F376877

General Info

Members Datasets Scaffolds Average Seq Length
270 240 193 160

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100647632|Ga0075435_1006476322
Length 150
Sequence MKAYRIGDKDGAYPIFSGEGSRDAPGRWNDLGQPMIYASEHYSTAMLEKLVRLGEMPPNQHFVEITIERGVSYEEVNVDLLPNWRGENQAQARGFGSRWFTEKRSAILIVPSVVAPVDKNVLINPNHEHFRHISASRERTIWWDARLFAA

Samples

Sample ID Description Type Environment
1 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
4 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
5 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
6 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
7 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
8 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
9 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
10 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
11 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
12 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
13 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
14 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
15 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
16 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
17 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
18 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
19 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
20 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
21 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
22 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
23 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
24 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
25 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
26 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
27 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
28 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
29 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
30 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
31 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
32 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
33 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
34 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
35 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
36 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
37 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
38 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
39 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
40 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
41 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
42 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
43 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
44 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
45 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
46 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
47 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
48 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
49 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
50 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
51 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
52 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
53 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
54 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
55 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
56 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
57 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
58 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
59 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
60 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
61 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
62 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
63 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
64 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
65 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
66 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
67 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
68 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
69 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
70 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
71 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
72 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
73 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
74 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
75 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
76 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
77 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
78 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
240 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.48
Metatranscriptomes 0
Isolates 28.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 27.04
Rhizoplane 4.07
Rhizosphere 60
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10246443 3300003320 Unclassified 1191
2 rootL2_10233103 3300003322 Bacteria 1443
3 rootH1_10284088 3300003323 Unclassified 2188
4 Ga0070683_101812239 3300005329 Unclassified 587
5 Ga0070660_100034465 3300005339 Bacteria 3825
6 Ga0070660_100087406 3300005339 Bacteria 2454
7 Ga0070659_100000265 3300005366 Bacteria 41345
8 Ga0070709_10040775 3300005434 Bacteria 2856
9 Ga0070714_100272275 3300005435 Bacteria 1570
10 Ga0070713_100044197 3300005436 Bacteria 3645
11 Ga0070713_100090201 3300005436 Bacteria 2635
12 Ga0070710_10020567 3300005437 Bacteria 3426
13 Ga0070681_10112339 3300005458 Bacteria 2664
14 Ga0070679_100101917 3300005530 Bacteria 2857
15 Ga0070665_100000194 3300005548 Bacteria 107719
16 Ga0068856_100117352 3300005614 Bacteria 2662
17 Ga0068856_100804066 3300005614 Unclassified 960
18 Ga0068852_100217391 3300005616 Bacteria 1816
19 Ga0068852_100804342 3300005616 Bacteria 954
20 Ga0068860_101187544 3300005843 Bacteria 783
21 Ga0081455_10041243 3300005937 Bacteria 4061
22 Ga0081540_1013009 3300005983 Bacteria 5435
23 Ga0070717_10472445 3300006028 Unclassified 1132
24 Ga0070715_10169927 3300006163 Bacteria 1085
25 Ga0070712_100001851 3300006175 Bacteria 12895
26 Ga0070712_100788089 3300006175 Bacteria 815
27 Ga0068871_100207418 3300006358 Bacteria 1694
28 Ga0075435_100647632 3300007076 Bacteria 917
29 Ga0099794_10029307 3300007265 Bacteria 2564
30 Ga0105240_10062085 3300009093 Bacteria 4653
31 Ga0105240_11001202 3300009093 Unclassified 894
32 Ga0105245_10078369 3300009098 Bacteria 3015
33 Ga0105242_10350915 3300009176 Bacteria 1362
34 Ga0105248_10128651 3300009177 Bacteria 2857
35 Ga0105237_10304497 3300009545 Bacteria 1597
36 Ga0105238_10770216 3300009551 Bacteria 977
37 Ga0105249_10919435 3300009553 Bacteria 942
38 Ga0105239_10093197 3300010375 Bacteria 3325
39 Ga0105239_10097300 3300010375 Bacteria 3253
40 Ga0157370_10093479 3300013104 Bacteria 2822
41 Ga0157369_10047014 3300013105 Bacteria 4687
42 Ga0157372_10030328 3300013307 Bacteria 5917
43 Ga0157376_10019861 3300014969 Bacteria 5187
44 Ga0213876_10210716 3300021384 Unclassified 1033
45 Ga0213876_10316488 3300021384 Unclassified 830
46 Ga0213875_10048781 3300021388 Bacteria 1986
47 Ga0213875_10082851 3300021388 Bacteria 1497
48 Ga0207685_10103435 3300025905 Bacteria 1222
49 Ga0207707_10246429 3300025912 Bacteria 1552
50 Ga0207695_10172568 3300025913 Bacteria 2087
51 Ga0207693_10023488 3300025915 Bacteria 4895
52 Ga0207693_10840326 3300025915 Bacteria 706
53 Ga0207657_10074636 3300025919 Bacteria 2863
54 Ga0207657_10175286 3300025919 Bacteria 1736
55 Ga0207652_10406889 3300025921 Bacteria 1228
56 Ga0207694_10059415 3300025924 Bacteria 2973
57 Ga0207687_10051272 3300025927 Bacteria 2876
58 Ga0207700_10007750 3300025928 Bacteria 6597
59 Ga0207664_10208441 3300025929 Bacteria 1690
