F376495

General Info

Members Datasets Scaffolds Average Seq Length
269 210 538 115

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0011312|Ga0501031_0011312_1976_2362
Length 128
Sequence MTSSDDMGAPGGSGAPAIDPAVPPSGTGCASCDADGGWWFHLRRCAACGRIGCCDSSPGRHASAHAAATGHPVVRSFEPGEDWFWDYAREQYVEQGPQLAAPQSHPADQAVPGPSDRVPPDWRDRLNR

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 2643221613 Oerskovia sp. Root22 Isolate Unclassified
198 2643221620 Nocardioides sp. Root240 Isolate Unclassified
199 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
200 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
201 2643221721 Oerskovia sp. Root918 Isolate Unclassified
202 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
203 2738541305 Nocardioides sp. CF167 Isolate Unclassified
204 2739367898 Nocardioides sp. CF479 Isolate Unclassified
205 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
206 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
207 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
208 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
209 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
210 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 1.49
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 0.37
Rhizoplane 8.92
Rhizosphere 75.46
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0011312 3300049568 Bacteria 5815
2 Ga0065714_10105490 3300005288 Bacteria 1565
3 Ga0070658_11357493 3300005327 Bacteria 617
4 Ga0070683_100446602 3300005329 Bacteria 1234
5 Ga0070682_100436737 3300005337 Bacteria 999
6 Ga0070660_100456866 3300005339 Bacteria 1060
7 Ga0070689_101728054 3300005340 Bacteria 570
8 Ga0070668_100087386 3300005347 Bacteria 2453
9 Ga0070674_100874640 3300005356 Bacteria 781
10 Ga0070674_101470873 3300005356 Bacteria 612
11 Ga0070688_101093544 3300005365 Bacteria 637
12 Ga0070709_10254820 3300005434 Bacteria 1266
13 Ga0070709_10664240 3300005434 Bacteria 808
14 Ga0070714_100013261 3300005435 Bacteria 6599
15 Ga0070714_100163068 3300005435 Bacteria 2018
16 Ga0070713_100006733 3300005436 Bacteria 8003
17 Ga0070710_10033354 3300005437 Bacteria 2796
18 Ga0070711_100759655 3300005439 Bacteria 820
19 Ga0070663_102051945 3300005455 Bacteria 515
20 Ga0070678_100755295 3300005456 Bacteria 880
21 Ga0070678_101376628 3300005456 Bacteria 658
22 Ga0070706_100120536 3300005467 Bacteria 2445
23 Ga0070684_100370299 3300005535 Bacteria 1319
24 Ga0070672_101477836 3300005543 Bacteria 609
25 Ga0070665_100044756 3300005548 Bacteria 4444
26 Ga0068855_101433382 3300005563 Bacteria 711
27 Ga0070664_100391342 3300005564 Bacteria 1270
28 Ga0068857_100799553 3300005577 Bacteria 900
29 Ga0068852_101506504 3300005616 Bacteria 695
30 Ga0068864_100001367 3300005618 Bacteria 20249
31 Ga0068863_100879414 3300005841 Bacteria 896
32 Ga0068858_100775522 3300005842 Bacteria 935
33 Ga0081455_10111834 3300005937 Bacteria 2169
34 Ga0070717_11707807 3300006028 Bacteria 570
35 Ga0075365_10208338 3300006038 Bacteria 1370
36 Ga0075365_10476804 3300006038 Bacteria 881
37 Ga0075365_10890647 3300006038 Bacteria 627
