F376340

General Info

Members Datasets Scaffolds Average Seq Length
269 165 538 250

Family's Representative Sequence

Representative Sequence 3300035207|Ga0373942_0000026|Ga0373942_0000026_19534_20376
Length 280
Sequence MSARVKFMSPPIKTSGDRLPTVVPVTDSPRPAGNGVVLITGASAGLGEEMARQFAALGYDLALCARRTDRLERLREEIVAGQPGRRVGVRALDVTFDTAVFTVFREFAAEFGRIDRVVVNAGLGKGAPLGTGRWDANRSTALVNFVGALAQAEAALQIFRAQRHGHLVMISSMSALRGMRRSMTTYAATKAGIAALAEGVRSERIPGVDVSVIFPGYIRSEMNEHVRQKTRFMVDTETGVRAMVAAIEKRRTKAYVPVWPWAPIGAALRVLPLSAVRRMV

Samples

Sample ID Description Type Environment
1 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
61 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
72 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
73 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
74 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
75 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
90 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
93 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2643221561 Nocardioides sp. Root151 Isolate Unclassified
157 2643221576 Nocardioides sp. Root614 Isolate Unclassified
158 2643221590 Nocardioides sp. Root682 Isolate Unclassified
159 2643221692 Nocardia sp. Root136 Isolate Unclassified
160 2643221696 Nocardioides sp. Root140 Isolate Unclassified
161 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
162 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
163 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
164 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
165 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 0
Isolates 3.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 20.45
Nodule 0
Rhizoplane 6.32
Rhizosphere 67.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373942_0000026 3300035207 Bacteria 27781
2 LJQas_1004476 3300000549 Bacteria 1818
3 Ga0070658_10487351 3300005327 Bacteria 1064
4 Ga0070683_100062791 3300005329 Bacteria 3454
5 Ga0070683_100070663 3300005329 Bacteria 3257
6 Ga0070674_100320648 3300005356 Bacteria 1242
7 Ga0070667_100037110 3300005367 Bacteria 4086
8 Ga0070700_100037314 3300005441 Bacteria 2954
9 Ga0070708_100193831 3300005445 Bacteria 1901
10 Ga0070663_100407320 3300005455 Bacteria 1113
11 Ga0070678_100449029 3300005456 Bacteria 1129
12 Ga0070662_100400196 3300005457 Bacteria 1133
13 Ga0070707_100064472 3300005468 Bacteria 3518
14 Ga0070698_100001963 3300005471 Bacteria 22848
15 Ga0068855_100061811 3300005563 Bacteria 4375
16 Ga0070664_100050813 3300005564 Bacteria 3510
17 Ga0068856_100026425 3300005614 Bacteria 5661
18 Ga0068870_10109319 3300005840 Bacteria 1576
19 Ga0068870_10117126 3300005840 Bacteria 1529
20 Ga0068860_100282022 3300005843 Bacteria 1624
21 Ga0075365_10009469 3300006038 Bacteria 5602
22 Ga0075365_10030728 3300006038 Bacteria 3443
23 Ga0075365_10047050 3300006038 Bacteria 2834
24 Ga0075365_10204760 3300006038 Bacteria 1383
25 Ga0075365_10268735 3300006038 Bacteria 1199
26 Ga0075368_10006979 3300006042 Bacteria 3972
27 Ga0075368_10082055 3300006042 Bacteria 1313
28 Ga0075363_100014106 3300006048 Bacteria 3894
29 Ga0075363_100015418 3300006048 Bacteria 3756
30 Ga0075363_100033571 3300006048 Bacteria 2673
31 Ga0075363_100038404 3300006048 Bacteria 2518
32 Ga0075363_100095711 3300006048 Bacteria 1638
33 Ga0075363_100099022 3300006048 Bacteria 1612
34 Ga0075363_100141076 3300006048 Bacteria 1357
35 Ga0075364_10002148 3300006051 Bacteria 11043
36 Ga0075364_10038021 3300006051 Bacteria 3118
