F376575

General Info

Members Datasets Scaffolds Average Seq Length
269 194 231 248

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581304|2585257867
Length 276
Sequence FCDVVRPAVAVYIWEVSKQRKSKPMKTVLITGCSSGFGLETARYFLERDWNVVATMRRPRPDVLPQSDRLRMIALDVTDADSIRNAVELAGPIDVLVNNAGIGWLNALEGTPMDTVRDLFETNTIGTMAMTQAVLPQFRARREGVIVNVTSTVTLKPLHLLSAYTASKAAVNAFTEVLALELAPFNIRARLVLPGRAPDTRFGENAQSRMREAASGFPEPYAELVQSIFAQWAEQPADQITRAVDVAEAIWRSATDPSCPMRLPAGTDAVALAAQV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
7 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
8 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
9 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
10 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
13 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
14 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
15 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
16 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
17 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
18 2818991457 Xanthomonas translucens 569 Isolate Unclassified
19 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
20 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
21 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
22 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
23 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
24 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
25 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
26 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
27 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
28 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
29 2904424332 Duganella sp. 1411 Isolate Rhizosphere
30 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
31 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
32 2919085039 Luteibacter sp. 1214 Isolate Unclassified
33 2919404418 Luteibacter sp. 3190 Isolate Unclassified
34 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
35 2928163908 Burkholderia sp. 567 Isolate Unclassified
36 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
37 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
183 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
184 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
192 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
193 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
194 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.5
Metatranscriptomes 0.37
Isolates 14.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.47
Nodule 2.23
Rhizoplane 7.43
Rhizosphere 45.35
Stem 0
Stem Tuber 0
Unclassified 27.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2661064 2162886007 Bacteria 9256
2 JGI25162J39368_1000328 3300002737 Bacteria 41728
3 JGI25151J46595_10024808 3300003187 Bacteria 2448
4 JGI25165J46597_1000543 3300003214 Bacteria 34671
5 rootH2_10056573 3300003320 Bacteria 2344
6 rootH1_10023100 3300003323 Bacteria 3285
7 JGI25160J50197_1000037 3300003354 Bacteria 162757
8 Ga0006562J51391_1064121 3300003578 Bacteria 1346
9 Ga0055533_1001040 3300003756 Bacteria 8028
10 Ga0055532_1000231 3300003758 Bacteria 41528
11 Ga0055527_1000188 3300003760 Bacteria 41528
12 Ga0055535_1000592 3300003761 Bacteria 29980
13 Ga0055542_1004297 3300003762 Bacteria 3507
14 Ga0055529_1004065 3300003763 Bacteria 2285
15 Ga0058692_1000028 3300003856 Bacteria 193757
16 Ga0065165_1000668 3300005262 Bacteria 49417
17 Ga0065704_10070292 3300005289 Bacteria 38337
18 Ga0070658_10066074 3300005327 Bacteria 2954
19 Ga0070683_100469064 3300005329 Bacteria 1202
20 Ga0070670_100001975 3300005331 Bacteria 16781
21 Ga0070660_100000361 3300005339 Bacteria 30309
22 Ga0070659_100000078 3300005366 Bacteria 74646
23 Ga0070663_100001118 3300005455 Bacteria 14751
24 Ga0070663_100244130 3300005455 Bacteria 1419
25 Ga0068855_100154659 3300005563 Bacteria 2606
26 Ga0068857_100053009 3300005577 Bacteria 3599
27 Ga0068852_100049181 3300005616 Bacteria 3606
28 Ga0068858_100844277 3300005842 Bacteria 894
29 Ga0075364_10012226 3300006051 Bacteria 5244
30 Ga0075366_10247888 3300006195 Bacteria 1086
31 Ga0105251_10000075 3300009011 Bacteria 94904
32 Ga0105251_10024598 3300009011 Bacteria 3090
33 Ga0105250_10041042 3300009092 Bacteria 1855