60 Ga0207690_10002297 3300025932 Bacteria 11665
61 Ga0207686_10273648 3300025934 Bacteria 1243
62 Ga0207669_10429647 3300025937 Bacteria 1042
63 Ga0207711_10140351 3300025941 Bacteria 2173
64 Ga0207639_10351873 3300026041 Bacteria 1316
65 Ga0207678_10684377 3300026067 Bacteria 902
66 Ga0207702_10194565 3300026078 Bacteria 1876
67 Ga0207698_11091394 3300026142 Bacteria 811
68 Ga0209588_1043429 3300027671 Bacteria 1452
69 Ga0268266_10000189 3300028379 Bacteria 109217
70 Ga0265334_10006177 3300028573 Bacteria 5184
71 Ga0307413_10484809 3300031824 Bacteria 989
72 Ga0307414_10191713 3300032004 Bacteria 1654
73 Ga0307414_10216869 3300032004 Bacteria 1568
74 Ga0307414_10309064 3300032004 Bacteria 1341
75 Ga0307414_10560403 3300032004 Bacteria 1019
76 Ga0307414_11137943 3300032004 Bacteria 721
77 Ga0373926_0072291 3300035083 Bacteria 1268
78 Ga0373944_0012102 3300035089 Bacteria 2373
79 Ga0373945_0059718 3300035116 Bacteria 1420
80 Ga0373943_0011282 3300035170 Bacteria 4020
81 Ga0373946_0017932 3300035171 Bacteria 2712
82 Ga0373924_0373979 3300035410 Bacteria 636
83 Ga0373935_0137472 3300035692 Bacteria 1647
84 Ga0373935_0179949 3300035692 Bacteria 1451
85 Ga0373927_0176364 3300035695 Bacteria 1401
86 Ga0373927_0531507 3300035695 Bacteria 777
87 Ga0373927_0900540 3300035695 Unclassified 584
88 Ga0373933_0146326 3300035724 Bacteria 1494
89 Ga0373947_0232156 3300035725 Bacteria 1215
90 Ga0373937_0041069 3300036401 Bacteria 4219
91 Ga0373937_0056835 3300036401 Bacteria 3594
92 Ga0373925_0157957 3300037068 Bacteria 1784
93 Ga0373925_0220835 3300037068 Bacteria 1512
94 Ga0395899_0304141 3300037312 Bacteria 1078
95 Ga0395898_0043808 3300037466 Bacteria 4409
96 Ga0395905_0394592 3300037471 Bacteria 1278
97 Ga0436364_0236951 3300037853 Bacteria 1812
98 Ga0436364_0702641 3300037853 Unclassified 781
99 Ga0436364_1098564 3300037853 Bacteria 2112
100 Ga0436364_1510486 3300037853 Bacteria 4448
101 Ga0395901_0092459 3300038443 Bacteria 3167
102 Ga0436365_0142883 3300039437 Bacteria 1247
103 Ga0436365_0551447 3300039437 Bacteria 1293
104 Ga0436365_0678146 3300039437 Unclassified 1916
105 Ga0436360_0781120 3300039438 Bacteria 1696
106 Ga0436361_0184877 3300039447 Bacteria 1742
107 Ga0436361_1027560 3300039447 Bacteria 2234
108 Ga0450918_067543 3300042531 Bacteria 668
109 Ga0466957_0401198 3300044842 Bacteria 938
110 Ga0466960_0378667 3300044901 Bacteria 812
111 Ga0466959_0409374 3300045049 Bacteria 921
112 Ga0451576_0035288 3300045051 Bacteria 5307
113 Ga0466958_0111997 3300045836 Bacteria 1704
114 Ga0495603_0039956 3300046455 Bacteria 2809
115 Ga0495641_0161418 3300046461 Bacteria 1002
116 Ga0495651_0321305 3300046462 Bacteria 1032
117 Ga0495580_0928857 3300046472 Bacteria 558
118 Ga0495605_0023104 3300046474 Bacteria 3274
119 Ga0495664_0004945 3300046477 Bacteria 7297
120 Ga0495594_0155583 3300046499 Bacteria 1298
121 Ga0495583_0002178 3300046506 Bacteria 17472
122 Ga0495608_0056257 3300046511 Bacteria 2598
123 Ga0495616_0020611 3300046513 Bacteria 3582
124 Ga0495620_0009168 3300046515 Bacteria 5278
125 Ga0495643_0007708 3300046522 Bacteria 6899
126 Ga0495666_0139406 3300046526 Bacteria 1131
127 Ga0495640_0176524 3300046533 Bacteria 1363
128 Ga0495640_0248428 3300046533 Bacteria 1115
129 Ga0495587_0031943 3300046536 Bacteria 3185
130 Ga0495609_0261012 3300046538 Bacteria 712
131 Ga0495645_0003069 3300046543 Bacteria 11313
132 Ga0495667_0003226 3300046559 Bacteria 10933
133 Ga0495625_0007739 3300046660 Bacteria 9286
134 Ga0495635_0016007 3300046663 Bacteria 5238
135 Ga0495588_0040072 3300046674 Bacteria 2388
136 Ga0495599_0010611 3300046678 Bacteria 5638
137 Ga0495623_0386000 3300046679 Unclassified 756
138 Ga0495646_0046091 3300046680 Bacteria 2660
139 Ga0495647_0108392 3300046681 Bacteria 1157
140 Ga0495613_0569606 3300046689 Bacteria 756
141 Ga0495624_0169188 3300046690 Bacteria 1333
