F376563

General Info

Members Datasets Scaffolds Average Seq Length
269 177 538 262

Family's Representative Sequence

Representative Sequence 3300059607|Ga0587125_005873|Ga0587125_005873_142_1131
Length 301
Sequence MLLELVLETSFNAKWCSVPLSPTIPTPTPLYWVACPPLSPPSLPAAVLASGCQKLKSRDQLNKGVQAFKNAQYADAVESFKTAVELDPTFPTARLYLATAYMQQYIPGAESPENNRMAQAAHDEFMKVLEQTPNDKVAIASLASLYLNQKKWDDAQKWYEKLAAVDPNSPIPFYSLGFIAWSKWYPAYGTARANLGMKQEDPGPIKDKKTKEELKAKYGPVIDGGLQALDKALQIDPEYDDAMAYENLLIRERADLADSKDDYEKQIKIADGWVEKALATKKAKAEKKASQNAGGIVADQK

Samples

Sample ID Description Type Environment
1 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.53
Metatranscriptomes 17.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.83
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 20.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587125_005873 3300059607 Bacteria 1143
2 LJNas_1007656 3300000546 Unclassified 1164
3 Ga0006778J45830_1036009 3300003162 Bacteria 3622
4 Ga0007417J51691_1021341 3300003544 Bacteria 2159
5 Ga0007410J51695_1040984 3300003574 Bacteria 1282
6 Ga0007409J51694_1028100 3300003575 Bacteria 2143
7 Ga0007416J51690_1021587 3300003577 Bacteria 2164
8 Ga0007429J51699_1039048 3300003579 Bacteria 2135
9 Ga0058859_11186708 3300004798 Bacteria 1581
10 Ga0058863_10051327 3300004799 Bacteria 986
11 Ga0058863_10104028 3300004799 Bacteria 1241
12 Ga0058863_11315815 3300004799 Bacteria 905
13 Ga0058863_11584954 3300004799 Bacteria 1374
14 Ga0058861_10027511 3300004800 Bacteria 4260
15 Ga0058861_11624449 3300004800 Bacteria 1707
16 Ga0058861_12012930 3300004800 Bacteria 3126
17 Ga0058860_11704873 3300004801 Unclassified 895
18 Ga0058860_12085142 3300004801 Bacteria 2953
19 Ga0058862_12744229 3300004803 Bacteria 2921
20 Ga0065712_10139268 3300005290 Bacteria 1450
21 Ga0070658_10224564 3300005327 Bacteria 1589
22 Ga0070683_100000035 3300005329 Bacteria 122362
23 Ga0070683_100260938 3300005329 Unclassified 1648
24 Ga0070683_100410280 3300005329 Bacteria 1292
25 Ga0070683_100433423 3300005329 Unclassified 1254
26 Ga0070666_10299937 3300005335 Unclassified 1144
27 Ga0070666_10376270 3300005335 Unclassified 1019
28 Ga0070680_100125110 3300005336 Bacteria 2148
29 Ga0070689_100107190 3300005340 Bacteria 2218
30 Ga0070661_100083047 3300005344 Bacteria 2366
31 Ga0070668_100451633 3300005347 Bacteria 1105
32 Ga0070673_100073827 3300005364 Bacteria 2747
33 Ga0070688_100234992 3300005365 Unclassified 1298
34 Ga0070667_100325809 3300005367 Bacteria 1387
35 Ga0070709_10043696 3300005434 Bacteria 2772
36 Ga0070709_10264423 3300005434 Bacteria 1244
37 Ga0070709_10487775 3300005434 Bacteria 934
38 Ga0070714_100000047 3300005435 Bacteria 112707
39 Ga0070713_100076257 3300005436 Bacteria 2847
40 Ga0070711_100035486 3300005439 Bacteria 3335
41 Ga0070711_100188313 3300005439 Unclassified 1584
42 Ga0070678_100095783 3300005456 Bacteria 2288
43 Ga0068867_100322446 3300005459 Bacteria 1280
44 Ga0070706_100445725 3300005467 Bacteria 1205
45 Ga0070679_100303845 3300005530 Unclassified 1546
46 Ga0070684_100000044 3300005535 Bacteria 84710
47 Ga0070684_100262274 3300005535 Bacteria 1581
48 Ga0070684_100286743 3300005535 Unclassified 1509
49 Ga0070695_100178895 3300005545 Bacteria 1501
50 Ga0068855_100034160 3300005563 Bacteria 6066
51 Ga0068855_100056717 3300005563 Bacteria 4594
52 Ga0068855_100134190 3300005563 Bacteria 2825
