249_10145136 3300009553 Bacteria 2279
50 Ga0105239_10013247 3300010375 Bacteria 9166
51 Ga0105239_10019464 3300010375 Bacteria 7493
52 Ga0105239_10467106 3300010375 Bacteria 1432
53 Ga0157370_10004870 3300013104 Bacteria 15241
54 Ga0157370_10018518 3300013104 Bacteria 7001
55 Ga0157369_10002472 3300013105 Bacteria 22147
56 Ga0163163_10011635 3300014325 Bacteria 7993
57 Ga0163163_10054779 3300014325 Bacteria 3941
58 Ga0163163_10345569 3300014325 Unclassified 1543
59 Ga0157379_10015567 3300014968 Bacteria 6677
60 Ga0157376_10011032 3300014969 Bacteria 6641
61 Ga0182006_1000850 3300015261 Bacteria 20567
62 Ga0182006_1006443 3300015261 Bacteria 5454
63 Ga0163161_10000222 3300017792 Bacteria 51953
64 Ga0213875_10000016 3300021388 Bacteria 260448
65 Ga0213875_10006903 3300021388 Bacteria 5917
66 Ga0209676_1000049 3300025292 Bacteria 403210
67 Ga0209050_1007521 3300025298 Bacteria 6081
68 Ga0207655_1000003 3300025728 Bacteria 1081376
69 Ga0207710_10041834 3300025900 Bacteria 2033
70 Ga0207705_10000311 3300025909 Bacteria 44823
71 Ga0207671_10000134 3300025914 Bacteria 113822
72 Ga0207704_10351036 3300025938 Bacteria 1148
73 Ga0207667_10199573 3300025949 Bacteria 2052
74 Ga0207712_10109445 3300025961 Bacteria 2070
75 Ga0207668_10224689 3300025972 Bacteria 1510
76 Ga0207658_10311940 3300025986 Bacteria 1359
77 Ga0207703_10011409 3300026035 Bacteria 6910
78 Ga0207702_10270035 3300026078 Bacteria 1604
79 Ga0207675_100123549 3300026118 Bacteria 2450
80 Ga0209281_1000045 3300027111 Bacteria 328124
81 Ga0209489_111511 3300027361 Bacteria 8935
82 Ga0207428_10037451 3300027907 Bacteria 3946
83 Ga0268266_10276010 3300028379 Bacteria 1562
84 Ga0307515_10101384 3300028794 Bacteria 3475
85 Ga0307408_100000593 3300031548 Bacteria 31081
86 Ga0307408_100007732 3300031548 Bacteria 7110
87 Ga0316579_10000112 3300031691 Bacteria 21688
88 Ga0316579_10003484 3300031691 Bacteria 6146
89 Ga0316576_10001232 3300031727 Bacteria 13533
90 Ga0316576_10046195 3300031727 Bacteria 3151
91 Ga0316578_10000036 3300031728 Bacteria 27635
92 Ga0316578_10000232 3300031728 Bacteria 16402
93 Ga0316578_10003565 3300031728 Bacteria 7152
94 Ga0307405_10019170 3300031731 Bacteria 3793
95 Ga0307405_10051966 3300031731 Bacteria 2546
96 Ga0316577_10000097 3300031733 Bacteria 24000
97 Ga0316577_10003071 3300031733 Archaea 8380
98 Ga0307413_10000017 3300031824 Bacteria 47931
99 Ga0307413_10011006 3300031824 Bacteria 4421
100 Ga0307413_10051983 3300031824 Bacteria 2472
101 Ga0307413_10218849 3300031824 Bacteria 1389
102 Ga0307410_10000133 3300031852 Bacteria 26488
103 Ga0307410_10000362 3300031852 Bacteria 17704
104 Ga0307410_10003707 3300031852 Bacteria 7731
105 Ga0307410_10069987 3300031852 Bacteria 2429
106 Ga0307406_10000006 3300031901 Bacteria 147237
107 Ga0307406_10000125 3300031901 Bacteria 45008
108 Ga0307406_10023669 3300031901 Bacteria 3658
109 Ga0307407_10001555 3300031903 Bacteria 8435