142 Ga0495671_0276796 3300046692 Bacteria 809
143 Ga0495649_0008500 3300046694 Bacteria 6170
144 Ga0495600_0113929 3300046809 Bacteria 1760
145 Ga0495660_0032814 3300046810 Bacteria 2915
146 Ga0495604_0029446 3300047317 Bacteria 4368
147 Ga0495674_0076712 3300047319 Bacteria 2874
148 Ga0495672_0130646 3300047320 Bacteria 1322
149 Ga0495676_0096849 3300047321 Bacteria 2192
150 Ga0495683_0007031 3300047323 Bacteria 6107
151 Ga0495687_191657 3300047443 Bacteria 657
152 Ga0495675_0062743 3300047444 Bacteria 2352
153 Ga0495684_0031580 3300047471 Bacteria 4067
154 Ga0495602_0010640 3300048088 Bacteria 9546
155 Ga0496101_0268239 3300048904 Bacteria 1332
156 Ga0496104_0123096 3300048907 Bacteria 2490
157 Ga0496106_0015463 3300048909 Bacteria 5649
158 Ga0496107_0018398 3300048910 Bacteria 4919
159 Ga0496108_0016265 3300048911 Bacteria 6065
160 Ga0496109_0007122 3300048912 Bacteria 9445
161 Ga0496110_0054519 3300048913 Bacteria 3517
162 Ga0496112_0050310 3300048915 Bacteria 4086
163 Ga0496113_0054818 3300048916 Bacteria 2986
164 Ga0496115_0022802 3300048918 Bacteria 4854
165 Ga0496115_0382582 3300048918 Bacteria 1144
166 Ga0496119_0019174 3300048922 Bacteria 5052
167 Ga0496122_0003377 3300048925 Bacteria 21019
168 Ga0496123_0002796 3300048926 Bacteria 20729
169 Ga0496126_0415360 3300048929 Bacteria 1089
170 Ga0495678_065753 3300049459 Bacteria 1345
171 Ga0495682_0178860 3300049460 Bacteria 754
172 Ga0501036_0267365 3300049572 Bacteria 1432
173 Ga0501038_0061404 3300049574 Bacteria 3214
174 Ga0501040_0359837 3300049576 Bacteria 1043
175 Ga0501047_0277340 3300049581 Bacteria 1522
176 Ga0501048_0465521 3300049582 Bacteria 906
177 Ga0501067_0118004 3300049583 Bacteria 1476
178 Ga0501070_0073521 3300049586 Bacteria 2829
179 Ga0501072_0493426 3300049588 Bacteria 969
180 Ga0501076_0140505 3300049592 Bacteria 1962
181 Ga0501044_0026251 3300049823 Bacteria 6168
182 nmdc:mga08x19_421558_c1 3300050514 Bacteria 937
183 Ga0495601_0033007 3300053077 Bacteria 3224
184 Ga0495601_0484235 3300053077 Bacteria 799
185 Ga0495612_0000237 3300053078 Bacteria 23124
186 Ga0495619_0032978 3300053085 Bacteria 3362
187 Ga0500652_076626 3300053131 Bacteria 1390
188 Ga0500658_0114254 3300053134 Bacteria 1191
189 Ga0500616_0086066 3300053153 Bacteria 1568
190 Ga0500645_003048 3300053730 Bacteria 7050
191 Ga0501082_0120256 3300060353 Bacteria 2277
192 Ga0501082_0867106 3300060353 Bacteria 790
193 Ga0466962_0086755 3300061719 Bacteria 1499

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100647632 Ga0075435_1006476322 150
2 iso_pu_bacteria 2513237101 2513692780 154
3 iso_pu_bacteria 2874604998 2874605438 154
4 iso_pu_bacteria 2876808645 2876809102 154
5 iso_pu_bacteria 2879110137 2879115731 154
6 iso_pu_bacteria 8006964411 8006967099 154
7 iso_pu_bacteria 8006994254 8006995788 154
8 3300035692 Ga0373935_0137472 Ga0373935_0137472_961_1434 155
9 3300036401 Ga0373937_0056835 Ga0373937_0056835_27_500 155
10 3300037068 Ga0373925_0220835 Ga0373925_0220835_372_845 155
11 iso_pu_bacteria 2513237086 2513587346 156
12 iso_pu_bacteria 2551306084 2551681688 156
13 iso_pu_bacteria 2551306085 2551684337 156
14 iso_pu_bacteria 2551306087 2551699136 156
15 iso_pu_bacteria 2551306090 2551720453 156
16 iso_pu_bacteria 2551306092 2551734200 156
17 iso_pu_bacteria 2551306093 2551740772 156
18 iso_pu_bacteria 2582581867 2585403983 156
19 iso_pu_bacteria 2585427590 2585824824 156
20 iso_pu_bacteria 2828305725 2828306078 156
21 iso_pu_bacteria 2841911363 2841911719 156
22 iso_pu_bacteria 2841917233 2841917324 156
23 iso_pu_bacteria 2855825444 2855829965 156
24 iso_pu_bacteria 2915993759 2915994067 156
25 iso_pu_bacteria 2916007675 2916010086 156
26 iso_pu_bacteria 2916014648 2916019012 156
27 iso_pu_bacteria 2916035215 2916035442 156
28 iso_pu_bacteria 2916068649 2916070667 156
29 iso_pu_bacteria 2921237296 2921238752 156
30 iso_pu_bacteria 2921289301 2921290254 156