34 Ga0105240_10006962 3300009093 Bacteria 16517
35 Ga0105240_10007101 3300009093 Bacteria 16325
36 Ga0105237_10027009 3300009545 Bacteria 5862
37 Ga0105237_10062702 3300009545 Bacteria 3717
38 Ga0105238_10039043 3300009551 Bacteria 4817
39 Ga0105238_10185516 3300009551 Bacteria 2056
40 Ga0105239_10044770 3300010375 Bacteria 4850
41 Ga0157370_10034099 3300013104 Bacteria 4959
42 Ga0157370_10417080 3300013104 Bacteria 1235
43 Ga0157372_10154438 3300013307 Bacteria 2650
44 Ga0182006_1000522 3300015261 Bacteria 29222
45 Ga0182006_1054838 3300015261 Bacteria 1523
46 Ga0182005_1000004 3300015265 Bacteria 609645
47 Ga0182005_1001161 3300015265 Bacteria 10905
48 Ga0182005_1008657 3300015265 Bacteria 2989
49 Ga0163161_10186154 3300017792 Bacteria 1594
50 Ga0209760_103056 3300025207 Bacteria 1509
51 Ga0209674_100155 3300025226 Bacteria 91885
52 Ga0209674_106127 3300025226 Bacteria 1678
53 Ga0209672_100020 3300025228 Bacteria 429003
54 Ga0209147_100024 3300025229 Bacteria 429003
55 Ga0207427_107248 3300025231 Bacteria 1316
56 Ga0209437_100051 3300025233 Bacteria 392523
57 Ga0209258_100121 3300025242 Bacteria 180843
58 Ga0209148_1000458 3300025254 Bacteria 44146
59 Ga0209148_1001123 3300025254 Bacteria 15827
60 Ga0209759_1000138 3300025256 Bacteria 125136
61 Ga0209233_1000069 3300025261 Bacteria 367639
62 Ga0209233_1011612 3300025261 Bacteria 2591
63 Ga0209455_1000263 3300025272 Bacteria 60487
64 Ga0209025_1000079 3300025294 Bacteria 270973
65 Ga0209758_1053433 3300025297 Bacteria 1388
66 Ga0207426_1000004 3300025302 Bacteria 1047900
67 Ga0209051_1004251 3300025303 Bacteria 8920
68 Ga0207713_1004521 3300025735 Bacteria 9009
69 Ga0207695_10000328 3300025913 Bacteria 113378
70 Ga0207695_10103454 3300025913 Bacteria 2839
71 Ga0207671_10030100 3300025914 Bacteria 4049
72 Ga0207671_10095979 3300025914 Bacteria 2239
73 Ga0207657_10000035 3300025919 Bacteria 125384
74 Ga0207694_10022992 3300025924 Bacteria 4731
75 Ga0207650_10026629 3300025925 Bacteria 4127
76 Ga0207690_10000007 3300025932 Bacteria 388533
77 Ga0207706_10269951 3300025933 Bacteria 1484
78 Ga0207709_10001926 3300025935 Bacteria 13633
79 Ga0207709_10489737 3300025935 Bacteria 957
80 Ga0207679_10433408 3300025945 Bacteria 1162
81 Ga0207667_10043062 3300025949 Bacteria 4793
82 Ga0207703_10694899 3300026035 Bacteria 967
83 Ga0207678_10000064 3300026067 Bacteria 83470
84 Ga0207678_10368033 3300026067 Bacteria 1241
85 Ga0207702_10149283 3300026078 Bacteria 2125
86 Ga0207698_10041860 3300026142 Bacteria 3418
87 Ga0209371_1000025 3300027312 Bacteria 450640
88 Ga0209371_1001418 3300027312 Bacteria 16379
89 Ga0209371_1001443 3300027312 Bacteria 16146
90 Ga0307517_10022636 3300028786 Bacteria 7864
91 Ga0307517_10123911 3300028786 Bacteria 1896
92 Ga0268256_1000027 3300030500 Bacteria 450640
93 Ga0268256_1002229 3300030500 Bacteria 10188
94 Ga0268256_1011377 3300030500 Bacteria 2817
95 Ga0307513_10071917 3300031456 Bacteria 3607
96 Ga0307408_100054357 3300031548 Bacteria 2895
97 Ga0307516_10010267 3300031730 Bacteria 10312
98 Ga0307405_10235258 3300031731 Bacteria 1353
99 Ga0307406_10016788 3300031901 Bacteria 4259
100 Ga0307412_10009087 3300031911 Bacteria 5695
101 Ga0307414_10212105 3300032004 Bacteria 1583
102 Ga0307414_10422781 3300032004 Bacteria 1162
103 Ga0307510_10000181 3300033180 Bacteria 54100
104 Ga0307510_10030169 3300033180 Bacteria 6152
105 Ga0307510_10205090 3300033180 Bacteria 1500
106 Ga0373960_0020303 3300035121 Bacteria 1755
107 Ga0373931_0054105 3300035691 Bacteria 2144
108 Ga0395905_0218452 3300037471 Bacteria 1784
109 Ga0395901_0917519 3300038443 Bacteria 857
110 Ga0436361_0690733 3300039447 Bacteria 1043
111 Ga0439436_0000009 3300041404 Bacteria 108375
112 Ga0439461_0005981 3300041410 Bacteria 2103
113 Ga0439466_0023087 3300041411 Bacteria 2190
114 Ga0439465_0001193 3300041413 Bacteria 8357
115 Ga0439465_0002056 3300041413 Bacteria 6599
116 Ga0451787_100051 3300041441 Bacteria 848
117 Ga0451793_1920026 3300041452 Bacteria 2866
118 Ga0451800_1458579 3300041459 Bacteria 2216
119 Ga0451802_1146121 3300041460 Bacteria 1487
120 Ga0451807_1506508 3300041486 Bacteria 1995
121 Ga0451853_0182881 3300041512 Bacteria 2103
122 Ga0439445_0007928 3300042004 Bacteria 2476
123 Ga0466982_0000045 3300044672 Bacteria 38024