53 Ga0068855_100567590 3300005563 Bacteria 1227
54 Ga0068857_100049425 3300005577 Bacteria 3731
55 Ga0068856_100042241 3300005614 Bacteria 4484
56 Ga0068852_100327887 3300005616 Bacteria 1489
57 Ga0068859_100165091 3300005617 Bacteria 2294
58 Ga0068859_100300583 3300005617 Bacteria 1698
59 Ga0068864_100004773 3300005618 Bacteria 11106
60 Ga0068858_100268864 3300005842 Bacteria 1622
61 Ga0068858_100552743 3300005842 Unclassified 1115
62 Ga0070717_10018142 3300006028 Bacteria 5491
63 Ga0070717_10169649 3300006028 Bacteria 1897
64 Ga0097621_100304400 3300006237 Bacteria 1409
65 Ga0068871_100399234 3300006358 Bacteria 1224
66 Ga0075430_100003612 3300006846 Bacteria 12974
67 Ga0075431_100041456 3300006847 Bacteria 4746
68 Ga0075433_10006163 3300006852 Bacteria 9458
69 Ga0075434_100000344 3300006871 Bacteria 33535
70 Ga0075434_100460602 3300006871 Unclassified 1293
71 Ga0075429_100149322 3300006880 Bacteria 2046
72 Ga0068865_100025590 3300006881 Bacteria 3884
73 Ga0075436_100008384 3300006914 Bacteria 7068
74 Ga0097620_100165089 3300006931 Bacteria 2294
75 Ga0097620_100300551 3300006931 Bacteria 1698
76 Ga0075435_100076541 3300007076 Bacteria 2742
77 Ga0075435_100111634 3300007076 Bacteria 2274
78 Ga0105240_10044875 3300009093 Bacteria 5612
79 Ga0105240_10237560 3300009093 Bacteria 2114
80 Ga0105240_10408838 3300009093 Bacteria 1527
81 Ga0105240_10641290 3300009093 Unclassified 1165
82 Ga0105240_10796837 3300009093 Bacteria 1024
83 Ga0105241_10021732 3300009174 Bacteria 4746
84 Ga0105242_10145141 3300009176 Unclassified 2064
85 Ga0105248_10020040 3300009177 Bacteria 7406
86 Ga0105248_10027568 3300009177 Bacteria 6326
87 Ga0105248_10179986 3300009177 Bacteria 2382
88 Ga0105248_10226175 3300009177 Bacteria 2106
89 Ga0105248_10435885 3300009177 Bacteria 1476
90 Ga0105248_10469577 3300009177 Bacteria 1418
91 Ga0105237_10004503 3300009545 Bacteria 16103
92 Ga0105237_10127470 3300009545 Bacteria 2539
93 Ga0105238_10033407 3300009551 Bacteria 5237
94 Ga0157369_10007776 3300013105 Bacteria 12334
95 Ga0157369_10274617 3300013105 Bacteria 1756
96 Ga0157369_10421812 3300013105 Unclassified 1383
97 Ga0157374_10021497 3300013296 Bacteria 5743
98 Ga0157378_10458210 3300013297 Bacteria 1267
99 Ga0163162_10524661 3300013306 Bacteria 1314
100 Ga0163162_11015443 3300013306 Bacteria 938
101 Ga0157375_10329110 3300013308 Bacteria 1693
102 Ga0157375_10545819 3300013308 Unclassified 1321
103 Ga0157375_10826565 3300013308 Unclassified 1074
104 Ga0163163_10003344 3300014325 Bacteria 13604
105 Ga0163163_10006332 3300014325 Bacteria 10334
106 Ga0163163_10078913 3300014325 Bacteria 3290
107 Ga0163163_10178126 3300014325 Bacteria 2173
108 Ga0157376_10063173 3300014969 Bacteria 3118
109 Ga0157376_10127838 3300014969 Bacteria 2263
110 Ga0163161_10375481 3300017792 Unclassified 1135
111 Ga0206356_10334766 3300020070 Unclassified 1934
112 Ga0206356_11467510 3300020070 Bacteria 2814
113 Ga0206355_1721531 3300020076 Bacteria 1141
114 Ga0206352_11176338 3300020078 Bacteria 1872
115 Ga0206350_10850435 3300020080 Unclassified 908
116 Ga0224712_10212571 3300022467 Unclassified 883
117 Ga0228598_1001939 3300024227 Unclassified 4503
118 Ga0207680_10046758 3300025903 Bacteria 2560
119 Ga0207647_10051208 3300025904 Bacteria 2553
120 Ga0207654_10017393 3300025911 Bacteria 3757
121 Ga0207654_10213277 3300025911 Bacteria 1277