38 Ga0075364_10245521 3300006051 Bacteria 1216
39 Ga0075367_10040181 3300006178 Bacteria 2730
40 Ga0075367_10989699 3300006178 Bacteria 537
41 Ga0097621_102229193 3300006237 Bacteria 524
42 Ga0075370_10178869 3300006353 Bacteria 1248
43 Ga0075428_100310397 3300006844 Bacteria 1695
44 Ga0075428_100815137 3300006844 Bacteria 992
45 Ga0075430_100178334 3300006846 Bacteria 1767
46 Ga0075431_100370934 3300006847 Bacteria 1436
47 Ga0075429_100227318 3300006880 Bacteria 1634
48 Ga0075435_100908524 3300007076 Bacteria 768
49 Ga0105240_12739319 3300009093 Bacteria 508
50 Ga0111539_11269574 3300009094 Bacteria 855
51 Ga0105245_11194031 3300009098 Bacteria 809
52 Ga0114129_10030872 3300009147 Bacteria 7579
53 Ga0114129_10147787 3300009147 Bacteria 3218
54 Ga0105241_11793570 3300009174 Bacteria 599
55 Ga0105248_10053540 3300009177 Bacteria 4528
56 Ga0105238_11370454 3300009551 Bacteria 734
57 Ga0105249_12646900 3300009553 Bacteria 574
58 Ga0157369_10605270 3300013105 Bacteria 1131
59 Ga0163162_10885565 3300013306 Bacteria 1006
60 Ga0157372_10534389 3300013307 Bacteria 1367
61 Ga0157375_11872185 3300013308 Bacteria 712
62 Ga0163163_10006430 3300014325 Bacteria 10270
63 Ga0157377_11328603 3300014745 Bacteria 563
64 Ga0157379_10489722 3300014968 Bacteria 1139
65 Ga0157379_10623095 3300014968 Bacteria 1008
66 Ga0163161_11236020 3300017792 Bacteria 647
67 Ga0206353_10241447 3300020082 Bacteria 872
68 Ga0206353_10458366 3300020082 Bacteria 636
69 Ga0206353_11122694 3300020082 Bacteria 589
70 Ga0206353_11443137 3300020082 Bacteria 1654
71 Ga0213875_10355932 3300021388 Bacteria 696
72 Ga0224572_1023400 3300024225 Unclassified 1187
73 Ga0207692_10189042 3300025898 Bacteria 1204
74 Ga0207699_10222198 3300025906 Bacteria 1290
75 Ga0207699_11299551 3300025906 Bacteria 538
76 Ga0207705_10927581 3300025909 Bacteria 674
77 Ga0207707_10949682 3300025912 Bacteria 708
78 Ga0207693_10542183 3300025915 Bacteria 907
79 Ga0207663_10518808 3300025916 Bacteria 928
80 Ga0207663_10794441 3300025916 Bacteria 753
81 Ga0207662_10100871 3300025918 Bacteria 1788
82 Ga0207657_10147862 3300025919 Bacteria 1915
83 Ga0207700_10652473 3300025928 Bacteria 938
84 Ga0207664_10105586 3300025929 Bacteria 2334
85 Ga0207669_10498234 3300025937 Bacteria 974
86 Ga0207669_10562696 3300025937 Bacteria 922
87 Ga0207665_10559709 3300025939 Bacteria 889
88 Ga0207711_10102565 3300025941 Bacteria 2533
89 Ga0207679_10047733 3300025945 Bacteria 3113
90 Ga0207667_10988195 3300025949 Bacteria 829
91 Ga0207712_10892207 3300025961 Bacteria 785
92 Ga0207703_10542807 3300026035 Bacteria 1095
93 Ga0207641_10219226 3300026088 Bacteria 1763
94 Ga0207676_10019724 3300026095 Bacteria 4924
95 Ga0207674_10161666 3300026116 Bacteria 2193
96 Ga0207683_10420446 3300026121 Bacteria 1231
97 Ga0265356_1016860 3300028017 Unclassified 791
98 Ga0307515_10132458 3300028794 Bacteria 2735
99 Ga0265325_10005990 3300031241 Bacteria 7440
100 Ga0265339_10108921 3300031249 Bacteria 1435
101 Ga0265327_10261733 3300031251 Bacteria 768
102 Ga0265316_10047304 3300031344 Bacteria 3404