31 iso_pu_bacteria 2921296804 2921304269 156
32 iso_pu_bacteria 2924150972 2924153173 156
33 iso_pu_bacteria 2924158325 2924162666 156
34 iso_pu_bacteria 2924165586 2924172386 156
35 iso_pu_bacteria 2924186466 2924192854 156
36 iso_pu_bacteria 2924214083 2924217449 156
37 iso_pu_bacteria 2937002841 2937003738 156
38 iso_pu_bacteria 2937016420 2937022506 156
39 iso_pu_bacteria 2937049772 2937051247 156
40 iso_pu_bacteria 2937056579 2937057030 156
41 iso_pu_bacteria 2937091812 2937092837 156
42 iso_pu_bacteria 2937098957 2937100394 156
43 iso_pu_bacteria 2957422303 2957422426 156
44 iso_pu_bacteria 2957430029 2957433984 156
45 iso_pu_bacteria 2957471148 2957475951 156
46 iso_pu_bacteria 2957484790 2957485963 156
47 iso_pu_bacteria 2957498199 2957504623 156
48 iso_pu_bacteria 2957505466 2957512521 156
49 iso_pu_bacteria 2960624210 2960627654 156
50 iso_pu_bacteria 2960631154 2960637689 156
51 iso_pu_bacteria 2960645483 2960652759 156
52 iso_pu_bacteria 2960652885 2960654029 156
53 iso_pu_bacteria 2964607997 2964609588 156
54 iso_pu_bacteria 2964649959 2964650788 156
55 iso_pu_bacteria 2964656573 2964658850 156
56 iso_pu_bacteria 2964678106 2964680451 156
57 iso_pu_bacteria 2967671571 2967676665 156
58 iso_pu_bacteria 2967678726 2967681452 156
59 iso_pu_bacteria 2967693043 2967699534 156
60 iso_pu_bacteria 2967714385 2967717271 156
61 iso_pu_bacteria 2967721400 2967727317 156
62 iso_pu_bacteria 2967742019 2967747278 156
63 iso_pu_bacteria 2967762386 2967763412 156
64 iso_pu_bacteria 2970019648 2970021853 156
65 iso_pu_bacteria 2970040964 2970041915 156
66 iso_pu_bacteria 2970047711 2970053876 156
67 iso_pu_bacteria 2970054988 2970055885 156
68 iso_pu_bacteria 2970061556 2970067625 156
69 iso_pu_bacteria 2970088815 2970095671 156
70 iso_pu_bacteria 2970109326 2970110987 156
71 iso_pu_bacteria 2970116247 2970117271 156
72 iso_pu_bacteria 2970129317 2970135784 156
73 iso_pu_bacteria 2970149975 2970156471 156
74 iso_pu_bacteria 2970164137 2970164156 156
75 iso_pu_bacteria 2970170962 2970171916 156
76 iso_pu_bacteria 2970184632 2970185280 156
77 iso_pu_bacteria 2970191845 2970193138 156
78 iso_pu_bacteria 2977537788 2977541952 156
79 iso_pu_bacteria 2977551784 2977554542 156
80 iso_pu_bacteria 2977572785 2977578731 156
81 iso_pu_bacteria 2977579622 2977585751 156
82 3300006358 Ga0068871_100207418 Ga0068871_1002074183 157
83 3300003322 rootL2_10233103 rootL2_102331032 158
84 3300005937 Ga0081455_10041243 Ga0081455_100412433 158
85 3300031824 Ga0307413_10484809 Ga0307413_104848092 158
86 3300032004 Ga0307414_10309064 Ga0307414_103090642 158
87 3300032004 Ga0307414_10560403 Ga0307414_105604032 158
88 3300047320 Ga0495672_0130646 Ga0495672_0130646_502_981 158
89 3300053134 Ga0500658_0114254 Ga0500658_0114254_203_679 158
90 3300025915 Ga0207693_10840326 Ga0207693_108403261 159
91 3300032004 Ga0307414_10191713 Ga0307414_101917132 159
92 3300032004 Ga0307414_10216869 Ga0307414_102168692 159
93 3300037471 Ga0395905_0394592 Ga0395905_0394592_604_1083 159
94 3300044842 Ga0466957_0401198 Ga0466957_0401198_352_834 159
95 3300045049 Ga0466959_0409374 Ga0466959_0409374_227_709 159
96 3300045836 Ga0466958_0111997 Ga0466958_0111997_1165_1647 159
97 3300048929 Ga0496126_0415360 Ga0496126_0415360_175_654 159
98 3300049572 Ga0501036_0267365 Ga0501036_0267365_551_1030 159
99 3300049574 Ga0501038_0061404 Ga0501038_0061404_221_700 159
100 3300049581 Ga0501047_0277340 Ga0501047_0277340_574_1053 159
101 3300049583 Ga0501067_0118004 Ga0501067_0118004_29_508 159
102 3300049586 Ga0501070_0073521 Ga0501070_0073521_283_762 159
103 3300049823 Ga0501044_0026251 Ga0501044_0026251_4787_5266 159
104 3300060353 Ga0501082_0120256 Ga0501082_0120256_1143_1622 159
105 3300061719 Ga0466962_0086755 Ga0466962_0086755_307_789 159
106 3300003320 rootH2_10246443 rootH2_102464432 160
107 3300003323 rootH1_10284088 rootH1_102840882 160