110 Ga0307407_10006978 3300031903 Bacteria 5076
111 Ga0307412_10362589 3300031911 Bacteria 1167
112 Ga0307409_100003127 3300031995 Bacteria 8889
113 Ga0307409_100054929 3300031995 Bacteria 3071
114 Ga0307409_100167893 3300031995 Bacteria 1928
115 Ga0307409_100515137 3300031995 Bacteria 1167
116 Ga0307416_100000239 3300032002 Bacteria 29225
117 Ga0307416_100000473 3300032002 Bacteria 20507
118 Ga0307416_100069753 3300032002 Bacteria 2910
119 Ga0307414_10000027 3300032004 Bacteria 192277
120 Ga0307414_10002374 3300032004 Bacteria 9844
121 Ga0307414_10009646 3300032004 Bacteria 5558
122 Ga0307414_10060575 3300032004 Bacteria 2677
123 Ga0307414_10159778 3300032004 Bacteria 1788
124 Ga0307414_10206184 3300032004 Bacteria 1603
125 Ga0307411_10000016 3300032005 Bacteria 102494
126 Ga0307411_10041367 3300032005 Bacteria 2932
127 Ga0307415_100342284 3300032126 Bacteria 1255
128 Ga0316585_10000137 3300032137 Bacteria 14253
129 Ga0316580_10000114 3300032139 Bacteria 15009
130 Ga0316596_1006097 3300033541 Bacteria 2789
131 Ga0316574_0000367 3300035398 Bacteria 17528
132 Ga0316574_0059796 3300035398 Bacteria 2390
133 Ga0316582_0000029 3300036647 Bacteria 34187
134 Ga0316582_0008308 3300036647 Bacteria 5571
135 Ga0316582_0213399 3300036647 Bacteria 1319
136 Ga0316584_0003073 3300036712 Bacteria 10755
137 Ga0316584_0020812 3300036712 Bacteria 4762
138 Ga0316584_0027701 3300036712 Bacteria 4172
139 Ga0316584_0228129 3300036712 Bacteria 1366
140 Ga0395899_0046685 3300037312 Bacteria 3226
141 Ga0436364_0430043 3300037853 Bacteria 27379
142 Ga0436364_0768558 3300037853 Bacteria 187546
143 Ga0436364_1260602 3300037853 Bacteria 5983
144 Ga0395901_0087068 3300038443 Bacteria 3266
145 Ga0400490_52136 3300038726 Bacteria 70831
146 Ga0400485_17222 3300038735 Bacteria 8009
147 Ga0400488_15130 3300038741 Bacteria 2137
148 Ga0400483_072362 3300039062 Bacteria 16811
149 Ga0400483_113370 3300039062 Bacteria 1778
150 Ga0400483_138962 3300039062 Bacteria 2300
151 Ga0400483_150282 3300039062 Bacteria 22034
152 Ga0400483_155381 3300039062 Bacteria 7635
153 Ga0400483_264803 3300039062 Bacteria 3245
154 Ga0400489_60021 3300039093 Bacteria 8640
155 Ga0400487_15590 3300039110 Bacteria 1719
156 Ga0400487_20924 3300039110 Bacteria 3169
157 Ga0400487_59740 3300039110 Bacteria 3934
158 Ga0436361_0828225 3300039447 Bacteria 1376
159 Ga0439447_000071 3300041407 Bacteria 36246
160 Ga0439466_0002028 3300041411 Bacteria 7942
161 Ga0439466_0033249 3300041411 Bacteria 1753
162 Ga0439465_0025042 3300041413 Bacteria 1882
163 Ga0439448_0015963 3300042005 Bacteria 2281
164 Ga0439450_029531 3300042008 Bacteria 1226
165 Ga0466972_0004293 3300044658 Bacteria 7121
166 Ga0466972_0005574 3300044658 Bacteria 6305
167 Ga0466965_0002872 3300044683 Bacteria 7431
168 Ga0466965_0003000 3300044683 Bacteria 7326
169 Ga0466968_0007363 3300044735 Bacteria 4183
170 Ga0466968_0015218 3300044735 Bacteria 3045