103 Ga0265313_10044612 3300031595 Bacteria 2163
104 Ga0316575_10043046 3300031665 Bacteria 1789
105 Ga0316575_10106950 3300031665 Bacteria 1140
106 Ga0316576_10069947 3300031727 Bacteria 2588
107 Ga0307516_10496933 3300031730 Bacteria 874
108 Ga0307413_10358602 3300031824 Bacteria 1128
109 Ga0307413_10917427 3300031824 Bacteria 745
110 Ga0307413_11079134 3300031824 Bacteria 692
111 Ga0307410_10089694 3300031852 Bacteria 2179
112 Ga0307410_10318669 3300031852 Bacteria 1233
113 Ga0326468_10050282 3300031889 Bacteria 629
114 Ga0307409_100112270 3300031995 Bacteria 2288
115 Ga0307409_100930511 3300031995 Bacteria 884
116 Ga0307414_10359745 3300032004 Bacteria 1252
117 Ga0307415_101808993 3300032126 Bacteria 591
118 Ga0307415_101812912 3300032126 Bacteria 591
119 Ga0316574_0081038 3300035398 Bacteria 2061
120 Ga0373947_0117844 3300035725 Bacteria 1685
121 Ga0373937_0680597 3300036401 Bacteria 975
122 Ga0373925_1006008 3300037068 Bacteria 686
123 Ga0395898_0157935 3300037466 Bacteria 2169
124 Ga0395905_1852870 3300037471 Bacteria 509
125 Ga0436364_0258533 3300037853 Bacteria 1968
126 Ga0395901_1156098 3300038443 Bacteria 742
127 Ga0451791_1836936 3300041451 Bacteria 3390
128 Ga0451793_1332788 3300041452 Bacteria 2144
129 Ga0451793_1539198 3300041452 Bacteria 533
130 Ga0451797_1079791 3300041453 Bacteria 646
131 Ga0451807_1259144 3300041486 Bacteria 762
132 Ga0451833_1082831 3300041491 Bacteria 676
133 Ga0451837_1064060 3300041494 Bacteria 2438
134 Ga0451845_0123657 3300041501 Bacteria 1256
135 Ga0451851_0432861 3300041507 Bacteria 649
136 Ga0451855_0697121 3300041511 Bacteria 538
137 Ga0451853_3344155 3300041512 Bacteria 591
138 Ga0450900_032641 3300042136 Bacteria 761
139 Ga0439435_0078660 3300042436 Bacteria 987
140 Ga0466969_0010461 3300044656 Bacteria 4918
141 Ga0466972_0000835 3300044658 Bacteria 14773
142 Ga0466965_0037536 3300044683 Bacteria 2379
143 Ga0466965_0086735 3300044683 Bacteria 1588
144 Ga0466965_0607667 3300044683 Bacteria 622
145 Ga0466966_0176457 3300044684 Bacteria 1297
146 Ga0466961_0014635 3300044693 Bacteria 5039
147 Ga0466971_0024185 3300044719 Bacteria 2710
148 Ga0466971_0259843 3300044719 Bacteria 828
149 Ga0466970_0107082 3300044765 Bacteria 1525
150 Ga0466960_0173512 3300044901 Bacteria 1165
151 Ga0466960_0483601 3300044901 Bacteria 723
152 Ga0466959_0220875 3300045049 Bacteria 1314
153 Ga0466967_1820154 3300045976 Bacteria 606
154 Ga0495629_0054278 3300046459 Bacteria 2803
155 Ga0495629_0186730 3300046459 Bacteria 1436
156 Ga0495651_0396617 3300046462 Bacteria 902
157 Ga0495653_0277732 3300046463 Bacteria 1100
158 Ga0495653_0526454 3300046463 Bacteria 734
159 Ga0495608_0200054 3300046511 Bacteria 1259
160 Ga0495630_0430274 3300046517 Bacteria 1011
161 Ga0495656_0701765 3300046615 Bacteria 544
162 Ga0495635_0339144 3300046663 Bacteria 1004
163 Ga0495658_0332651 3300046683 Bacteria 964
164 Ga0495680_0695350 3300047322 Bacteria 672
165 Ga0496102_0005160 3300048905 Bacteria 11083
166 Ga0496103_0042128 3300048906 Bacteria 2808
167 Ga0496104_0111445 3300048907 Bacteria 2623