124 Ga0466961_0144497 3300044693 Bacteria 1488
125 Ga0466957_0136051 3300044842 Bacteria 1579
126 Ga0466958_0000830 3300045836 Bacteria 13658
127 Ga0495638_0000346 3300046460 Bacteria 58330
128 Ga0495638_0134234 3300046460 Bacteria 1451
129 Ga0495650_0000399 3300046471 Bacteria 72364
130 Ga0495650_0001592 3300046471 Bacteria 21240
131 Ga0495650_0003026 3300046471 Bacteria 12688
132 Ga0495650_0008191 3300046471 Bacteria 6143
133 Ga0495650_0015083 3300046471 Bacteria 3982
134 Ga0495650_0026434 3300046471 Bacteria 2700
135 Ga0495582_0004182 3300046473 Bacteria 8115
136 Ga0495607_0008989 3300046501 Bacteria 6797
137 Ga0495607_0041974 3300046501 Bacteria 2714
138 Ga0495583_0018984 3300046506 Bacteria 3601
139 Ga0495606_0005337 3300046507 Bacteria 12355
140 Ga0495610_0000024 3300046512 Bacteria 304748
141 Ga0495610_0001774 3300046512 Bacteria 18868
142 Ga0495620_0025584 3300046515 Bacteria 2790
143 Ga0495628_0008629 3300046516 Bacteria 8732
144 Ga0495668_0001184 3300046616 Bacteria 26516
145 Ga0495611_0137182 3300046648 Bacteria 1142
146 Ga0495625_0001608 3300046660 Bacteria 26653
147 Ga0495661_0026579 3300046665 Bacteria 3727
148 Ga0495657_0007089 3300046675 Bacteria 8694
149 Ga0495624_0004602 3300046690 Bacteria 10062
150 Ga0495649_0040212 3300046694 Bacteria 2562
151 Ga0495660_0006156 3300046810 Bacteria 7121
152 Ga0495660_0037220 3300046810 Bacteria 2711
153 Ga0495660_0049872 3300046810 Bacteria 2283
154 Ga0495672_0000036 3300047320 Bacteria 279648
155 Ga0495679_023446 3300047446 Bacteria 2093
156 Ga0495679_055592 3300047446 Bacteria 1175
157 Ga0495686_0011019 3300047472 Bacteria 6394
158 Ga0495686_0128596 3300047472 Bacteria 1504
159 Ga0496100_0000070 3300048903 Bacteria 56600
160 Ga0496101_0000044 3300048904 Bacteria 161295
161 Ga0496101_0138500 3300048904 Bacteria 1853
162 Ga0496102_0000715 3300048905 Bacteria 32824
163 Ga0496103_0000213 3300048906 Bacteria 58012
164 Ga0496104_0030385 3300048907 Bacteria 5020
165 Ga0496104_0086835 3300048907 Bacteria 2987
166 Ga0496105_0051870 3300048908 Bacteria 3387
167 Ga0496105_0198400 3300048908 Bacteria 1638
168 Ga0496112_0348521 3300048915 Bacteria 1423
169 Ga0496114_0131561 3300048917 Bacteria 2161
170 Ga0496116_0000216 3300048919 Bacteria 108542
171 Ga0496117_0000098 3300048920 Bacteria 196331
172 Ga0496117_0005443 3300048920 Bacteria 13371
173 Ga0496117_0007740 3300048920 Bacteria 10382
174 Ga0496117_0015510 3300048920 Bacteria 6490
175 Ga0496117_0017153 3300048920 Bacteria 6060
176 Ga0496118_0000608 3300048921 Bacteria 58952
177 Ga0496118_0000625 3300048921 Bacteria 58119
178 Ga0496118_0002026 3300048921 Bacteria 28649
179 Ga0496118_0002119 3300048921 Bacteria 27797
180 Ga0496118_0010724 3300048921 Bacteria 9034
181 Ga0496119_0002070 3300048922 Bacteria 22680
182 Ga0496119_0004204 3300048922 Bacteria 14460
183 Ga0496119_0146713 3300048922 Bacteria 1268
184 Ga0496120_0002568 3300048923 Bacteria 18100
185 Ga0496120_0003369 3300048923 Bacteria 14648
186 Ga0496121_0000246 3300048924 Bacteria 114919
187 Ga0496121_0000644 3300048924 Bacteria 65162
188 Ga0496121_0018059 3300048924 Bacteria 7142
189 Ga0496121_0038538 3300048924 Bacteria 4228
190 Ga0496121_0221258 3300048924 Bacteria 1333
191 Ga0496122_0001796 3300048925 Bacteria 32863
192 Ga0496122_0003728 3300048925 Bacteria 19672
193 Ga0496122_0015531 3300048925 Bacteria 7271
194 Ga0496122_0033399 3300048925 Bacteria 4233
195 Ga0496122_0188789 3300048925 Bacteria 1219
196 Ga0496122_0294265 3300048925 Bacteria 879
197 Ga0496123_0002974 3300048926 Bacteria 19685
198 Ga0496123_0005440 3300048926 Bacteria 12823
199 Ga0496123_0021311 3300048926 Bacteria 5041
200 Ga0496123_0032903 3300048926 Bacteria 3742
201 Ga0496123_0080838 3300048926 Bacteria 1978
202 Ga0496123_0085292 3300048926 Bacteria 1900
203 Ga0496123_0091764 3300048926 Bacteria 1800
204 Ga0496123_0169778 3300048926 Bacteria 1152
205 Ga0496123_0346287 3300048926 Bacteria 693
206 Ga0496124_0000023 3300048927 Bacteria 415226
207 Ga0496124_0004196 3300048927 Bacteria 16963
208 Ga0496124_0078024 3300048927 Bacteria 2730
209 Ga0496124_0106006 3300048927 Bacteria 2270
210 Ga0496125_0071638 3300048928 Bacteria 2706
211 Ga0496126_0007073 3300048929 Bacteria 12359
212 Ga0496126_0103660 3300048929 Bacteria 2486