122 Ga0207695_10033830 3300025913 Bacteria 5567
123 Ga0207695_10064769 3300025913 Bacteria 3761
124 Ga0207695_10434741 3300025913 Unclassified 1196
125 Ga0207671_10009620 3300025914 Bacteria 8058
126 Ga0207663_10085338 3300025916 Unclassified 2079
127 Ga0207660_10423419 3300025917 Unclassified 1074
128 Ga0207652_10131210 3300025921 Bacteria 2235
129 Ga0207652_10232625 3300025921 Unclassified 1661
130 Ga0207694_10032422 3300025924 Bacteria 3999
131 Ga0207694_10321695 3300025924 Bacteria 1277
132 Ga0207700_10103050 3300025928 Bacteria 2281
133 Ga0207664_10000076 3300025929 Bacteria 102019
134 Ga0207686_10180684 3300025934 Unclassified 1496
135 Ga0207711_10021501 3300025941 Bacteria 5390
136 Ga0207711_10028013 3300025941 Bacteria 4737
137 Ga0207661_10000008 3300025944 Bacteria 451211
138 Ga0207661_10130898 3300025944 Bacteria 2149
139 Ga0207661_10151873 3300025944 Bacteria 2003
140 Ga0207661_10225629 3300025944 Unclassified 1657
141 Ga0207667_10146623 3300025949 Bacteria 2430
142 Ga0207667_10600013 3300025949 Bacteria 1110
143 Ga0207651_10281037 3300025960 Bacteria 1376
144 Ga0207658_10288362 3300025986 Bacteria 1410
145 Ga0207677_10302569 3300026023 Bacteria 1322
146 Ga0207703_10157927 3300026035 Bacteria 1984
147 Ga0207702_10098840 3300026078 Bacteria 2571
148 Ga0207641_10017791 3300026088 Bacteria 5823
149 Ga0207641_10047507 3300026088 Bacteria 3620
150 Ga0207676_10051552 3300026095 Bacteria 3213
151 Ga0207674_10075528 3300026116 Bacteria 3379
152 Ga0207683_10082307 3300026121 Bacteria 2859
153 Ga0207698_10357862 3300026142 Bacteria 1381
154 Ga0268266_10143720 3300028379 Bacteria 2143
155 Ga0268266_10285146 3300028379 Bacteria 1537
156 Ga0268266_10334772 3300028379 Bacteria 1419
157 Ga0265323_10001898 3300028653 Bacteria 9860
158 Ga0265338_10001002 3300028800 Bacteria 47431
159 Ga0265762_1005281 3300030760 Bacteria 2316
160 Ga0265760_10000603 3300031090 Bacteria 10223
161 Ga0265331_10022625 3300031250 Bacteria 3206
162 Ga0265316_10011585 3300031344 Bacteria 7943
163 Ga0265316_10019559 3300031344 Bacteria 5785
164 Ga0265316_10153557 3300031344 Bacteria 1724
165 Ga0265316_10293021 3300031344 Unclassified 1187
166 Ga0265316_10341962 3300031344 Bacteria 1084
167 Ga0265314_10049120 3300031711 Bacteria 2956
168 Ga0265342_10093963 3300031712 Unclassified 1716
169 Ga0373934_0072195 3300035086 Bacteria 1382
170 Ga0373923_0005353 3300035111 Bacteria 4356
171 Ga0373923_0058540 3300035111 Bacteria 1632
172 Ga0373936_0006285 3300035113 Bacteria 4480
173 Ga0373954_0010977 3300035118 Bacteria 4007
174 Ga0373954_0190872 3300035118 Unclassified 1006
175 Ga0373956_0032461 3300035119 Bacteria 2291
176 Ga0373943_0000439 3300035170 Bacteria 17597
177 Ga0373943_0281177 3300035170 Bacteria 941
178 Ga0373946_0028220 3300035171 Unclassified 2225
179 Ga0373955_0044276 3300035172 Bacteria 2396
180 Ga0373955_0339565 3300035172 Unclassified 909
181 Ga0373927_0000340 3300035695 Bacteria 36716
182 Ga0373937_0104343 3300036401 Bacteria 2634
183 Ga0373937_0293282 3300036401 Bacteria 1537
184 Ga0373937_0405894 3300036401 Bacteria 1293
185 Ga0373937_0450746 3300036401 Bacteria 1222
186 Ga0373925_0007986 3300037068 Bacteria 7704
187 Ga0373925_1057254 3300037068 Unclassified 668
188 Ga0436365_0251641 3300039437 Unclassified 1284
189 Ga0451577_0234370 3300042876 Unclassified 1660
190 Ga0451577_0318623 3300042876 Unclassified 1410