168 Ga0496104_1226418 3300048907 Bacteria 653
169 Ga0496105_0123785 3300048908 Bacteria 2131
170 Ga0496108_0398560 3300048911 Bacteria 1202
171 Ga0496108_0554430 3300048911 Bacteria 1002
172 Ga0496108_0732550 3300048911 Bacteria 856
173 Ga0496109_0014732 3300048912 Bacteria 6803
174 Ga0496109_1166169 3300048912 Bacteria 707
175 Ga0496110_0184520 3300048913 Bacteria 1894
176 Ga0496111_0116762 3300048914 Bacteria 1968
177 Ga0496112_0091176 3300048915 Bacteria 3016
178 Ga0496112_0391300 3300048915 Bacteria 1330
179 Ga0496112_1870480 3300048915 Bacteria 512
180 Ga0496113_0004049 3300048916 Bacteria 8928
181 Ga0496113_0719701 3300048916 Bacteria 796
182 Ga0496114_0056861 3300048917 Bacteria 3265
183 Ga0496114_0125436 3300048917 Bacteria 2213
184 Ga0496118_0246583 3300048921 Bacteria 1018
185 Ga0496121_0093955 3300048924 Bacteria 2334
186 Ga0496124_0141632 3300048927 Bacteria 1897
187 Ga0496126_0117425 3300048929 Bacteria 2311
188 Ga0501031_0204267 3300049568 Bacteria 1289
189 Ga0501032_0017873 3300049569 Bacteria 4975
190 Ga0501033_0079266 3300049570 Bacteria 2410
191 Ga0501034_0004496 3300049571 Bacteria 15498
192 Ga0501036_0309171 3300049572 Bacteria 1322
193 Ga0501036_0322576 3300049572 Bacteria 1290
194 Ga0501037_0006849 3300049573 Bacteria 8325
195 Ga0501037_0539649 3300049573 Bacteria 788
196 Ga0501038_0200416 3300049574 Bacteria 1602
197 Ga0501042_0092307 3300049578 Bacteria 2174
198 Ga0501042_0156635 3300049578 Bacteria 1643
199 Ga0501042_0691141 3300049578 Bacteria 742
200 Ga0501042_1412368 3300049578 Bacteria 508
201 Ga0501043_0109769 3300049579 Bacteria 2166
202 Ga0501046_0004510 3300049580 Bacteria 12619
203 Ga0501047_0003281 3300049581 Bacteria 15320
204 Ga0501048_0017499 3300049582 Bacteria 5277
205 Ga0501067_0239688 3300049583 Bacteria 1009
206 Ga0501068_0163838 3300049584 Bacteria 1402
207 Ga0501070_0000727 3300049586 Bacteria 30087
208 Ga0501070_0676832 3300049586 Bacteria 817
209 Ga0501071_0055229 3300049587 Bacteria 2867
210 Ga0501071_0245588 3300049587 Bacteria 1350
211 Ga0501071_0878043 3300049587 Bacteria 692
212 Ga0501072_0039634 3300049588 Bacteria 3698
213 Ga0501072_0352031 3300049588 Bacteria 1169
214 Ga0501072_1304891 3300049588 Bacteria 562
215 Ga0501073_0048050 3300049589 Bacteria 2997
216 Ga0501073_0541592 3300049589 Bacteria 804
217 Ga0501074_0202539 3300049590 Bacteria 1414
218 Ga0501075_0032648 3300049591 Bacteria 3869
219 Ga0501076_0137473 3300049592 Bacteria 1984
220 Ga0501076_0178676 3300049592 Bacteria 1730
221 Ga0501077_0029535 3300049593 Bacteria 3485
222 Ga0501079_0160414 3300049741 Bacteria 1753
223 Ga0501080_0090790 3300049742 Bacteria 2837
224 Ga0501081_0359069 3300049743 Bacteria 1074
225 Ga0501081_1174530 3300049743 Bacteria 581
226 Ga0501083_0304185 3300049744 Bacteria 1037
227 Ga0501035_0001946 3300049822 Bacteria 20676
228 Ga0501035_0004756 3300049822 Bacteria 12892
229 Ga0501044_0002025 3300049823 Bacteria 23362
230 Ga0501045_0848134 3300049824 Bacteria 672
231 nmdc:mga00v17_160056_c1 3300050491 Bacteria 1449
232 nmdc:mga00v17_505894_c1 3300050491 Bacteria 783