171 Ga0466960_0002519 3300044901 Bacteria 6884
172 Ga0466960_0003438 3300044901 Bacteria 6089
173 Ga0466960_0113256 3300044901 Bacteria 1412
174 Ga0451576_0023697 3300045051 Bacteria 6642
175 Ga0495585_0145127 3300046492 Bacteria 1241
176 Ga0495663_0011917 3300046525 Bacteria 2422
177 Ga0495654_0023022 3300046530 Bacteria 3228
178 Ga0495625_0078467 3300046660 Bacteria 2305
179 Ga0495657_0018741 3300046675 Bacteria 5002
180 Ga0495623_0152969 3300046679 Unclassified 1362
181 Ga0495647_0137144 3300046681 Bacteria 1041
182 Ga0495674_0059482 3300047319 Bacteria 3337
183 Ga0495672_0111813 3300047320 Bacteria 1465
184 Ga0495676_0281314 3300047321 Bacteria 1126
185 Ga0495684_0004613 3300047471 Bacteria 10756
186 Ga0496114_0116190 3300048917 Bacteria 2297
187 Ga0496115_0012041 3300048918 Bacteria 6502
188 Ga0496116_0000130 3300048919 Bacteria 157116
189 Ga0496116_0152754 3300048919 Bacteria 1279
190 Ga0496117_0076409 3300048920 Bacteria 2221
191 Ga0496118_0081530 3300048921 Bacteria 2271
192 Ga0496121_0031408 3300048924 Bacteria 4853
193 Ga0496124_0033809 3300048927 Bacteria 4494
194 Ga0496125_0000098 3300048928 Bacteria 204522
195 Ga0496126_0003300 3300048929 Bacteria 20549
196 Ga0496126_0283791 3300048929 Bacteria 1371
197 Ga0501031_0025133 3300049568 Bacteria 3885
198 Ga0501032_0000226 3300049569 Bacteria 46882
199 Ga0501034_0000001 3300049571 Bacteria 2184493
200 Ga0501034_0042041 3300049571 Bacteria 4625
201 Ga0501034_0407747 3300049571 Bacteria 1281
202 Ga0501036_0009555 3300049572 Bacteria 7976
203 Ga0501038_0056905 3300049574 Bacteria 3358
204 Ga0501038_0128885 3300049574 Bacteria 2079
205 Ga0501039_0000001 3300049575 Bacteria 449008
206 Ga0501042_0334523 3300049578 Bacteria 1094
207 Ga0501043_0036864 3300049579 Bacteria 3847
208 Ga0501043_0108872 3300049579 Bacteria 2176
209 Ga0501046_0132815 3300049580 Bacteria 1887
210 Ga0501048_0024704 3300049582 Bacteria 4384
211 Ga0501074_0003901 3300049590 Bacteria 10626
212 Ga0501076_0007870 3300049592 Bacteria 7770
213 Ga0501238_000024 3300049671 Bacteria 27924
214 Ga0501249_000080 3300049679 Bacteria 30920
215 Ga0501249_000505 3300049679 Bacteria 9504
216 Ga0501249_006207 3300049679 Bacteria 2455
217 Ga0501081_0013612 3300049743 Bacteria 5347
218 Ga0501266_000024 3300049763 Bacteria 82394
219 Ga0501280_002649 3300049776 Bacteria 2918
220 Ga0501282_004295 3300049778 Bacteria 1528
221 Ga0501044_0371473 3300049823 Bacteria 1347
222 nmdc:mga09592_150035_c1 3300050508 Bacteria 2011
223 nmdc:mga0rr50_88958_c1 3300050513 Bacteria 2400
224 Ga0500646_0002832 3300053090 Bacteria 4457
225 Ga0500641_0000063 3300053096 Bacteria 44172
226 Ga0500641_0000403 3300053096 Bacteria 16008
227 Ga0500555_003226 3300053103 Bacteria 4645
228 Ga0500562_000031 3300053108 Bacteria 90469
229 Ga0500592_002893 3300053116 Bacteria 2758
230 Ga0500594_0020053 3300053118 Bacteria 1664
231 Ga0500607_148438 3300053121 Bacteria 1091