213 Ga0496126_0338366 3300048929 Bacteria 1233
214 Ga0495678_000770 3300049459 Bacteria 28951
215 nmdc:mga00v17_36778_c1 3300050491 Bacteria 2920
216 nmdc:mga0k408_80510_c1 3300050493 Bacteria 1907
217 nmdc:mga07m45_89187_c1 3300050496 Bacteria 1766
218 Ga0500635_0111958 3300053080 Bacteria 1015
219 Ga0500572_117946 3300053111 Bacteria 858
220 Ga0500594_0005854 3300053118 Bacteria 2737
221 Ga0500607_013384 3300053121 Bacteria 4789
222 Ga0500618_014166 3300053125 Bacteria 2043
223 Ga0500642_0014673 3300053130 Bacteria 2922
224 Ga0500658_0001403 3300053134 Bacteria 9716
225 Ga0500559_0000038 3300053136 Bacteria 109922
226 Ga0500559_0018600 3300053136 Bacteria 2935
227 Ga0500564_083698 3300053138 Bacteria 1427
228 Ga0500622_0001043 3300053156 Bacteria 23134
229 Ga0500622_0076912 3300053156 Bacteria 1677
230 Ga0500636_0001531 3300053177 Bacteria 12586
231 Ga0500661_008439 3300055283 Bacteria 1896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0346287 Ga0496123_0346287_13_636 206
2 3300041441 Ga0451787_100051 Ga0451787_100051_13_669 218
3 3300041460 Ga0451802_1146121 Ga0451802_1146121_815_1471 218
4 3300048920 Ga0496117_0017153 Ga0496117_0017153_5392_6048 218
5 3300025935 Ga0207709_10489737 Ga0207709_104897371 222
6 3300046507 Ga0495606_0005337 Ga0495606_0005337_5100_5858 228
7 3300041410 Ga0439461_0005981 Ga0439461_0005981_201_944 232
8 3300048917 Ga0496114_0131561 Ga0496114_0131561_148_903 232
9 3300017792 Ga0163161_10186154 Ga0163161_101861542 233
10 3300048925 Ga0496122_0033399 Ga0496122_0033399_1865_2617 233
11 3300048926 Ga0496123_0080838 Ga0496123_0080838_284_1036 233
12 3300006051 Ga0075364_10012226 Ga0075364_100122263 240
13 3300050491 nmdc:mga00v17_36778_c1 nmdc:mga00v17_36778_c1_2150_2899 240
14 iso_pu_bacteria 2511231003 2511248133 240
15 iso_pu_bacteria 2808606418 2809147119 241
16 iso_pu_bacteria 2854896431 2854902202 242
17 3300009093 Ga0105240_10007101 Ga0105240_100071018 243
18 iso_pu_bacteria 2593339238 2595446269 243
19 iso_pu_bacteria 2786546517 2787436737 243
20 iso_pu_bacteria 2842918807 2842921986 243
21 iso_pu_bacteria 2852653556 2852653737 243
22 iso_pu_bacteria 2919085039 2919085301 243
23 iso_pu_bacteria 2919404418 2919407983 243
24 iso_pu_bacteria 8046767195 8046773045 243
25 iso_pu_bacteria 2508501114 2509076479 244
26 iso_pu_bacteria 2515154123 2515687178 244
27 iso_pu_bacteria 2526164713 2527075843 244
28 iso_pu_bacteria 2818991440 2819562737 244
29 iso_pu_bacteria 2885270888 2885271747 244
30 iso_pu_bacteria 2902405164 2902409033 244
31 iso_pu_bacteria 2904424332 2904424859 244
32 iso_pu_bacteria 2904463128 2904463347 244
33 3300045836 Ga0466958_0000830 Ga0466958_0000830_8376_9113 245
34 3300046471 Ga0495650_0015083 Ga0495650_0015083_1421_2158 245
35 3300048921 Ga0496118_0000608 Ga0496118_0000608_11703_12443 245
36 3300048924 Ga0496121_0000246 Ga0496121_0000246_27855_28595 245
37 3300048925 Ga0496122_0294265 Ga0496122_0294265_95_835 245
38 iso_pu_bacteria 2523231067 2523469634 245
39 iso_pu_bacteria 2585427608 2585901130 245
40 iso_pu_bacteria 2588253510 2588294768 245
41 iso_pu_bacteria 2599185240 2599747352 245
42 iso_pu_bacteria 2599185355 2600209023 245
43 iso_pu_bacteria 2675903129 2676745051 245
44 iso_pu_bacteria 2738543031 2739351603 245
45 iso_pu_bacteria 2818991457 2819661469 245
46 iso_pu_bacteria 2842324504 2842325415 245
47 iso_pu_bacteria 2842348783 2842349694 245
48 iso_pu_bacteria 2842454564 2842455070 245
49 iso_pu_bacteria 2852684882 2852687336 245
50 iso_pu_bacteria 2870068957 2870073451 245
51 iso_pu_bacteria 2928157003 2928158447 245
52 iso_pu_bacteria 2928163908 2928167338 245
53 iso_pu_bacteria 2981990288 2981991915 245
54 iso_pu_bacteria 8020945358 8020953195 245
55 3300025297 Ga0209758_1053433 Ga0209758_10534333 246
56 3300037471 Ga0395905_0218452 Ga0395905_0218452_498_1241 246
57 3300046616 Ga0495668_0001184 Ga0495668_0001184_15790_16530 246
58 3300048926 Ga0496123_0169778 Ga0496123_0169778_101_841 246
59 iso_pu_bacteria 2904541872 2904541946 246
60 iso_pu_bacteria 2929160207 2929167235 246
61 3300003578 Ga0006562J51391_1064121 Ga0006562J51391_10641212 247
62 3300009545 Ga0105237_10062702 Ga0105237_100627024 247
63 3300013104 Ga0157370_10034099 Ga0157370_100340992 247