233 nmdc:mga0yw44_193231_c1 3300050492 Bacteria 1343
234 nmdc:mga0yw44_415798_c1 3300050492 Bacteria 910
235 nmdc:mga0yw44_807979_c1 3300050492 Bacteria 637
236 nmdc:mga06z11_476008_c1 3300050494 Bacteria 756
237 nmdc:mga07m45_192082_c1 3300050496 Bacteria 1187
238 nmdc:mga05p37_42641_c1 3300050507 Bacteria 5577
239 nmdc:mga05p37_982703_c1 3300050507 Unclassified 899
240 nmdc:mga09592_127860_c1 3300050508 Bacteria 2185
241 nmdc:mga0qj67_44588_c1 3300050509 Bacteria 3496
242 nmdc:mga06r32_288233_c1 3300050510 Bacteria 1629
243 nmdc:mga08y16_1065591_c1 3300050511 Bacteria 785
244 Ga0495601_0614771 3300053077 Bacteria 697
245 Ga0495619_0034558 3300053085 Bacteria 3287
246 Ga0495619_0355826 3300053085 Bacteria 1013
247 Ga0500644_0000271 3300053088 Bacteria 29196
248 Ga0500559_0025241 3300053136 Bacteria 2529
249 Ga0500616_0073657 3300053153 Bacteria 1733
250 Ga0501084_0256694 3300054114 Bacteria 1475
251 Ga0501084_0377238 3300054114 Bacteria 1198
252 Ga0501082_0122259 3300060353 Bacteria 2257
253 Ga0501082_1904711 3300060353 Bacteria 518
254 Ga0466962_0051069 3300061719 Bacteria 1977
255 Ga0530510_0165651 3300061734 Bacteria 1636
256 2644081399 2643221613 Bacteria 4622396
257 2644115278 2643221620 Bacteria 5134593
258 2644503932 2643221690 Bacteria 4654705
259 2644527006 2643221694 Bacteria 4392972
260 2644664532 2643221721 Bacteria 4486924
261 2644670261 2643221722 Bacteria 4247614
262 2738870250 2738541305 Bacteria 4910150
263 2740168769 2739367898 Bacteria 4367674
264 2857483525 2857481737 Bacteria 4761446
265 2884997082 2884994152 Bacteria 4492978
266 2935894049 2935890801 Bacteria 4593001
267 2939585043 2939582691 Bacteria 7088898
268 8033688638 8033684223 Bacteria 6906479
269 8054611678 8054609563 Bacteria 5170090
270 Ga0501031_0011312
271 Ga0065714_10105490
272 Ga0070658_11357493
273 Ga0070683_100446602
274 Ga0070682_100436737
275 Ga0070660_100456866
276 Ga0070689_101728054
277 Ga0070668_100087386
278 Ga0070674_100874640
279 Ga0070674_101470873
280 Ga0070688_101093544
281 Ga0070709_10254820
282 Ga0070709_10664240
283 Ga0070714_100013261
284 Ga0070714_100163068
285 Ga0070713_100006733
286 Ga0070710_10033354
287 Ga0070711_100759655
288 Ga0070663_102051945
289 Ga0070678_100755295
290 Ga0070678_101376628
291 Ga0070706_100120536
292 Ga0070684_100370299
293 Ga0070672_101477836
294 Ga0070665_100044756
295 Ga0068855_101433382
296 Ga0070664_100391342
297 Ga0068857_100799553
298 Ga0068852_101506504
299 Ga0068864_100001367
300 Ga0068863_100879414
301 Ga0068858_100775522
302 Ga0081455_10111834
303 Ga0070717_11707807
304 Ga0075365_10208338
305 Ga0075365_10476804
306 Ga0075365_10890647
307 Ga0075364_10245521
308 Ga0075367_10040181
309 Ga0075367_10989699
310 Ga0097621_102229193
311 Ga0075370_10178869
312 Ga0075428_100310397
313 Ga0075428_100815137
314 Ga0075430_100178334
315 Ga0075431_100370934
316 Ga0075429_100227318
317 Ga0075435_100908524
318 Ga0105240_12739319
319 Ga0111539_11269574
320 Ga0105245_11194031
321 Ga0114129_10030872
322 Ga0114129_10147787
323 Ga0105241_11793570
324 Ga0105248_10053540