108 3300005329 Ga0070683_101812239 Ga0070683_1018122391 160
109 3300005339 Ga0070660_100034465 Ga0070660_1000344651 160
110 3300005339 Ga0070660_100087406 Ga0070660_1000874063 160
111 3300005366 Ga0070659_100000265 Ga0070659_10000026527 160
112 3300005434 Ga0070709_10040775 Ga0070709_100407752 160
113 3300005435 Ga0070714_100272275 Ga0070714_1002722752 160
114 3300005436 Ga0070713_100044197 Ga0070713_1000441972 160
115 3300005436 Ga0070713_100090201 Ga0070713_1000902012 160
116 3300005437 Ga0070710_10020567 Ga0070710_100205672 160
117 3300005458 Ga0070681_10112339 Ga0070681_101123391 160
118 3300005530 Ga0070679_100101917 Ga0070679_1001019174 160
119 3300005548 Ga0070665_100000194 Ga0070665_100000194112 160
120 3300005614 Ga0068856_100117352 Ga0068856_1001173524 160
121 3300005614 Ga0068856_100804066 Ga0068856_1008040661 160
122 3300005616 Ga0068852_100217391 Ga0068852_1002173912 160
123 3300005616 Ga0068852_100804342 Ga0068852_1008043422 160
124 3300005843 Ga0068860_101187544 Ga0068860_1011875442 160
125 3300005983 Ga0081540_1013009 Ga0081540_10130094 160
126 3300006028 Ga0070717_10472445 Ga0070717_104724452 160
127 3300006163 Ga0070715_10169927 Ga0070715_101699272 160
128 3300006175 Ga0070712_100001851 Ga0070712_10000185113 160
129 3300006175 Ga0070712_100788089 Ga0070712_1007880892 160
130 3300007265 Ga0099794_10029307 Ga0099794_100293073 160
131 3300009093 Ga0105240_10062085 Ga0105240_100620853 160
132 3300009093 Ga0105240_11001202 Ga0105240_110012021 160
133 3300009098 Ga0105245_10078369 Ga0105245_100783694 160
134 3300009176 Ga0105242_10350915 Ga0105242_103509153 160
135 3300009177 Ga0105248_10128651 Ga0105248_101286513 160
136 3300009545 Ga0105237_10304497 Ga0105237_103044973 160
137 3300009551 Ga0105238_10770216 Ga0105238_107702162 160
138 3300009553 Ga0105249_10919435 Ga0105249_109194351 160
139 3300010375 Ga0105239_10093197 Ga0105239_100931973 160
140 3300010375 Ga0105239_10097300 Ga0105239_100973004 160
141 3300013104 Ga0157370_10093479 Ga0157370_100934793 160
142 3300013105 Ga0157369_10047014 Ga0157369_100470143 160
143 3300013307 Ga0157372_10030328 Ga0157372_100303282 160
144 3300014969 Ga0157376_10019861 Ga0157376_100198615 160
145 3300021384 Ga0213876_10210716 Ga0213876_102107162 160
146 3300021384 Ga0213876_10316488 Ga0213876_103164882 160
147 3300021388 Ga0213875_10048781 Ga0213875_100487813 160
148 3300021388 Ga0213875_10082851 Ga0213875_100828512 160
149 3300025905 Ga0207685_10103435 Ga0207685_101034352 160
150 3300025912 Ga0207707_10246429 Ga0207707_102464292 160
151 3300025913 Ga0207695_10172568 Ga0207695_101725683 160
152 3300025915 Ga0207693_10023488 Ga0207693_100234884 160
153 3300025919 Ga0207657_10074636 Ga0207657_100746363 160
154 3300025919 Ga0207657_10175286 Ga0207657_101752863 160
155 3300025921 Ga0207652_10406889 Ga0207652_104068892 160
156 3300025924 Ga0207694_10059415 Ga0207694_100594153 160
157 3300025927 Ga0207687_10051272 Ga0207687_100512724 160
158 3300025928 Ga0207700_10007750 Ga0207700_100077508 160
159 3300025929 Ga0207664_10208441 Ga0207664_102084412 160
160 3300025932 Ga0207690_10002297 Ga0207690_100022975 160
161 3300025934 Ga0207686_10273648 Ga0207686_102736482 160
162 3300025937 Ga0207669_10429647 Ga0207669_104296472 160
163 3300025941 Ga0207711_10140351 Ga0207711_101403512 160
164 3300026041 Ga0207639_10351873 Ga0207639_103518732 160
165 3300026067 Ga0207678_10684377 Ga0207678_106843772 160
166 3300026078 Ga0207702_10194565 Ga0207702_101945652 160
167 3300026142 Ga0207698_11091394 Ga0207698_110913942 160
168 3300027671 Ga0209588_1043429 Ga0209588_10434293 160
169 3300028379 Ga0268266_10000189 Ga0268266_10000189103 160
170 3300028573 Ga0265334_10006177 Ga0265334_100061773 160
171 3300032004 Ga0307414_11137943 Ga0307414_111379431 160
172 3300035083 Ga0373926_0072291 Ga0373926_0072291_393_875 160
173 3300035089 Ga0373944_0012102 Ga0373944_0012102_209_691 160