191 Ga0453683_0120466 3300044673 Bacteria 1652
192 Ga0466963_0044754 3300044694 Bacteria 2913
193 Ga0453684_0263301 3300044712 Bacteria 1974
194 Ga0451576_0096959 3300045051 Bacteria 3067
195 Ga0451576_0265060 3300045051 Unclassified 1796
196 Ga0495592_0148244 3300046454 Unclassified 1625
197 Ga0495653_0209070 3300046463 Unclassified 1319
198 Ga0495580_0003796 3300046472 Bacteria 12802
199 Ga0495580_0041924 3300046472 Bacteria 3262
200 Ga0495580_0124637 3300046472 Bacteria 1788
201 Ga0495639_0013866 3300046475 Bacteria 3484
202 Ga0495630_0004930 3300046517 Bacteria 9385
203 Ga0495630_0085020 3300046517 Bacteria 2388
204 Ga0495652_0329230 3300046529 Bacteria 1101
205 Ga0495665_0017890 3300046531 Bacteria 3809
206 Ga0495640_0022994 3300046533 Bacteria 4551
207 Ga0495640_0206890 3300046533 Unclassified 1242
208 Ga0495586_0231869 3300046535 Bacteria 1051
209 Ga0495587_0205311 3300046536 Unclassified 1114
210 Ga0495645_0103746 3300046543 Bacteria 2020
211 Ga0495645_0340287 3300046543 Unclassified 969
212 Ga0495625_0158408 3300046660 Bacteria 1518
213 Ga0495635_0062786 3300046663 Bacteria 2551
214 Ga0495635_0087925 3300046663 Bacteria 2126
215 Ga0495635_0105732 3300046663 Bacteria 1923
216 Ga0495657_0338583 3300046675 Unclassified 892
217 Ga0495669_0164266 3300046684 Unclassified 1054
218 Ga0495581_0014238 3300047315 Bacteria 4612
219 Ga0495674_0133128 3300047319 Bacteria 2094
220 Ga0495674_0521119 3300047319 Bacteria 949
221 Ga0495676_0175494 3300047321 Unclassified 1505
222 Ga0495684_0002534 3300047471 Bacteria 14556
223 Ga0495684_0008660 3300047471 Bacteria 7869
224 Ga0495684_0378302 3300047471 Unclassified 999
225 Ga0495593_0129912 3300047673 Bacteria 1279
226 Ga0495602_0061099 3300048088 Bacteria 3279
227 Ga0495602_0370969 3300048088 Bacteria 1028
228 Ga0496101_0301824 3300048904 Bacteria 1254
229 Ga0496102_0077160 3300048905 Bacteria 3066
230 Ga0496105_0025771 3300048908 Bacteria 4791
231 Ga0496105_0156924 3300048908 Bacteria 1869
232 Ga0496108_0017200 3300048911 Bacteria 5915
233 Ga0496108_0018858 3300048911 Bacteria 5657
234 Ga0496109_0008953 3300048912 Bacteria 8527
235 Ga0496109_0299205 3300048912 Unclassified 1517
236 Ga0496110_0297176 3300048913 Bacteria 1471
237 Ga0496112_0023278 3300048915 Bacteria 5915
238 Ga0496113_0010832 3300048916 Bacteria 6051
239 Ga0496113_0015973 3300048916 Bacteria 5177
240 Ga0496115_0300055 3300048918 Bacteria 1316
241 Ga0496119_0037124 3300048922 Bacteria 3170
242 nmdc:mga0qj67_14992_c1 3300050509 Bacteria 5864
243 nmdc:mga06r32_97273_c1 3300050510 Bacteria 2884
244 nmdc:mga0n895_3028_c1 3300050512 Bacteria 13368
245 nmdc:mga0rr50_112821_c1 3300050513 Bacteria 2153
246 nmdc:mga0rr50_59838_c1 3300050513 Bacteria 2862
247 nmdc:mga0a205_4102_c1 3300050515 Bacteria 13030
248 Ga0587070_038111 3300059491 Bacteria 907
249 Ga0587073_0013988 3300059492 Bacteria 1421
250 Ga0587073_0036438 3300059492 Bacteria 1049
251 Ga0587077_011305 3300059493 Bacteria 1401
252 Ga0587077_011518 3300059493 Unclassified 1393
253 Ga0587077_016915 3300059493 Bacteria 1235
254 Ga0587080_033717 3300059503 Bacteria 904
255 Ga0587082_026059 3300059504 Unclassified 987
256 Ga0587083_0015039 3300059505 Bacteria 1343
257 Ga0587083_0043040 3300059505 Viruses 954
258 Ga0587088_035288 3300059508 Bacteria 916
259 Ga0587098_004479 3300059604 Bacteria 1322