325 Ga0105238_11370454
326 Ga0105249_12646900
327 Ga0157369_10605270
328 Ga0163162_10885565
329 Ga0157372_10534389
330 Ga0157375_11872185
331 Ga0163163_10006430
332 Ga0157377_11328603
333 Ga0157379_10489722
334 Ga0157379_10623095
335 Ga0163161_11236020
336 Ga0206353_10241447
337 Ga0206353_10458366
338 Ga0206353_11122694
339 Ga0206353_11443137
340 Ga0213875_10355932
341 Ga0224572_1023400
342 Ga0207692_10189042
343 Ga0207699_10222198
344 Ga0207699_11299551
345 Ga0207705_10927581
346 Ga0207707_10949682
347 Ga0207693_10542183
348 Ga0207663_10518808
349 Ga0207663_10794441
350 Ga0207662_10100871
351 Ga0207657_10147862
352 Ga0207700_10652473
353 Ga0207664_10105586
354 Ga0207669_10498234
355 Ga0207669_10562696
356 Ga0207665_10559709
357 Ga0207711_10102565
358 Ga0207679_10047733
359 Ga0207667_10988195
360 Ga0207712_10892207
361 Ga0207703_10542807
362 Ga0207641_10219226
363 Ga0207676_10019724
364 Ga0207674_10161666
365 Ga0207683_10420446
366 Ga0265356_1016860
367 Ga0307515_10132458
368 Ga0265325_10005990
369 Ga0265339_10108921
370 Ga0265327_10261733
371 Ga0265316_10047304
372 Ga0265313_10044612
373 Ga0316575_10043046
374 Ga0316575_10106950
375 Ga0316576_10069947
376 Ga0307516_10496933
377 Ga0307413_10358602
378 Ga0307413_10917427
379 Ga0307413_11079134
380 Ga0307410_10089694
381 Ga0307410_10318669
382 Ga0326468_10050282
383 Ga0307409_100112270
384 Ga0307409_100930511
385 Ga0307414_10359745
386 Ga0307415_101808993
387 Ga0307415_101812912
388 Ga0316574_0081038
389 Ga0373947_0117844
390 Ga0373937_0680597
391 Ga0373925_1006008
392 Ga0395898_0157935
393 Ga0395905_1852870
394 Ga0436364_0258533
395 Ga0395901_1156098
396 Ga0451791_1836936
397 Ga0451793_1332788
398 Ga0451793_1539198
399 Ga0451797_1079791
400 Ga0451807_1259144
401 Ga0451833_1082831
402 Ga0451837_1064060
403 Ga0451845_0123657
404 Ga0451851_0432861
405 Ga0451855_0697121
406 Ga0451853_3344155
407 Ga0450900_032641
408 Ga0439435_0078660
409 Ga0466969_0010461
410 Ga0466972_0000835
411 Ga0466965_0037536
412 Ga0466965_0086735
413 Ga0466965_0607667
414 Ga0466966_0176457
415 Ga0466961_0014635
416 Ga0466971_0024185
417 Ga0466971_0259843
418 Ga0466970_0107082
419 Ga0466960_0173512
420 Ga0466960_0483601
421 Ga0466959_0220875
422 Ga0466967_1820154
423 Ga0495629_0054278
424 Ga0495629_0186730
425 Ga0495651_0396617
426 Ga0495653_0277732
427 Ga0495653_0526454
428 Ga0495608_0200054
429 Ga0495630_0430274
430 Ga0495656_0701765
431 Ga0495635_0339144
432 Ga0495658_0332651
433 Ga0495680_0695350
434 Ga0496102_0005160
435 Ga0496103_0042128
436 Ga0496104_0111445
437 Ga0496104_1226418
438 Ga0496105_0123785
439 Ga0496108_0398560
440 Ga0496108_0554430
441 Ga0496108_0732550
442 Ga0496109_0014732
443 Ga0496109_1166169
444 Ga0496110_0184520
445 Ga0496111_0116762
446 Ga0496112_0091176
447 Ga0496112_0391300
448 Ga0496112_1870480
449 Ga0496113_0004049
450 Ga0496113_0719701
451 Ga0496114_0056861
452 Ga0496114_0125436
453 Ga0496118_0246583
454 Ga0496121_0093955
455 Ga0496124_0141632
456 Ga0496126_0117425
457 Ga0501031_0204267
458 Ga0501032_0017873
459 Ga0501033_0079266