232 Ga0500658_0000014 3300053134 Bacteria 153278
233 Ga0500559_0023362 3300053136 Bacteria 2625
234 Ga0500559_0035451 3300053136 Bacteria 2155
235 Ga0500616_0022788 3300053153 Bacteria 3494
236 Ga0500584_005151 3300053726 Bacteria 5457
237 Ga0501084_0001906 3300054114 Bacteria 16641
238 Ga0501082_0004870 3300060353 Bacteria 11712
239 2644641620 2643221716 Bacteria 4986332
240 2513234531 2513020052 Bacteria 5120511
241 2520880265 2519899754 Bacteria 5336938
242 2644008910 2643221600 Bacteria 5530138
243 2644167888 2643221629 Bacteria 5850260
244 2644348584 2643221662 Bacteria 5851492
245 2644371036 2643221667 Bacteria 5627472
246 2644682270 2643221725 Bacteria 5087956
247 2738735367 2738541279 Bacteria 6149495
248 2738767944 2738541285 Bacteria 6150075
249 2739216949 2738543007 Bacteria 6149845
250 2740000585 2739367857 Bacteria 5433684
251 2740005401 2739367858 Bacteria 5432813
252 2802651040 2802428842 Bacteria 4926114
253 2816427640 2816332119 Bacteria 8120218
254 2817413928 2816332280 Bacteria 5109718
255 2857616338 2857613821 Bacteria 4917088
256 2857622473 2857618242 Bacteria 5635925
257 2881361224 2881359912 Bacteria 4935907
258 2903899019 2903895155 Bacteria 5258610
259 2904424208 2904419702 Bacteria 5166287
260 2904557548 2904555929 Bacteria 5218588
261 2909047582 2909042592 Bacteria 6499737
262 2919195932 2919191525 Bacteria 5765973
263 2919686834 2919683626 Bacteria 5534354
264 2929151074 2929150217 Bacteria 5462483
265 2958461885 2958458903 Bacteria 5301041
266 2977272451 2977268062 Bacteria 5243061
267 8054309698 8054307821 Bacteria 5212224
268 8054797308 8054795415 Bacteria 9785225
269 8055592261 8055592153 Bacteria 5961247
270 8056440596 8056440228 Bacteria 4946504
271 rootH1_10192237
272 rootH1_10300926
273 Ga0006562J51391_1028965
274 Ga0065714_10008239
275 Ga0065714_10079997
276 Ga0065714_10089441
277 Ga0065714_10094471
278 Ga0070658_10000279
279 Ga0070670_100000948
280 Ga0070669_100072859
281 Ga0070675_100004964
282 Ga0070659_100225427
283 Ga0070667_100034258
284 Ga0070667_100145854
285 Ga0070667_100414063
286 Ga0070714_100016495
287 Ga0068855_100234623
288 Ga0068857_100076595
289 Ga0068856_100169027
290 Ga0068856_100508941
291 Ga0068859_100011934
292 Ga0068858_100013452
293 Ga0068862_100120213
294 Ga0081455_10006480
295 Ga0081455_10173397
296 Ga0081538_10015708
297 Ga0070717_10000399
298 Ga0075362_10093806
299 Ga0097621_100050461
300 Ga0075428_100123658
301 Ga0075428_100418623
302 Ga0075431_100047095
303 Ga0075433_10026072
304 Ga0075434_100043923
305 Ga0075429_100032152
306 Ga0097620_100011934
307 Ga0099826_10009934
308 Ga0075435_100091333
309 Ga0105244_10000062
310 Ga0105240_10042163
311 Ga0105247_10052840
312 Ga0105247_10066776
313 Ga0105243_10236633
314 Ga0105248_10122365
315 Ga0105237_10000275
316 Ga0105237_10682864
317 Ga0105238_10090883
318 Ga0105238_10595292
319 Ga0105249_10145136
320 Ga0105239_10013247