37 Ga0075362_10014335 3300006177 Bacteria 3196
38 Ga0075362_10064412 3300006177 Bacteria 1663
39 Ga0075367_10027104 3300006178 Bacteria 3256
40 Ga0075367_10281829 3300006178 Bacteria 1045
41 Ga0075370_10002816 3300006353 Bacteria 8154
42 Ga0075370_10011049 3300006353 Bacteria 4734
43 Ga0075370_10136583 3300006353 Bacteria 1433
44 Ga0075370_10163779 3300006353 Bacteria 1306
45 Ga0075370_10198842 3300006353 Bacteria 1182
46 Ga0075370_10268401 3300006353 Bacteria 1013
47 Ga0068865_100699786 3300006881 Bacteria 866
48 Ga0114129_10880162 3300009147 Bacteria 1136
49 Ga0105243_10041325 3300009148 Bacteria 3606
50 Ga0105243_10564371 3300009148 Bacteria 1090
51 Ga0105237_10366701 3300009545 Bacteria 1445
52 Ga0105238_10437301 3300009551 Bacteria 1304
53 Ga0105238_10442199 3300009551 Bacteria 1296
54 Ga0105249_10047603 3300009553 Bacteria 3907
55 Ga0105249_10867311 3300009553 Bacteria 969
56 Ga0105239_10033741 3300010375 Bacteria 5619
57 Ga0105239_10314780 3300010375 Bacteria 1764
58 Ga0157319_1005671 3300012497 Bacteria 868
59 Ga0157369_10496922 3300013105 Bacteria 1262
60 Ga0163162_10365231 3300013306 Bacteria 1576
61 Ga0163163_10149815 3300014325 Bacteria 2377
62 Ga0163163_10549679 3300014325 Bacteria 1217
63 Ga0163163_11021961 3300014325 Bacteria 890
64 Ga0157380_10021793 3300014326 Bacteria 4812
65 Ga0163161_10274855 3300017792 Bacteria 1319
66 Ga0163161_10681674 3300017792 Bacteria 854
67 Ga0213875_10028820 3300021388 Bacteria 2634
68 Ga0207705_10128495 3300025909 Bacteria 1884
69 Ga0207671_10207011 3300025914 Bacteria 1533
70 Ga0207657_10013518 3300025919 Bacteria 8005
71 Ga0207646_10046068 3300025922 Bacteria 3914
72 Ga0207694_10318608 3300025924 Bacteria 1283
73 Ga0207694_10561197 3300025924 Bacteria 959
74 Ga0207659_10522517 3300025926 Bacteria 1007
75 Ga0207687_10467962 3300025927 Bacteria 1048
76 Ga0207706_10076591 3300025933 Bacteria 2942
77 Ga0207661_10061801 3300025944 Bacteria 3028
78 Ga0207667_10009991 3300025949 Bacteria 11130
79 Ga0207712_10091704 3300025961 Bacteria 2239
80 Ga0207658_10027025 3300025986 Bacteria 4029
81 Ga0207678_10205593 3300026067 Bacteria 1684
82 Ga0207708_10033433 3300026075 Bacteria 3907
83 Ga0207674_10442835 3300026116 Bacteria 1256
84 Ga0207698_10550201 3300026142 Bacteria 1131
85 Ga0209813_10005271 3300027866 Bacteria 3129
86 Ga0316182_1368909 3300030745 Bacteria 4453
87 Ga0265327_10000637 3300031251 Bacteria 57211
88 Ga0307408_100178778 3300031548 Bacteria 1700
89 Ga0316575_10010455 3300031665 Bacteria 3412
90 Ga0316575_10071304 3300031665 Bacteria 1396
91 Ga0316579_10027767 3300031691 Bacteria 2572
92 Ga0316578_10004866 3300031728 Bacteria 6418
93 Ga0316578_10018451 3300031728 Bacteria 3824
94 Ga0316578_10027930 3300031728 Bacteria 3192
95 Ga0307405_10059757 3300031731 Bacteria 2403
96 Ga0307405_10073634 3300031731 Bacteria 2206
97 Ga0316577_10038035 3300031733 Bacteria 2690
98 Ga0316577_10067775 3300031733 Bacteria 1992
99 Ga0307413_10164946 3300031824 Bacteria 1561
100 Ga0307413_10193583 3300031824 Bacteria 1462
101 Ga0307406_10023323 3300031901 Bacteria 3680
102 Ga0307412_10104774 3300031911 Bacteria 2008
103 Ga0307409_100162739 3300031995 Bacteria 1954
104 Ga0307416_100001076 3300032002 Bacteria 14591
105 Ga0307416_100083010 3300032002 Bacteria 2717
106 Ga0307416_100302405 3300032002 Bacteria 1591
107 Ga0307416_100343853 3300032002 Bacteria 1506
108 Ga0307415_100001414 3300032126 Bacteria 11469