460 Ga0501034_0004496
461 Ga0501036_0309171
462 Ga0501036_0322576
463 Ga0501037_0006849
464 Ga0501037_0539649
465 Ga0501038_0200416
466 Ga0501042_0092307
467 Ga0501042_0156635
468 Ga0501042_0691141
469 Ga0501042_1412368
470 Ga0501043_0109769
471 Ga0501046_0004510
472 Ga0501047_0003281
473 Ga0501048_0017499
474 Ga0501067_0239688
475 Ga0501068_0163838
476 Ga0501070_0000727
477 Ga0501070_0676832
478 Ga0501071_0055229
479 Ga0501071_0245588
480 Ga0501071_0878043
481 Ga0501072_0039634
482 Ga0501072_0352031
483 Ga0501072_1304891
484 Ga0501073_0048050
485 Ga0501073_0541592
486 Ga0501074_0202539
487 Ga0501075_0032648
488 Ga0501076_0137473
489 Ga0501076_0178676
490 Ga0501077_0029535
491 Ga0501079_0160414
492 Ga0501080_0090790
493 Ga0501081_0359069
494 Ga0501081_1174530
495 Ga0501083_0304185
496 Ga0501035_0001946
497 Ga0501035_0004756
498 Ga0501044_0002025
499 Ga0501045_0848134
500 nmdc:mga00v17_160056_c1
501 nmdc:mga00v17_505894_c1
502 nmdc:mga0yw44_193231_c1
503 nmdc:mga0yw44_415798_c1
504 nmdc:mga0yw44_807979_c1
505 nmdc:mga06z11_476008_c1
506 nmdc:mga07m45_192082_c1
507 nmdc:mga05p37_42641_c1
508 nmdc:mga05p37_982703_c1
509 nmdc:mga09592_127860_c1
510 nmdc:mga0qj67_44588_c1
511 nmdc:mga06r32_288233_c1
512 nmdc:mga08y16_1065591_c1
513 Ga0495601_0614771
514 Ga0495619_0034558
515 Ga0495619_0355826
516 Ga0500644_0000271
517 Ga0500559_0025241
518 Ga0500616_0073657
519 Ga0501084_0256694
520 Ga0501084_0377238
521 Ga0501082_0122259
522 Ga0501082_1904711
523 Ga0466962_0051069
524 Ga0530510_0165651
525 2644081399
526 2644115278
527 2644503932
528 2644527006
529 2644664532
530 2644670261
531 2738870250
532 2740168769
533 2857483525
534 2884997082
535 2935894049
536 2939585043
537 8033688638
538 8054611678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

29

98

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fk5-assembly1.cif.gz_A structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module 0.8612 31 82
6aqr-assembly1.cif.gz_A saga dub module ubp8(c146a)/sgf11/sus1/sgf73 bound to monoubiquitin 0.8597 31 82
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.856 30 84
6t9l-assembly1.cif.gz_K saga dub module bound to a ubiqitinated nucleosome 0.8346 31 82
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.8223 6 85
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.945 11 82 3.30.40.10
af_Q9GRV2_34_127_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9174 19 84 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9006 31 82 3.30.40.10
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8865 18 84 3.30.40.10
af_Q9VVR1_1_121_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8792 17 82 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A4R3DAI5-F1-model_v4 deleted 1.007 29 82
AF-A0A841NYZ2-F1-model_v4 deleted 1.002 35 82
AF-A0A541BA33-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9991 8 113 GO:0008270
AF-A0A1X7MXB8-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9988 7 116 GO:0008270
GO:0016787
AF-A0A4P8PUS0-F1-model_v4 UBP-type domain-containing protein 0.9984 8 114 GO:0008270

Map