174 3300035116 Ga0373945_0059718 Ga0373945_0059718_19_501 160
175 3300035170 Ga0373943_0011282 Ga0373943_0011282_986_1468 160
176 3300035171 Ga0373946_0017932 Ga0373946_0017932_1250_1732 160
177 3300035410 Ga0373924_0373979 Ga0373924_0373979_71_553 160
178 3300035692 Ga0373935_0179949 Ga0373935_0179949_403_885 160
179 3300035695 Ga0373927_0176364 Ga0373927_0176364_641_1123 160
180 3300035695 Ga0373927_0531507 Ga0373927_0531507_64_552 160
181 3300035695 Ga0373927_0900540 Ga0373927_0900540_33_518 160
182 3300035724 Ga0373933_0146326 Ga0373933_0146326_532_1017 160
183 3300035725 Ga0373947_0232156 Ga0373947_0232156_615_1097 160
184 3300036401 Ga0373937_0041069 Ga0373937_0041069_2275_2760 160
185 3300037068 Ga0373925_0157957 Ga0373925_0157957_468_950 160
186 3300037312 Ga0395899_0304141 Ga0395899_0304141_167_661 160
187 3300037466 Ga0395898_0043808 Ga0395898_0043808_808_1302 160
188 3300037853 Ga0436364_0236951 Ga0436364_0236951_971_1459 160
189 3300037853 Ga0436364_0702641 Ga0436364_0702641_92_604 160
190 3300037853 Ga0436364_1098564 Ga0436364_1098564_1313_1864 160
191 3300037853 Ga0436364_1510486 Ga0436364_1510486_917_1405 160
192 3300038443 Ga0395901_0092459 Ga0395901_0092459_226_720 160
193 3300039437 Ga0436365_0142883 Ga0436365_0142883_20_514 160
194 3300039437 Ga0436365_0551447 Ga0436365_0551447_462_956 160
195 3300039437 Ga0436365_0678146 Ga0436365_0678146_69_557 160
196 3300039438 Ga0436360_0781120 Ga0436360_0781120_645_1157 160
197 3300039447 Ga0436361_0184877 Ga0436361_0184877_1176_1664 160
198 3300039447 Ga0436361_1027560 Ga0436361_1027560_1275_1766 160
199 3300042531 Ga0450918_067543 Ga0450918_067543_126_629 160
200 3300044901 Ga0466960_0378667 Ga0466960_0378667_132_620 160
201 3300045051 Ga0451576_0035288 Ga0451576_0035288_521_1003 160
202 3300046455 Ga0495603_0039956 Ga0495603_0039956_530_1012 160
203 3300046461 Ga0495641_0161418 Ga0495641_0161418_445_927 160
204 3300046462 Ga0495651_0321305 Ga0495651_0321305_403_888 160
205 3300046472 Ga0495580_0928857 Ga0495580_0928857_12_494 160
206 3300046474 Ga0495605_0023104 Ga0495605_0023104_2704_3186 160
207 3300046477 Ga0495664_0004945 Ga0495664_0004945_5887_6372 160
208 3300046499 Ga0495594_0155583 Ga0495594_0155583_161_643 160
209 3300046506 Ga0495583_0002178 Ga0495583_0002178_11648_12130 160
210 3300046511 Ga0495608_0056257 Ga0495608_0056257_1970_2455 160
211 3300046513 Ga0495616_0020611 Ga0495616_0020611_1615_2097 160
212 3300046515 Ga0495620_0009168 Ga0495620_0009168_1971_2453 160
213 3300046522 Ga0495643_0007708 Ga0495643_0007708_2699_3181 160
214 3300046526 Ga0495666_0139406 Ga0495666_0139406_314_796 160
215 3300046533 Ga0495640_0176524 Ga0495640_0176524_497_982 160
216 3300046533 Ga0495640_0248428 Ga0495640_0248428_404_892 160
217 3300046536 Ga0495587_0031943 Ga0495587_0031943_2537_3022 160
218 3300046538 Ga0495609_0261012 Ga0495609_0261012_134_616 160
219 3300046543 Ga0495645_0003069 Ga0495645_0003069_1920_2405 160
220 3300046559 Ga0495667_0003226 Ga0495667_0003226_9977_10462 160
221 3300046660 Ga0495625_0007739 Ga0495625_0007739_6122_6604 160
222 3300046663 Ga0495635_0016007 Ga0495635_0016007_174_659 160
223 3300046674 Ga0495588_0040072 Ga0495588_0040072_210_692 160
224 3300046678 Ga0495599_0010611 Ga0495599_0010611_936_1421 160
225 3300046679 Ga0495623_0386000 Ga0495623_0386000_90_575 160
226 3300046680 Ga0495646_0046091 Ga0495646_0046091_174_659 160
227 3300046681 Ga0495647_0108392 Ga0495647_0108392_144_626 160
228 3300046689 Ga0495613_0569606 Ga0495613_0569606_74_556 160
229 3300046690 Ga0495624_0169188 Ga0495624_0169188_815_1297 160
230 3300046692 Ga0495671_0276796 Ga0495671_0276796_246_731 160
231 3300046694 Ga0495649_0008500 Ga0495649_0008500_1039_1521 160
232 3300046809 Ga0495600_0113929 Ga0495600_0113929_948_1433 160
233 3300046810 Ga0495660_0032814 Ga0495660_0032814_1071_1553 160
234 3300047317 Ga0495604_0029446 Ga0495604_0029446_1358_1843 160