109 Ga0307415_100862148 3300032126 Bacteria 832
110 Ga0316583_10050170 3300032133 Bacteria 1469
111 Ga0316585_10012975 3300032137 Bacteria 2477
112 Ga0316585_10020724 3300032137 Bacteria 2015
113 Ga0316580_10014351 3300032139 Bacteria 2419
114 Ga0373941_0070863 3300035115 Bacteria 1157
115 Ga0373962_0001264 3300035242 Bacteria 5940
116 Ga0316574_0039589 3300035398 Bacteria 2899
117 Ga0316582_0035231 3300036647 Bacteria 3088
118 Ga0316584_0001137 3300036712 Bacteria 15628
119 Ga0316584_0002023 3300036712 Bacteria 12688
120 Ga0395900_0071806 3300037418 Bacteria 3559
121 Ga0395900_0395802 3300037418 Bacteria 1347
122 Ga0395900_0470343 3300037418 Bacteria 1211
123 Ga0395898_0775114 3300037466 Bacteria 900
124 Ga0316581_0034183 3300037588 Bacteria 1538
125 Ga0436364_1162805 3300037853 Bacteria 1696
126 Ga0436364_1192493 3300037853 Bacteria 4993
127 Ga0395901_0372883 3300038443 Bacteria 1470
128 Ga0242420_008792 3300038996 Bacteria 1646
129 Ga0439466_0072184 3300041411 Bacteria 1098
130 Ga0439465_0031602 3300041413 Bacteria 1687
131 Ga0451833_1254940 3300041491 Bacteria 833
132 Ga0451853_0408630 3300041512 Bacteria 5107
133 Ga0439431_0015002 3300041997 Bacteria 1800
134 Ga0439445_0033420 3300042004 Bacteria 1344
135 Ga0439457_014244 3300042014 Bacteria 1781
136 Ga0450909_013729 3300042185 Bacteria 1192
137 Ga0439464_0030523 3300042439 Bacteria 1509
138 Ga0466972_0085824 3300044658 Bacteria 1496
139 Ga0466972_0117945 3300044658 Bacteria 1252
140 Ga0466972_0185680 3300044658 Bacteria 975
141 Ga0466965_0052970 3300044683 Bacteria 2016
142 Ga0466961_0009717 3300044693 Bacteria 6123
143 Ga0466961_0017465 3300044693 Bacteria 4610
144 Ga0466963_0025721 3300044694 Bacteria 3757
145 Ga0466963_0033118 3300044694 Bacteria 3352
146 Ga0466963_0140048 3300044694 Bacteria 1675
147 Ga0466971_0013286 3300044719 Bacteria 3614
148 Ga0466971_0236794 3300044719 Bacteria 868
149 Ga0466970_0007482 3300044765 Bacteria 5477
150 Ga0466970_0093194 3300044765 Bacteria 1636
151 Ga0466957_0014516 3300044842 Bacteria 4587
152 Ga0466957_0023197 3300044842 Bacteria 3666
153 Ga0466957_0074543 3300044842 Bacteria 2104
154 Ga0466957_0096645 3300044842 Bacteria 1857
155 Ga0466957_0458670 3300044842 Bacteria 879
156 Ga0466960_0028883 3300044901 Bacteria 2541
157 Ga0466960_0059180 3300044901 Bacteria 1873
158 Ga0466960_0289298 3300044901 Bacteria 920
159 Ga0466960_0311247 3300044901 Bacteria 890
160 Ga0466958_0039389 3300045836 Bacteria 2839
161 Ga0466958_0303639 3300045836 Bacteria 1025
162 Ga0466967_0140120 3300045976 Bacteria 2252
163 Ga0466967_0199736 3300045976 Bacteria 1893
164 Ga0466967_0821607 3300045976 Bacteria 923
165 Ga0495664_0179500 3300046477 Bacteria 1284
166 Ga0496100_0068293 3300048903 Bacteria 2363
167 Ga0496101_0278614 3300048904 Bacteria 1307
168 Ga0496102_0109365 3300048905 Bacteria 2575
169 Ga0496105_0087885 3300048908 Bacteria 2568
170 Ga0496107_0125328 3300048910 Bacteria 1894
171 Ga0496108_0055579 3300048911 Bacteria 3324
172 Ga0496108_0518645 3300048911 Bacteria 1040
173 Ga0496109_0077437 3300048912 Bacteria 3060
174 Ga0496109_0113470 3300048912 Bacteria 2520
175 Ga0496110_0184134 3300048913 Bacteria 1896
176 Ga0496111_0021447 3300048914 Bacteria 4511
177 Ga0496112_0064714 3300048915 Bacteria 3609
178 Ga0496113_0059588 3300048916 Bacteria 2876
179 Ga0496114_0028322 3300048917 Bacteria 4596
180 Ga0496114_0042770 3300048917 Bacteria 3755
181 Ga0496114_0070210 3300048917 Bacteria 2942
182 Ga0496114_0073035 3300048917 Bacteria 2886