64 3300015261 Ga0182006_1000522 Ga0182006_100052222 247
65 3300015265 Ga0182005_1000004 Ga0182005_1000004306 247
66 3300025226 Ga0209674_106127 Ga0209674_1061272 247
67 3300025231 Ga0207427_107248 Ga0207427_1072482 247
68 3300025254 Ga0209148_1001123 Ga0209148_10011233 247
69 3300025303 Ga0209051_1004251 Ga0209051_10042516 247
70 3300025914 Ga0207671_10095979 Ga0207671_100959792 247
71 3300027312 Ga0209371_1001418 Ga0209371_100141812 247
72 3300027312 Ga0209371_1001443 Ga0209371_10014432 247
73 3300028786 Ga0307517_10123911 Ga0307517_101239111 247
74 3300030500 Ga0268256_1002229 Ga0268256_10022296 247
75 3300030500 Ga0268256_1011377 Ga0268256_10113774 247
76 3300031731 Ga0307405_10235258 Ga0307405_102352581 247
77 3300031911 Ga0307412_10009087 Ga0307412_100090874 247
78 3300033180 Ga0307510_10000181 Ga0307510_1000018140 247
79 3300035121 Ga0373960_0020303 Ga0373960_0020303_363_1112 247
80 3300035691 Ga0373931_0054105 Ga0373931_0054105_33_782 247
81 3300038443 Ga0395901_0917519 Ga0395901_0917519_43_786 247
82 3300039447 Ga0436361_0690733 Ga0436361_0690733_74_817 247
83 3300041404 Ga0439436_0000009 Ga0439436_0000009_73270_74013 247
84 3300041411 Ga0439466_0023087 Ga0439466_0023087_209_952 247
85 3300041413 Ga0439465_0001193 Ga0439465_0001193_6910_7653 247
86 3300041413 Ga0439465_0002056 Ga0439465_0002056_4212_4955 247
87 3300042004 Ga0439445_0007928 Ga0439445_0007928_1128_1871 247
88 3300046460 Ga0495638_0000346 Ga0495638_0000346_40043_40786 247
89 3300046471 Ga0495650_0001592 Ga0495650_0001592_14462_15205 247
90 3300046501 Ga0495607_0041974 Ga0495607_0041974_53_796 247
91 3300046512 Ga0495610_0000024 Ga0495610_0000024_247305_248048 247
92 3300046512 Ga0495610_0001774 Ga0495610_0001774_16250_16993 247
93 3300046660 Ga0495625_0001608 Ga0495625_0001608_10680_11423 247
94 3300046690 Ga0495624_0004602 Ga0495624_0004602_9133_9876 247
95 3300046694 Ga0495649_0040212 Ga0495649_0040212_1355_2098 247
96 3300046810 Ga0495660_0037220 Ga0495660_0037220_1258_2001 247
97 3300046810 Ga0495660_0049872 Ga0495660_0049872_1036_1779 247
98 3300047320 Ga0495672_0000036 Ga0495672_0000036_208614_209357 247
99 3300047472 Ga0495686_0011019 Ga0495686_0011019_4320_5063 247
100 3300048924 Ga0496121_0018059 Ga0496121_0018059_5298_6041 247
101 3300048927 Ga0496124_0106006 Ga0496124_0106006_660_1421 247
102 3300053134 Ga0500658_0001403 Ga0500658_0001403_6532_7275 247
103 3300002737 JGI25162J39368_1000328 JGI25162J39368_100032830 248
104 3300003214 JGI25165J46597_1000543 JGI25165J46597_100054316 248
105 3300003354 JGI25160J50197_1000037 JGI25160J50197_1000037107 248
106 3300003756 Ga0055533_1001040 Ga0055533_10010403 248
107 3300005262 Ga0065165_1000668 Ga0065165_10006689 248
108 3300005455 Ga0070663_100244130 Ga0070663_1002441301 248
109 3300005577 Ga0068857_100053009 Ga0068857_1000530092 248
110 3300025207 Ga0209760_103056 Ga0209760_1030561 248
111 3300025226 Ga0209674_100155 Ga0209674_10015524 248
112 3300025233 Ga0209437_100051 Ga0209437_100051370 248
113 3300025256 Ga0209759_1000138 Ga0209759_100013857 248
114 3300025261 Ga0209233_1000069 Ga0209233_100006929 248
115 3300025261 Ga0209233_1011612 Ga0209233_10116122 248
116 3300025302 Ga0207426_1000004 Ga0207426_1000004613 248
117 3300026067 Ga0207678_10368033 Ga0207678_103680332 248
118 3300044672 Ga0466982_0000045 Ga0466982_0000045_28413_29159 248
119 3300044693 Ga0466961_0144497 Ga0466961_0144497_692_1462 248
120 3300044842 Ga0466957_0136051 Ga0466957_0136051_475_1224 248
121 3300046471 Ga0495650_0026434 Ga0495650_0026434_1046_1807 248
122 3300046648 Ga0495611_0137182 Ga0495611_0137182_113_874 248
123 3300046665 Ga0495661_0026579 Ga0495661_0026579_2305_3066 248
124 3300046810 Ga0495660_0006156 Ga0495660_0006156_1428_2189 248
125 3300047446 Ga0495679_055592 Ga0495679_055592_58_819 248
126 3300048903 Ga0496100_0000070 Ga0496100_0000070_49357_50106 248
127 3300048904 Ga0496101_0000044 Ga0496101_0000044_48613_49362 248
128 3300048905 Ga0496102_0000715 Ga0496102_0000715_23491_24240 248
129 3300048906 Ga0496103_0000213 Ga0496103_0000213_40621_41370 248
130 3300048907 Ga0496104_0030385 Ga0496104_0030385_754_1503 248
131 3300048920 Ga0496117_0000098 Ga0496117_0000098_83649_84398 248
132 3300048921 Ga0496118_0000625 Ga0496118_0000625_18288_19037 248