260 Ga0587101_006217 3300059623 Unclassified 1360
261 Ga0587117_006468 3300059627 Unclassified 1308
262 Ga0587128_004973 3300059630 Bacteria 1568
263 Ga0587072_008370 3300059643 Bacteria 1637
264 Ga0587072_041627 3300059643 Bacteria 895
265 Ga0587075_021771 3300059644 Unclassified 958
266 Ga0587076_027673 3300059645 Bacteria 984
267 Ga0587079_038092 3300059647 Bacteria 958
268 Ga0587071_013814 3300060344 Unclassified 1397
269 Ga0501082_0001323 3300060353 Bacteria 21689
270 Ga0587125_005873
271 LJNas_1007656
272 Ga0006778J45830_1036009
273 Ga0007417J51691_1021341
274 Ga0007410J51695_1040984
275 Ga0007409J51694_1028100
276 Ga0007416J51690_1021587
277 Ga0007429J51699_1039048
278 Ga0058859_11186708
279 Ga0058863_10051327
280 Ga0058863_10104028
281 Ga0058863_11315815
282 Ga0058863_11584954
283 Ga0058861_10027511
284 Ga0058861_11624449
285 Ga0058861_12012930
286 Ga0058860_11704873
287 Ga0058860_12085142
288 Ga0058862_12744229
289 Ga0065712_10139268
290 Ga0070658_10224564
291 Ga0070683_100000035
292 Ga0070683_100260938
293 Ga0070683_100410280
294 Ga0070683_100433423
295 Ga0070666_10299937
296 Ga0070666_10376270
297 Ga0070680_100125110
298 Ga0070689_100107190
299 Ga0070661_100083047
300 Ga0070668_100451633
301 Ga0070673_100073827
302 Ga0070688_100234992
303 Ga0070667_100325809
304 Ga0070709_10043696
305 Ga0070709_10264423
306 Ga0070709_10487775
307 Ga0070714_100000047
308 Ga0070713_100076257
309 Ga0070711_100035486
310 Ga0070711_100188313
311 Ga0070678_100095783
312 Ga0068867_100322446
313 Ga0070706_100445725
314 Ga0070679_100303845
315 Ga0070684_100000044
316 Ga0070684_100262274
317 Ga0070684_100286743
318 Ga0070695_100178895
319 Ga0068855_100034160
320 Ga0068855_100056717
321 Ga0068855_100134190
322 Ga0068855_100567590
323 Ga0068857_100049425
324 Ga0068856_100042241
325 Ga0068852_100327887
326 Ga0068859_100165091
327 Ga0068859_100300583
328 Ga0068864_100004773
329 Ga0068858_100268864
330 Ga0068858_100552743
331 Ga0070717_10018142
332 Ga0070717_10169649
333 Ga0097621_100304400
334 Ga0068871_100399234
335 Ga0075430_100003612
336 Ga0075431_100041456
337 Ga0075433_10006163
338 Ga0075434_100000344
339 Ga0075434_100460602
340 Ga0075429_100149322
341 Ga0068865_100025590
342 Ga0075436_100008384
343 Ga0097620_100165089
344 Ga0097620_100300551
345 Ga0075435_100076541
346 Ga0075435_100111634
347 Ga0105240_10044875
348 Ga0105240_10237560
349 Ga0105240_10408838
350 Ga0105240_10641290
351 Ga0105240_10796837
352 Ga0105241_10021732
353 Ga0105242_10145141
354 Ga0105248_10020040
355 Ga0105248_10027568
356 Ga0105248_10179986
357 Ga0105248_10226175
358 Ga0105248_10435885
359 Ga0105248_10469577
360 Ga0105237_10004503
361 Ga0105237_10127470
362 Ga0105238_10033407
363 Ga0157369_10007776
364 Ga0157369_10274617
365 Ga0157369_10421812
366 Ga0157374_10021497
367 Ga0157378_10458210
368 Ga0163162_10524661
369 Ga0163162_11015443
370 Ga0157375_10329110
371 Ga0157375_10545819
372 Ga0157375_10826565
373 Ga0163163_10003344
374 Ga0163163_10006332
375 Ga0163163_10078913
376 Ga0163163_10178126
377 Ga0157376_10063173
378 Ga0157376_10127838
379 Ga0163161_10375481
380 Ga0206356_10334766
381 Ga0206356_11467510
382 Ga0206355_1721531
383 Ga0206352_11176338
384 Ga0206350_10850435
385 Ga0224712_10212571
386 Ga0228598_1001939
387 Ga0207680_10046758
388 Ga0207647_10051208
389 Ga0207654_10017393
390 Ga0207654_10213277
391 Ga0207695_10033830