321 Ga0105239_10019464
322 Ga0105239_10467106
323 Ga0157370_10004870
324 Ga0157370_10018518
325 Ga0157369_10002472
326 Ga0163163_10011635
327 Ga0163163_10054779
328 Ga0163163_10345569
329 Ga0157379_10015567
330 Ga0157376_10011032
331 Ga0182006_1000850
332 Ga0182006_1006443
333 Ga0163161_10000222
334 Ga0213875_10000016
335 Ga0213875_10006903
336 Ga0209676_1000049
337 Ga0209050_1007521
338 Ga0207655_1000003
339 Ga0207710_10041834
340 Ga0207705_10000311
341 Ga0207671_10000134
342 Ga0207704_10351036
343 Ga0207667_10199573
344 Ga0207712_10109445
345 Ga0207668_10224689
346 Ga0207658_10311940
347 Ga0207703_10011409
348 Ga0207702_10270035
349 Ga0207675_100123549
350 Ga0209281_1000045
351 Ga0209489_111511
352 Ga0207428_10037451
353 Ga0268266_10276010
354 Ga0307515_10101384
355 Ga0307408_100000593
356 Ga0307408_100007732
357 Ga0316579_10000112
358 Ga0316579_10003484
359 Ga0316576_10001232
360 Ga0316576_10046195
361 Ga0316578_10000036
362 Ga0316578_10000232
363 Ga0316578_10003565
364 Ga0307405_10019170
365 Ga0307405_10051966
366 Ga0316577_10000097
367 Ga0316577_10003071
368 Ga0307413_10000017
369 Ga0307413_10011006
370 Ga0307413_10051983
371 Ga0307413_10218849
372 Ga0307410_10000133
373 Ga0307410_10000362
374 Ga0307410_10003707
375 Ga0307410_10069987
376 Ga0307406_10000006
377 Ga0307406_10000125
378 Ga0307406_10023669
379 Ga0307407_10001555
380 Ga0307407_10006978
381 Ga0307412_10362589
382 Ga0307409_100003127
383 Ga0307409_100054929
384 Ga0307409_100167893
385 Ga0307409_100515137
386 Ga0307416_100000239
387 Ga0307416_100000473
388 Ga0307416_100069753
389 Ga0307414_10000027
390 Ga0307414_10002374
391 Ga0307414_10009646
392 Ga0307414_10060575
393 Ga0307414_10159778
394 Ga0307414_10206184
395 Ga0307411_10000016
396 Ga0307411_10041367
397 Ga0307415_100342284
398 Ga0316585_10000137
399 Ga0316580_10000114
400 Ga0316596_1006097
401 Ga0316574_0000367
402 Ga0316574_0059796
403 Ga0316582_0000029
404 Ga0316582_0008308
405 Ga0316582_0213399
406 Ga0316584_0003073
407 Ga0316584_0020812
408 Ga0316584_0027701
409 Ga0316584_0228129
410 Ga0395899_0046685
411 Ga0436364_0430043
412 Ga0436364_0768558
413 Ga0436364_1260602
414 Ga0395901_0087068
415 Ga0400490_52136
416 Ga0400485_17222
417 Ga0400488_15130
418 Ga0400483_072362
419 Ga0400483_113370
420 Ga0400483_138962
421 Ga0400483_150282
422 Ga0400483_155381
423 Ga0400483_264803
424 Ga0400489_60021
425 Ga0400487_15590
426 Ga0400487_20924
427 Ga0400487_59740
428 Ga0436361_0828225
429 Ga0439447_000071
430 Ga0439466_0002028
431 Ga0439466_0033249
432 Ga0439465_0025042
433 Ga0439448_0015963
434 Ga0439450_029531
435 Ga0466972_0004293
436 Ga0466972_0005574
437 Ga0466965_0002872
438 Ga0466965_0003000
439 Ga0466968_0007363
440 Ga0466968_0015218
441 Ga0466960_0002519
442 Ga0466960_0003438
443 Ga0466960_0113256
444 Ga0451576_0023697
445 Ga0495585_0145127
446 Ga0495663_0011917
447 Ga0495654_0023022
448 Ga0495625_0078467
449 Ga0495657_0018741