133 3300048922 Ga0496119_0146713 Ga0496119_0146713_295_1044 248
134 3300048924 Ga0496121_0000644 Ga0496121_0000644_24629_25378 248
135 3300048925 Ga0496122_0188789 Ga0496122_0188789_290_1039 248
136 3300048926 Ga0496123_0091764 Ga0496123_0091764_773_1522 248
137 3300048929 Ga0496126_0103660 Ga0496126_0103660_594_1343 248
138 3300049459 Ga0495678_000770 Ga0495678_000770_25487_26257 248
139 3300053121 Ga0500607_013384 Ga0500607_013384_95_841 248
140 3300053125 Ga0500618_014166 Ga0500618_014166_638_1393 248
141 iso_pu_bacteria 2582581304 2585257867 248
142 2162886007 SwRhRL2b_contig_2661064 SwRhRL2b_0391.00002650 249
143 3300003187 JGI25151J46595_10024808 JGI25151J46595_100248082 249
144 3300003320 rootH2_10056573 rootH2_100565733 249
145 3300003323 rootH1_10023100 rootH1_100231003 249
146 3300003758 Ga0055532_1000231 Ga0055532_10002315 249
147 3300003760 Ga0055527_1000188 Ga0055527_10001885 249
148 3300003761 Ga0055535_1000592 Ga0055535_100059227 249
149 3300003762 Ga0055542_1004297 Ga0055542_10042973 249
150 3300003763 Ga0055529_1004065 Ga0055529_10040652 249
151 3300003856 Ga0058692_1000028 Ga0058692_100002866 249
152 3300005289 Ga0065704_10070292 Ga0065704_1007029217 249
153 3300005327 Ga0070658_10066074 Ga0070658_100660742 249
154 3300005329 Ga0070683_100469064 Ga0070683_1004690641 249
155 3300005331 Ga0070670_100001975 Ga0070670_1000019754 249
156 3300005339 Ga0070660_100000361 Ga0070660_10000036124 249
157 3300005366 Ga0070659_100000078 Ga0070659_10000007844 249
158 3300005455 Ga0070663_100001118 Ga0070663_1000011186 249
159 3300005563 Ga0068855_100154659 Ga0068855_1001546593 249
160 3300005616 Ga0068852_100049181 Ga0068852_1000491813 249
161 3300005842 Ga0068858_100844277 Ga0068858_1008442771 249
162 3300006195 Ga0075366_10247888 Ga0075366_102478882 249
163 3300009011 Ga0105251_10000075 Ga0105251_100000753 249
164 3300009011 Ga0105251_10024598 Ga0105251_100245982 249
165 3300009092 Ga0105250_10041042 Ga0105250_100410422 249
166 3300009093 Ga0105240_10006962 Ga0105240_1000696216 249
167 3300009545 Ga0105237_10027009 Ga0105237_100270094 249
168 3300009551 Ga0105238_10039043 Ga0105238_100390433 249
169 3300009551 Ga0105238_10185516 Ga0105238_101855162 249
170 3300010375 Ga0105239_10044770 Ga0105239_100447702 249
171 3300013104 Ga0157370_10417080 Ga0157370_104170802 249
172 3300013307 Ga0157372_10154438 Ga0157372_101544383 249
173 3300015261 Ga0182006_1054838 Ga0182006_10548382 249
174 3300015265 Ga0182005_1001161 Ga0182005_10011615 249
175 3300015265 Ga0182005_1008657 Ga0182005_10086573 249
176 3300025228 Ga0209672_100020 Ga0209672_100020228 249
177 3300025229 Ga0209147_100024 Ga0209147_100024228 249
178 3300025242 Ga0209258_100121 Ga0209258_100121164 249
179 3300025254 Ga0209148_1000458 Ga0209148_10004582 249
180 3300025272 Ga0209455_1000263 Ga0209455_100026362 249
181 3300025294 Ga0209025_1000079 Ga0209025_100007925 249
182 3300025735 Ga0207713_1004521 Ga0207713_10045214 249
183 3300025913 Ga0207695_10000328 Ga0207695_1000032871 249
184 3300025913 Ga0207695_10103454 Ga0207695_101034542 249
185 3300025914 Ga0207671_10030100 Ga0207671_100301004 249
186 3300025919 Ga0207657_10000035 Ga0207657_10000035110 249
187 3300025924 Ga0207694_10022992 Ga0207694_100229923 249
188 3300025925 Ga0207650_10026629 Ga0207650_100266294 249
189 3300025932 Ga0207690_10000007 Ga0207690_10000007249 249
190 3300025933 Ga0207706_10269951 Ga0207706_102699512 249
191 3300025935 Ga0207709_10001926 Ga0207709_100019261 249
192 3300025945 Ga0207679_10433408 Ga0207679_104334082 249
193 3300025949 Ga0207667_10043062 Ga0207667_100430623 249
194 3300026035 Ga0207703_10694899 Ga0207703_106948992 249
195 3300026067 Ga0207678_10000064 Ga0207678_100000648 249
196 3300026078 Ga0207702_10149283 Ga0207702_101492831 249
197 3300026142 Ga0207698_10041860 Ga0207698_100418602 249
198 3300027312 Ga0209371_1000025 Ga0209371_1000025195 249
199 3300028786 Ga0307517_10022636 Ga0307517_100226362 249
200 3300030500 Ga0268256_1000027 Ga0268256_1000027195 249
201 3300031456 Ga0307513_10071917 Ga0307513_100719175 249
202 3300031548 Ga0307408_100054357 Ga0307408_1000543573 249
203 3300031730 Ga0307516_10010267 Ga0307516_100102672 249
204 3300031901 Ga0307406_10016788 Ga0307406_100167884 249