392 Ga0207695_10064769
393 Ga0207695_10434741
394 Ga0207671_10009620
395 Ga0207663_10085338
396 Ga0207660_10423419
397 Ga0207652_10131210
398 Ga0207652_10232625
399 Ga0207694_10032422
400 Ga0207694_10321695
401 Ga0207700_10103050
402 Ga0207664_10000076
403 Ga0207686_10180684
404 Ga0207711_10021501
405 Ga0207711_10028013
406 Ga0207661_10000008
407 Ga0207661_10130898
408 Ga0207661_10151873
409 Ga0207661_10225629
410 Ga0207667_10146623
411 Ga0207667_10600013
412 Ga0207651_10281037
413 Ga0207658_10288362
414 Ga0207677_10302569
415 Ga0207703_10157927
416 Ga0207702_10098840
417 Ga0207641_10017791
418 Ga0207641_10047507
419 Ga0207676_10051552
420 Ga0207674_10075528
421 Ga0207683_10082307
422 Ga0207698_10357862
423 Ga0268266_10143720
424 Ga0268266_10285146
425 Ga0268266_10334772
426 Ga0265323_10001898
427 Ga0265338_10001002
428 Ga0265762_1005281
429 Ga0265760_10000603
430 Ga0265331_10022625
431 Ga0265316_10011585
432 Ga0265316_10019559
433 Ga0265316_10153557
434 Ga0265316_10293021
435 Ga0265316_10341962
436 Ga0265314_10049120
437 Ga0265342_10093963
438 Ga0373934_0072195
439 Ga0373923_0005353
440 Ga0373923_0058540
441 Ga0373936_0006285
442 Ga0373954_0010977
443 Ga0373954_0190872
444 Ga0373956_0032461
445 Ga0373943_0000439
446 Ga0373943_0281177
447 Ga0373946_0028220
448 Ga0373955_0044276
449 Ga0373955_0339565
450 Ga0373927_0000340
451 Ga0373937_0104343
452 Ga0373937_0293282
453 Ga0373937_0405894
454 Ga0373937_0450746
455 Ga0373925_0007986
456 Ga0373925_1057254
457 Ga0436365_0251641
458 Ga0451577_0234370
459 Ga0451577_0318623
460 Ga0453683_0120466
461 Ga0466963_0044754
462 Ga0453684_0263301
463 Ga0451576_0096959
464 Ga0451576_0265060
465 Ga0495592_0148244
466 Ga0495653_0209070
467 Ga0495580_0003796
468 Ga0495580_0041924
469 Ga0495580_0124637
470 Ga0495639_0013866
471 Ga0495630_0004930
472 Ga0495630_0085020
473 Ga0495652_0329230
474 Ga0495665_0017890
475 Ga0495640_0022994
476 Ga0495640_0206890
477 Ga0495586_0231869
478 Ga0495587_0205311
479 Ga0495645_0103746
480 Ga0495645_0340287
481 Ga0495625_0158408
482 Ga0495635_0062786
483 Ga0495635_0087925
484 Ga0495635_0105732
485 Ga0495657_0338583
486 Ga0495669_0164266
487 Ga0495581_0014238
488 Ga0495674_0133128
489 Ga0495674_0521119
490 Ga0495676_0175494
491 Ga0495684_0002534
492 Ga0495684_0008660
493 Ga0495684_0378302
494 Ga0495593_0129912
495 Ga0495602_0061099
496 Ga0495602_0370969
497 Ga0496101_0301824
498 Ga0496102_0077160
499 Ga0496105_0025771
500 Ga0496105_0156924
501 Ga0496108_0017200
502 Ga0496108_0018858
503 Ga0496109_0008953
504 Ga0496109_0299205
505 Ga0496110_0297176
506 Ga0496112_0023278
507 Ga0496113_0010832
508 Ga0496113_0015973
509 Ga0496115_0300055
510 Ga0496119_0037124
511 nmdc:mga0qj67_14992_c1
512 nmdc:mga06r32_97273_c1
513 nmdc:mga0n895_3028_c1
514 nmdc:mga0rr50_112821_c1
515 nmdc:mga0rr50_59838_c1
516 nmdc:mga0a205_4102_c1
517 Ga0587070_038111
518 Ga0587073_0013988
519 Ga0587073_0036438
520 Ga0587077_011305
521 Ga0587077_011518
522 Ga0587077_016915
523 Ga0587080_033717
524 Ga0587082_026059
525 Ga0587083_0015039
526 Ga0587083_0043040
527 Ga0587088_035288
528 Ga0587098_004479
529 Ga0587101_006217
530 Ga0587117_006468
531 Ga0587128_004973
532 Ga0587072_008370
533 Ga0587072_041627
534 Ga0587075_021771
535 Ga0587076_027673
536 Ga0587079_038092
537 Ga0587071_013814
538 Ga0501082_0001323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13414