183 Ga0496124_0275793 3300048927 Bacteria 1229
184 Ga0501031_0006471 3300049568 Bacteria 7638
185 Ga0501032_0022526 3300049569 Bacteria 4366
186 Ga0501032_0069251 3300049569 Bacteria 2355
187 Ga0501036_0009437 3300049572 Bacteria 8024
188 Ga0501036_0054345 3300049572 Bacteria 3392
189 Ga0501036_0474266 3300049572 Bacteria 1042
190 Ga0501036_0499069 3300049572 Bacteria 1013
191 Ga0501037_0017941 3300049573 Bacteria 5209
192 Ga0501037_0178255 3300049573 Bacteria 1508
193 Ga0501038_0001063 3300049574 Bacteria 24793
194 Ga0501039_0027801 3300049575 Bacteria 4349
195 Ga0501039_0048073 3300049575 Bacteria 3298
196 Ga0501039_0304891 3300049575 Bacteria 1252
197 Ga0501040_0126782 3300049576 Bacteria 1793
198 Ga0501041_0004559 3300049577 Bacteria 8039
199 Ga0501041_0099145 3300049577 Bacteria 1802
200 Ga0501042_0033992 3300049578 Bacteria 3616
201 Ga0501043_0010885 3300049579 Bacteria 7122
202 Ga0501046_0082662 3300049580 Bacteria 2480
203 Ga0501047_0005424 3300049581 Bacteria 11996
204 Ga0501048_0001054 3300049582 Bacteria 20657
205 Ga0501048_0306671 3300049582 Bacteria 1130
206 Ga0501067_0012166 3300049583 Bacteria 4771
207 Ga0501067_0026524 3300049583 Bacteria 3209
208 Ga0501067_0371660 3300049583 Bacteria 797
209 Ga0501069_0066397 3300049585 Bacteria 2017
210 Ga0501069_0228167 3300049585 Bacteria 1084
211 Ga0501070_0028750 3300049586 Bacteria 4661
212 Ga0501070_0040836 3300049586 Bacteria 3867
213 Ga0501072_0147841 3300049588 Bacteria 1873
214 Ga0501074_0426666 3300049590 Bacteria 940
215 Ga0501075_0234558 3300049591 Bacteria 1399
216 Ga0501076_0048698 3300049592 Bacteria 3349
217 Ga0501076_0612568 3300049592 Bacteria 898
218 Ga0501077_0100562 3300049593 Bacteria 1832
219 Ga0501079_0213865 3300049741 Bacteria 1506
220 Ga0501079_0439011 3300049741 Bacteria 1025
221 Ga0501081_0472669 3300049743 Bacteria 933
222 Ga0501044_0029318 3300049823 Bacteria 5803
223 Ga0501045_0224447 3300049824 Bacteria 1398
224 nmdc:mga03683_173869_c1 3300050489 Bacteria 980
225 nmdc:mga03n38_12072_c1 3300050490 Bacteria 3239
226 nmdc:mga03n38_237856_c1 3300050490 Bacteria 957
227 nmdc:mga03n38_24005_c1 3300050490 Bacteria 2489
228 nmdc:mga03n38_3102_c1 3300050490 Bacteria 5278
229 nmdc:mga03n38_72511_c1 3300050490 Bacteria 1597
230 nmdc:mga00v17_28122_c1 3300050491 Bacteria 3291
231 nmdc:mga00v17_334550_c1 3300050491 Bacteria 984
232 nmdc:mga00v17_393618_c1 3300050491 Bacteria 900
233 nmdc:mga0yw44_109206_c1 3300050492 Bacteria 1771
234 nmdc:mga0yw44_153821_c1 3300050492 Bacteria 1502
235 nmdc:mga0yw44_172134_c1 3300050492 Bacteria 1422
236 nmdc:mga0yw44_206118_c1 3300050492 Bacteria 1300
237 nmdc:mga0yw44_218028_c1 3300050492 Bacteria 1264
238 nmdc:mga0yw44_27469_c1 3300050492 Bacteria 3260
239 nmdc:mga0yw44_289025_c1 3300050492 Bacteria 1097
240 nmdc:mga0yw44_367140_c1 3300050492 Bacteria 971
241 nmdc:mga0yw44_51716_c1 3300050492 Bacteria 2488
242 nmdc:mga06z11_2123_c1 3300050494 Bacteria 7516
243 nmdc:mga06z11_217892_c1 3300050494 Bacteria 1114
244 nmdc:mga04h51_2203_c1 3300050495 Bacteria 4581
245 nmdc:mga04h51_65438_c1 3300050495 Bacteria 1257
246 nmdc:mga07m45_121696_c1 3300050496 Bacteria 1507
247 nmdc:mga07m45_13724_c1 3300050496 Bacteria 4302
248 nmdc:mga07m45_96631_c1 3300050496 Bacteria 1695
249 Ga0500644_0000115 3300053088 Bacteria 50255
250 Ga0500644_0017940 3300053088 Bacteria 2064
251 Ga0500554_048097 3300053102 Bacteria 1333
252 Ga0501084_0212063 3300054114 Bacteria 1634