450 Ga0495623_0152969
451 Ga0495647_0137144
452 Ga0495674_0059482
453 Ga0495672_0111813
454 Ga0495676_0281314
455 Ga0495684_0004613
456 Ga0496114_0116190
457 Ga0496115_0012041
458 Ga0496116_0000130
459 Ga0496116_0152754
460 Ga0496117_0076409
461 Ga0496118_0081530
462 Ga0496121_0031408
463 Ga0496124_0033809
464 Ga0496125_0000098
465 Ga0496126_0003300
466 Ga0496126_0283791
467 Ga0501031_0025133
468 Ga0501032_0000226
469 Ga0501034_0000001
470 Ga0501034_0042041
471 Ga0501034_0407747
472 Ga0501036_0009555
473 Ga0501038_0056905
474 Ga0501038_0128885
475 Ga0501039_0000001
476 Ga0501042_0334523
477 Ga0501043_0036864
478 Ga0501043_0108872
479 Ga0501046_0132815
480 Ga0501048_0024704
481 Ga0501074_0003901
482 Ga0501076_0007870
483 Ga0501238_000024
484 Ga0501249_000080
485 Ga0501249_000505
486 Ga0501249_006207
487 Ga0501081_0013612
488 Ga0501266_000024
489 Ga0501280_002649
490 Ga0501282_004295
491 Ga0501044_0371473
492 nmdc:mga09592_150035_c1
493 nmdc:mga0rr50_88958_c1
494 Ga0500646_0002832
495 Ga0500641_0000063
496 Ga0500641_0000403
497 Ga0500555_003226
498 Ga0500562_000031
499 Ga0500592_002893
500 Ga0500594_0020053
501 Ga0500607_148438
502 Ga0500658_0000014
503 Ga0500559_0023362
504 Ga0500559_0035451
505 Ga0500616_0022788
506 Ga0500584_005151
507 Ga0501084_0001906
508 Ga0501082_0004870
509 2644641620
510 2513234531
511 2520880265
512 2644008910
513 2644167888
514 2644348584
515 2644371036
516 2644682270
517 2738735367
518 2738767944
519 2739216949
520 2740000585
521 2740005401
522 2802651040
523 2816427640
524 2817413928
525 2857616338
526 2857622473
527 2881361224
528 2903899019
529 2904424208
530 2904557548
531 2909047582
532 2919195932
533 2919686834
534 2929151074
535 2958461885
536 2977272451
537 8054309698
538 8054797308
539 8055592261
540 8056440596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

59

382

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9621 1 315
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9587 1 315
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9556 1 315
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9475 1 315
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9419 1 317
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9222 1 317 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9134 1 313 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9108 1 315 3.20.20.100
3up8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9074 6 312 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9026 1 313 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A379AEG0-F1-model_v4 General stress protein 69 (EC 1.1.1.-) 0.9995 2 181 GO:0005829
GO:0016491
AF-A0A519RMU5-F1-model_v4 Aldo/keto reductase 0.9901 43 316 GO:0005829
AF-A0A3N7H1F2-F1-model_v4 Aldo/keto reductase 0.9899 150 314 GO:0005829
AF-B9B0Z6-F1-model_v4 deleted 0.9875 1 315
AF-A0A2Z6TUM4-F1-model_v4 deleted 0.9866 1 315

Map