TPR_11

TPR repeat

66

104

0.95

PF14559

TPR_19

Tetratricopeptide repeat

115

176

0.93

PF13432

TPR_16

Tetratricopeptide repeat

61

136

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1na3-assembly1.cif.gz_A design of stable alpha-helical arrays from an idealized tpr motif 0.9332 20 114
8cus-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9238 21 143
6vl6-assembly1.cif.gz_B de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers 0.9233 21 127
8fwd-assembly1.cif.gz_2 fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock 0.9201 21 128
6vfj-assembly1.cif.gz_B de novo designed icosahedral nanoparticle i53_dn5 0.9152 20 136
ID Description Score Start End Superfamily
3pe4A01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9372 21 131 1.25.40.10
af_Q4DCN5_245_348_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9364 17 111 1.25.40.10
af_Q4DHE6_245_347_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9363 12 111 1.25.40.10
af_A4I5Y0_484_573_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.935 29 127 1.25.40.10
4gz3A01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9349 21 131 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V9CLC6-F1-model_v4 Uncharacterized protein 0.9495 2 112
AF-A0A2V9R3G2-F1-model_v4 Uncharacterized protein 0.9455 20 257
AF-A0A7V5YTW9-F1-model_v4 Tetratricopeptide repeat protein 0.9445 3 122
AF-C1F9H8-F1-model_v4 TPR domain protein 0.9428 9 257
AF-A0A7C3GH47-F1-model_v4 Tetratricopeptide repeat protein 0.9412 47 262

Map