253 Ga0501084_0225643 3300054114 Bacteria 1581
254 Ga0501084_0309693 3300054114 Bacteria 1334
255 Ga0590075_007215 3300059424 Bacteria 2639
256 Ga0466962_0030091 3300061719 Bacteria 2599
257 Ga0530510_0022080 3300061734 Bacteria 4531
258 Ga0530510_0030499 3300061734 Bacteria 3873
259 Ga0530510_0100282 3300061734 Bacteria 2117
260 2643824960 2643221561 Bacteria 4984412
261 2643889320 2643221576 Bacteria 5214352
262 2643958375 2643221590 Bacteria 5214697
263 2644515204 2643221692 Bacteria 7282860
264 2644532490 2643221696 Bacteria 5431823
265 2753037708 2751185725 Bacteria 5740550
266 2753325576 2751185792 Bacteria 5739090
267 2984578319 2984576629 Bacteria 4248407
268 2990260798 2990256926 Bacteria 4252839
269 3001890145 3001889506 Bacteria 2975194
270 Ga0373942_0000026
271 LJQas_1004476
272 Ga0070658_10487351
273 Ga0070683_100062791
274 Ga0070683_100070663
275 Ga0070674_100320648
276 Ga0070667_100037110
277 Ga0070700_100037314
278 Ga0070708_100193831
279 Ga0070663_100407320
280 Ga0070678_100449029
281 Ga0070662_100400196
282 Ga0070707_100064472
283 Ga0070698_100001963
284 Ga0068855_100061811
285 Ga0070664_100050813
286 Ga0068856_100026425
287 Ga0068870_10109319
288 Ga0068870_10117126
289 Ga0068860_100282022
290 Ga0075365_10009469
291 Ga0075365_10030728
292 Ga0075365_10047050
293 Ga0075365_10204760
294 Ga0075365_10268735
295 Ga0075368_10006979
296 Ga0075368_10082055
297 Ga0075363_100014106
298 Ga0075363_100015418
299 Ga0075363_100033571
300 Ga0075363_100038404
301 Ga0075363_100095711
302 Ga0075363_100099022
303 Ga0075363_100141076
304 Ga0075364_10002148
305 Ga0075364_10038021
306 Ga0075362_10014335
307 Ga0075362_10064412
308 Ga0075367_10027104
309 Ga0075367_10281829
310 Ga0075370_10002816
311 Ga0075370_10011049
312 Ga0075370_10136583
313 Ga0075370_10163779
314 Ga0075370_10198842
315 Ga0075370_10268401
316 Ga0068865_100699786
317 Ga0114129_10880162
318 Ga0105243_10041325
319 Ga0105243_10564371
320 Ga0105237_10366701
321 Ga0105238_10437301
322 Ga0105238_10442199
323 Ga0105249_10047603
324 Ga0105249_10867311
325 Ga0105239_10033741
326 Ga0105239_10314780
327 Ga0157319_1005671
328 Ga0157369_10496922
329 Ga0163162_10365231
330 Ga0163163_10149815
331 Ga0163163_10549679
332 Ga0163163_11021961
333 Ga0157380_10021793
334 Ga0163161_10274855
335 Ga0163161_10681674
336 Ga0213875_10028820
337 Ga0207705_10128495
338 Ga0207671_10207011
339 Ga0207657_10013518
340 Ga0207646_10046068
341 Ga0207694_10318608
342 Ga0207694_10561197
343 Ga0207659_10522517
344 Ga0207687_10467962
345 Ga0207706_10076591
346 Ga0207661_10061801
347 Ga0207667_10009991
348 Ga0207712_10091704
349 Ga0207658_10027025
350 Ga0207678_10205593
351 Ga0207708_10033433
352 Ga0207674_10442835
353 Ga0207698_10550201
354 Ga0209813_10005271
355 Ga0316182_1368909
356 Ga0265327_10000637
357 Ga0307408_100178778
358 Ga0316575_10010455
359 Ga0316575_10071304
360 Ga0316579_10027767
361 Ga0316578_10004866
362 Ga0316578_10018451
363 Ga0316578_10027930
364 Ga0307405_10059757
365 Ga0307405_10073634
366 Ga0316577_10038035
367 Ga0316577_10067775
368 Ga0307413_10164946
369 Ga0307413_10193583
370 Ga0307406_10023323
371 Ga0307412_10104774
372 Ga0307409_100162739
373 Ga0307416_100001076
374 Ga0307416_100083010
375 Ga0307416_100302405
376 Ga0307416_100343853
377 Ga0307415_100001414
378 Ga0307415_100862148
379 Ga0316583_10050170
380 Ga0316585_10012975
381 Ga0316585_10020724
382 Ga0316580_10014351
383 Ga0373941_0070863
384 Ga0373962_0001264
385 Ga0316574_0039589