205 3300032004 Ga0307414_10212105 Ga0307414_102121052 249
206 3300032004 Ga0307414_10422781 Ga0307414_104227812 249
207 3300033180 Ga0307510_10030169 Ga0307510_100301693 249
208 3300033180 Ga0307510_10205090 Ga0307510_102050902 249
209 3300041452 Ga0451793_1920026 Ga0451793_1920026_1690_2439 249
210 3300041459 Ga0451800_1458579 Ga0451800_1458579_144_893 249
211 3300041486 Ga0451807_1506508 Ga0451807_1506508_1021_1770 249
212 3300041512 Ga0451853_0182881 Ga0451853_0182881_1301_2050 249
213 3300046460 Ga0495638_0134234 Ga0495638_0134234_508_1257 249
214 3300046471 Ga0495650_0000399 Ga0495650_0000399_46158_46931 249
215 3300046471 Ga0495650_0003026 Ga0495650_0003026_1933_2706 249
216 3300046471 Ga0495650_0008191 Ga0495650_0008191_1318_2082 249
217 3300046473 Ga0495582_0004182 Ga0495582_0004182_7191_7940 249
218 3300046501 Ga0495607_0008989 Ga0495607_0008989_5275_6027 249
219 3300046506 Ga0495583_0018984 Ga0495583_0018984_2609_3361 249
220 3300046515 Ga0495620_0025584 Ga0495620_0025584_1153_1902 249
221 3300046516 Ga0495628_0008629 Ga0495628_0008629_2696_3445 249
222 3300046675 Ga0495657_0007089 Ga0495657_0007089_4928_5677 249
223 3300047446 Ga0495679_023446 Ga0495679_023446_130_894 249
224 3300047472 Ga0495686_0128596 Ga0495686_0128596_86_835 249
225 3300048904 Ga0496101_0138500 Ga0496101_0138500_225_974 249
226 3300048907 Ga0496104_0086835 Ga0496104_0086835_1535_2299 249
227 3300048908 Ga0496105_0051870 Ga0496105_0051870_1434_2198 249
228 3300048908 Ga0496105_0198400 Ga0496105_0198400_209_958 249
229 3300048915 Ga0496112_0348521 Ga0496112_0348521_566_1315 249
230 3300048919 Ga0496116_0000216 Ga0496116_0000216_63482_64234 249
231 3300048920 Ga0496117_0005443 Ga0496117_0005443_11232_11981 249
232 3300048920 Ga0496117_0007740 Ga0496117_0007740_8928_9680 249
233 3300048920 Ga0496117_0015510 Ga0496117_0015510_4521_5285 249
234 3300048921 Ga0496118_0002026 Ga0496118_0002026_12991_13743 249
235 3300048921 Ga0496118_0002119 Ga0496118_0002119_9862_10611 249
236 3300048921 Ga0496118_0010724 Ga0496118_0010724_3692_4456 249
237 3300048922 Ga0496119_0002070 Ga0496119_0002070_11975_12739 249
238 3300048922 Ga0496119_0004204 Ga0496119_0004204_8080_8829 249
239 3300048923 Ga0496120_0002568 Ga0496120_0002568_9662_10426 249
240 3300048923 Ga0496120_0003369 Ga0496120_0003369_8207_8956 249
241 3300048924 Ga0496121_0038538 Ga0496121_0038538_3252_4001 249
242 3300048924 Ga0496121_0221258 Ga0496121_0221258_225_983 249
243 3300048925 Ga0496122_0001796 Ga0496122_0001796_29853_30605 249
244 3300048925 Ga0496122_0003728 Ga0496122_0003728_13205_13954 249
245 3300048925 Ga0496122_0015531 Ga0496122_0015531_1436_2200 249
246 3300048926 Ga0496123_0002974 Ga0496123_0002974_13238_13987 249
247 3300048926 Ga0496123_0005440 Ga0496123_0005440_1014_1766 249
248 3300048926 Ga0496123_0021311 Ga0496123_0021311_1334_2098 249
249 3300048926 Ga0496123_0032903 Ga0496123_0032903_1603_2361 249
250 3300048926 Ga0496123_0085292 Ga0496123_0085292_85_834 249
251 3300048927 Ga0496124_0000023 Ga0496124_0000023_378416_379168 249
252 3300048927 Ga0496124_0004196 Ga0496124_0004196_10559_11308 249
253 3300048927 Ga0496124_0078024 Ga0496124_0078024_215_964 249
254 3300048928 Ga0496125_0071638 Ga0496125_0071638_240_989 249
255 3300048929 Ga0496126_0007073 Ga0496126_0007073_1738_2487 249
256 3300048929 Ga0496126_0338366 Ga0496126_0338366_59_823 249
257 3300050493 nmdc:mga0k408_80510_c1 nmdc:mga0k408_80510_c1_836_1585 249
258 3300050496 nmdc:mga07m45_89187_c1 nmdc:mga07m45_89187_c1_436_1185 249
259 3300053080 Ga0500635_0111958 Ga0500635_0111958_83_832 249
260 3300053111 Ga0500572_117946 Ga0500572_117946_54_818 249
261 3300053118 Ga0500594_0005854 Ga0500594_0005854_1143_1892 249
262 3300053130 Ga0500642_0014673 Ga0500642_0014673_786_1535 249
263 3300053136 Ga0500559_0000038 Ga0500559_0000038_90720_91469 249
264 3300053136 Ga0500559_0018600 Ga0500559_0018600_388_1137 249
265 3300053138 Ga0500564_083698 Ga0500564_083698_62_811 249
266 3300053156 Ga0500622_0001043 Ga0500622_0001043_12811_13560 249
267 3300053156 Ga0500622_0076912 Ga0500622_0076912_380_1129 249
268 3300053177 Ga0500636_0001531 Ga0500636_0001531_6958_7707 249
269 3300055283 Ga0500661_008439 Ga0500661_008439_249_1001 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