235 3300047319 Ga0495674_0076712 Ga0495674_0076712_931_1416 160
236 3300047321 Ga0495676_0096849 Ga0495676_0096849_1108_1590 160
237 3300047323 Ga0495683_0007031 Ga0495683_0007031_2571_3053 160
238 3300047443 Ga0495687_191657 Ga0495687_191657_63_545 160
239 3300047444 Ga0495675_0062743 Ga0495675_0062743_1644_2129 160
240 3300047471 Ga0495684_0031580 Ga0495684_0031580_2508_2993 160
241 3300048088 Ga0495602_0010640 Ga0495602_0010640_5669_6154 160
242 3300048904 Ga0496101_0268239 Ga0496101_0268239_127_609 160
243 3300048907 Ga0496104_0123096 Ga0496104_0123096_1186_1668 160
244 3300048909 Ga0496106_0015463 Ga0496106_0015463_867_1349 160
245 3300048910 Ga0496107_0018398 Ga0496107_0018398_654_1136 160
246 3300048911 Ga0496108_0016265 Ga0496108_0016265_1263_1745 160
247 3300048912 Ga0496109_0007122 Ga0496109_0007122_8165_8647 160
248 3300048913 Ga0496110_0054519 Ga0496110_0054519_2012_2494 160
249 3300048915 Ga0496112_0050310 Ga0496112_0050310_1922_2404 160
250 3300048916 Ga0496113_0054818 Ga0496113_0054818_1455_1937 160
251 3300048918 Ga0496115_0022802 Ga0496115_0022802_525_1013 160
252 3300048918 Ga0496115_0382582 Ga0496115_0382582_134_616 160
253 3300048922 Ga0496119_0019174 Ga0496119_0019174_2635_3117 160
254 3300048925 Ga0496122_0003377 Ga0496122_0003377_975_1457 160
255 3300048926 Ga0496123_0002796 Ga0496123_0002796_1246_1728 160
256 3300049459 Ga0495678_065753 Ga0495678_065753_624_1106 160
257 3300049460 Ga0495682_0178860 Ga0495682_0178860_35_517 160
258 3300049576 Ga0501040_0359837 Ga0501040_0359837_356_838 160
259 3300049582 Ga0501048_0465521 Ga0501048_0465521_189_671 160
260 3300049588 Ga0501072_0493426 Ga0501072_0493426_15_497 160
261 3300049592 Ga0501076_0140505 Ga0501076_0140505_413_895 160
262 3300050514 nmdc:mga08x19_421558_c1 nmdc:mga08x19_421558_c1_428_910 160
263 3300053077 Ga0495601_0033007 Ga0495601_0033007_1917_2402 160
264 3300053077 Ga0495601_0484235 Ga0495601_0484235_52_537 160
265 3300053078 Ga0495612_0000237 Ga0495612_0000237_1914_2399 160
266 3300053085 Ga0495619_0032978 Ga0495619_0032978_218_703 160
267 3300053131 Ga0500652_076626 Ga0500652_076626_589_1071 160
268 3300053153 Ga0500616_0086066 Ga0500616_0086066_344_829 160
269 3300053730 Ga0500645_003048 Ga0500645_003048_6453_6935 160
270 3300060353 Ga0501082_0867106 Ga0501082_0867106_279_761 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

2

144

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.8522 9 156
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.8519 9 156
8gug-assembly1.cif.gz_A-2 structure of vpa0770 toxin bound to vpa0769 antitoxin in vibrio parahaemolyticus 0.8232 10 159
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.8074 10 156
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.7926 9 156
ID Description Score Start End Superfamily
af_Q4D025_99_360_3.30.559.70 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Choline/Carnitine o-acyltransferase, domain 2 0.5596 113 136 3.30.559.70
af_I1NC89_205_414_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.5441 117 137 3.30.559.10
af_G5EDY1_47_246_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5399 6 86 3.90.228.10
af_P53304_1_167_3.30.559.30 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Nonribosomal peptide synthetase, condensation domain 0.5148 115 139 3.30.559.30
af_I1MSN6_221_451_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.4947 117 140 3.30.559.10
ID Description Score Start End GO Terms
AF-W1L0P7-F1-model_v4 deleted 0.9753 44 157
AF-A0A439R787-F1-model_v4 RES domain-containing protein 0.9661 48 160
AF-A0A442PZ74-F1-model_v4 deleted 0.9657 41 160
AF-A0A439R787-F1-model_v4 RES domain-containing protein 0.9579 48 160
AF-A0A1I4F418-F1-model_v4 RES domain-containing protein 0.9569 62 160

Feature Viewer

pLDDT pTM Quality
88.31 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map