386 Ga0316582_0035231
387 Ga0316584_0001137
388 Ga0316584_0002023
389 Ga0395900_0071806
390 Ga0395900_0395802
391 Ga0395900_0470343
392 Ga0395898_0775114
393 Ga0316581_0034183
394 Ga0436364_1162805
395 Ga0436364_1192493
396 Ga0395901_0372883
397 Ga0242420_008792
398 Ga0439466_0072184
399 Ga0439465_0031602
400 Ga0451833_1254940
401 Ga0451853_0408630
402 Ga0439431_0015002
403 Ga0439445_0033420
404 Ga0439457_014244
405 Ga0450909_013729
406 Ga0439464_0030523
407 Ga0466972_0085824
408 Ga0466972_0117945
409 Ga0466972_0185680
410 Ga0466965_0052970
411 Ga0466961_0009717
412 Ga0466961_0017465
413 Ga0466963_0025721
414 Ga0466963_0033118
415 Ga0466963_0140048
416 Ga0466971_0013286
417 Ga0466971_0236794
418 Ga0466970_0007482
419 Ga0466970_0093194
420 Ga0466957_0014516
421 Ga0466957_0023197
422 Ga0466957_0074543
423 Ga0466957_0096645
424 Ga0466957_0458670
425 Ga0466960_0028883
426 Ga0466960_0059180
427 Ga0466960_0289298
428 Ga0466960_0311247
429 Ga0466958_0039389
430 Ga0466958_0303639
431 Ga0466967_0140120
432 Ga0466967_0199736
433 Ga0466967_0821607
434 Ga0495664_0179500
435 Ga0496100_0068293
436 Ga0496101_0278614
437 Ga0496102_0109365
438 Ga0496105_0087885
439 Ga0496107_0125328
440 Ga0496108_0055579
441 Ga0496108_0518645
442 Ga0496109_0077437
443 Ga0496109_0113470
444 Ga0496110_0184134
445 Ga0496111_0021447
446 Ga0496112_0064714
447 Ga0496113_0059588
448 Ga0496114_0028322
449 Ga0496114_0042770
450 Ga0496114_0070210
451 Ga0496114_0073035
452 Ga0496124_0275793
453 Ga0501031_0006471
454 Ga0501032_0022526
455 Ga0501032_0069251
456 Ga0501036_0009437
457 Ga0501036_0054345
458 Ga0501036_0474266
459 Ga0501036_0499069
460 Ga0501037_0017941
461 Ga0501037_0178255
462 Ga0501038_0001063
463 Ga0501039_0027801
464 Ga0501039_0048073
465 Ga0501039_0304891
466 Ga0501040_0126782
467 Ga0501041_0004559
468 Ga0501041_0099145
469 Ga0501042_0033992
470 Ga0501043_0010885
471 Ga0501046_0082662
472 Ga0501047_0005424
473 Ga0501048_0001054
474 Ga0501048_0306671
475 Ga0501067_0012166
476 Ga0501067_0026524
477 Ga0501067_0371660
478 Ga0501069_0066397
479 Ga0501069_0228167
480 Ga0501070_0028750
481 Ga0501070_0040836
482 Ga0501072_0147841
483 Ga0501074_0426666
484 Ga0501075_0234558
485 Ga0501076_0048698
486 Ga0501076_0612568
487 Ga0501077_0100562
488 Ga0501079_0213865
489 Ga0501079_0439011
490 Ga0501081_0472669
491 Ga0501044_0029318
492 Ga0501045_0224447
493 nmdc:mga03683_173869_c1
494 nmdc:mga03n38_12072_c1
495 nmdc:mga03n38_237856_c1
496 nmdc:mga03n38_24005_c1
497 nmdc:mga03n38_3102_c1
498 nmdc:mga03n38_72511_c1
499 nmdc:mga00v17_28122_c1
500 nmdc:mga00v17_334550_c1
501 nmdc:mga00v17_393618_c1
502 nmdc:mga0yw44_109206_c1
503 nmdc:mga0yw44_153821_c1
504 nmdc:mga0yw44_172134_c1
505 nmdc:mga0yw44_206118_c1
506 nmdc:mga0yw44_218028_c1
507 nmdc:mga0yw44_27469_c1
508 nmdc:mga0yw44_289025_c1
509 nmdc:mga0yw44_367140_c1
510 nmdc:mga0yw44_51716_c1
511 nmdc:mga06z11_2123_c1
512 nmdc:mga06z11_217892_c1
513 nmdc:mga04h51_2203_c1
514 nmdc:mga04h51_65438_c1
515 nmdc:mga07m45_121696_c1
516 nmdc:mga07m45_13724_c1
517 nmdc:mga07m45_96631_c1
518 Ga0500644_0000115
519 Ga0500644_0017940
520 Ga0500554_048097
521 Ga0501084_0212063
522 Ga0501084_0225643
523 Ga0501084_0309693
524 Ga0590075_007215
525 Ga0466962_0030091
526 Ga0530510_0022080
527 Ga0530510_0030499
528 Ga0530510_0100282
529 2643824960
530 2643889320
531 2643958375
532 2644515204
533 2644532490
534 2753037708
535 2753325576
536 2984578319
537 2990260798
538 3001890145