211

0.93

PF08659

KR

KR domain

26

184

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

216

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

28

188

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imf-assembly1.cif.gz_D 1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' 0.9325 2 176
7e6o-assembly1.cif.gz_D crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9205 2 174
3guy-assembly1.cif.gz_D crystal structure of a short-chain dehydrogenase/reductase from vibrio parahaemolyticus 0.919 4 175
8hax-assembly1.cif.gz_B brucella melitensis 7alpha-hydroxysteroid dehydrogenase mutant-i258m/k262t 0.9187 2 174
2q2q-assembly2.cif.gz_F-2 structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.9183 2 174
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9687 76 174 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 2 171 3.40.50.720
af_A0A1D6LBF9_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9353 67 174 3.40.50.720
af_Q9W3K9_50_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9282 2 178 3.40.50.720
af_Q9VKB8_43_310_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9218 2 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A436QX60-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9994 1 164 GO:0000140
GO:0004806
GO:0005811
GO:0006654
GO:0019433
AF-A0A7Y9YS30-F1-model_v4 deleted 0.9977 1 248
AF-A0A7J0D2C2-F1-model_v4 Short-chain dehydrogenase/reductase 0.9964 1 182 GO:0016491
AF-A0A829XTV3-F1-model_v4 deleted 0.9915 32 249
AF-A0A7Y9YS30-F1-model_v4 deleted 0.9897 1 248

Feature Viewer

pLDDT pTM Quality
92.15 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map