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

231

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

249

0.91

PF08659

KR

KR domain

35

214

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9235 6 228
3gdf-assembly1.cif.gz_D crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum. 0.9191 7 202
3f5q-assembly2.cif.gz_A crystal structure of putative short chain dehydrogenase from escherichia coli cft073 0.9102 7 191
4dmm-assembly1.cif.gz_B 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with nadp 0.9101 7 220
4dry-assembly1.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9096 7 229
ID Description Score Start End Superfamily
af_P9WGR7_3_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9753 6 248 3.40.50.720
af_P9WGR7_3_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9409 6 248 3.40.50.720
4e6pC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9236 7 199 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9235 6 228 3.40.50.720
af_O50417_340_587_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9197 6 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F2VQ29-F1-model_v4 deleted 0.9878 6 195
AF-A0A0Q7QVM8-F1-model_v4 Short-chain dehydrogenase 0.9858 6 253 GO:0016020
GO:0016491
AF-I4ZPH6-F1-model_v4 deleted 0.982 6 253
AF-A0A2D1IRY0-F1-model_v4 Short chain dehydrogenase 0.9809 6 253 GO:0016020
GO:0016491
AF-A0A6G8S438-F1-model_v4 SDR family oxidoreductase 0.9807 6 253 GO:0016020
GO:0016491

Map