F376177

General Info

Members Datasets Scaffolds Average Seq Length
269 170 268 127

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11071704|Ga0105245_110717041
Length 132
Sequence VESEKVKDRIQTDRAPQAIGPYSQAVKAGGFVFASGQVAFDPATMQIVDGGIREQTERVMRNLAAVLEAAGSSMERVVKTTVFLADMNEFAAMNEVYGSFFAAEVPPARSTVEVKRLPRDVRVEIDLIALAD

Samples

Sample ID Description Type Environment
1 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.49
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10102616 3300005290 Bacteria 2004
2 Ga0065707_10015825 3300005295 Bacteria 1640
3 Ga0070658_10659142 3300005327 Unclassified 908
4 Ga0070676_10002684 3300005328 Bacteria 9161
5 Ga0070690_100608549 3300005330 Bacteria 830
6 Ga0070670_100450777 3300005331 Bacteria 1140
7 Ga0070677_10111009 3300005333 Bacteria 1224
8 Ga0068869_100306577 3300005334 Bacteria 1284
9 Ga0070689_100108759 3300005340 Bacteria 2203
10 Ga0070692_10383149 3300005345 Bacteria 883
11 Ga0070669_100227993 3300005353 Bacteria 1475
12 Ga0070669_100403034 3300005353 Bacteria 1119
13 Ga0070675_100050654 3300005354 Bacteria 3410
14 Ga0070675_100904989 3300005354 Bacteria 809
15 Ga0070671_101077972 3300005355 Bacteria 705
16 Ga0070688_101055378 3300005365 Bacteria 648
17 Ga0070703_10000199 3300005406 Bacteria 29026
18 Ga0070703_10195058 3300005406 Bacteria 791
19 Ga0070709_10000043 3300005434 Bacteria 101915
20 Ga0070709_10227249 3300005434 Unclassified 1334
21 Ga0070701_10124480 3300005438 Unclassified 1457
22 Ga0070694_100167568 3300005444 Bacteria 1616
23 Ga0070708_100105786 3300005445 Bacteria 2582
24 Ga0070708_100552012 3300005445 Unclassified 1087
25 Ga0070708_101305406 3300005445 Unclassified 678
26 Ga0068867_100347799 3300005459 Bacteria 1236
27 Ga0068867_102133478 3300005459 Unclassified 531
28 Ga0070707_100000554 3300005468 Bacteria 37509
29 Ga0070707_100020078 3300005468 Bacteria 6301
30 Ga0070699_100006643 3300005518 Bacteria 10055
31 Ga0070686_100093215 3300005544 Bacteria 2019
32 Ga0070686_100100192 3300005544 Unclassified 1956
33 Ga0070696_100169134 3300005546 Bacteria 1615
34 Ga0070704_100004227 3300005549 Bacteria 8294
35 Ga0070704_100109949 3300005549 Bacteria 2095
36 Ga0070704_100177128 3300005549 Unclassified 1702
37 Ga0070704_101287031 3300005549 Bacteria 669
38 Ga0070704_101350420 3300005549 Archaea 653
39 Ga0068857_100041337 3300005577 Bacteria 4088
40 Ga0068854_101742902 3300005578 Bacteria 570
41 Ga0068856_101802203 3300005614 Bacteria 624
42 Ga0070702_100536043 3300005615 Unclassified 866
43 Ga0068859_100080921 3300005617 Bacteria 3290
44 Ga0068859_100190758 3300005617 Bacteria 2134
45 Ga0068859_102697606 3300005617 Bacteria 546
46 Ga0068864_100253408 3300005618 Unclassified 1635
47 Ga0068866_10410949 3300005718 Bacteria 875
48 Ga0068861_100816075 3300005719 Bacteria 877
49 Ga0068863_100276539 3300005841 Bacteria 1626
50 Ga0068858_100149838 3300005842 Bacteria 2193
51 Ga0068860_100241603 3300005843 Bacteria 1757
52 Ga0068860_101082459 3300005843 Bacteria 821
53 Ga0068860_101635198 3300005843 Bacteria 666
54 Ga0068862_100015082 3300005844 Bacteria 6421
55 Ga0068862_100837416 3300005844 Bacteria 901
56 Ga0068862_101124127 3300005844 Bacteria 781
57 Ga0068862_101352268 3300005844 Bacteria 715
58 Ga0081455_10014082 3300005937 Bacteria 7861
59 Ga0081455_10048678 3300005937 Bacteria 3661
60 Ga0075432_10519544 3300006058 Unclassified 533
61 Ga0070715_10729210 3300006163 Unclassified 595
62 Ga0070716_100101499 3300006173 Unclassified 1765
63 Ga0070712_101712309 3300006175 Unclassified 550
64 Ga0097621_100079593 3300006237 Bacteria 2725
65 Ga0097621_100715222 3300006237 Bacteria 923
66 Ga0068871_100029292 3300006358 Bacteria 4322
67 Ga0068871_101400267 3300006358 Bacteria 659
68 Ga0075428_100278605 3300006844 Unclassified 1799
69 Ga0075428_101071929 3300006844 Bacteria 852
70 Ga0075428_101431441 3300006844 Bacteria 725
71 Ga0075428_101654145 3300006844 Bacteria 669
72 Ga0075430_100228326 3300006846 Bacteria 1544
73 Ga0075431_100078290 3300006847 Bacteria 3412
74 Ga0075431_100565380 3300006847 Bacteria 1123
75 Ga0075431_101289570 3300006847 Bacteria 691
76 Ga0075433_10160583 3300006852 Unclassified 2000
77 Ga0075433_10381858 3300006852 Bacteria 1244
78 Ga0075434_100069918 3300006871 Bacteria 3500
79 Ga0075434_100938180 3300006871 Bacteria 880
80 Ga0075429_101086935 3300006880 Bacteria 699
81 Ga0075429_101521675 3300006880 Bacteria 582
82 Ga0068865_100229651 3300006881 Unclassified 1455
83 Ga0075436_101169621 3300006914 Unclassified 580
84 Ga0097620_100080919 3300006931 Bacteria 3290
85 Ga0097620_100190771 3300006931 Bacteria 2134
86 Ga0097620_102695969 3300006931 Bacteria 546
87 Ga0075435_100552121 3300007076 Unclassified 998
88 Ga0075435_100754431 3300007076 Bacteria 847
89 Ga0111539_10001130 3300009094 Bacteria 35291
90 Ga0111539_10003150 3300009094 Bacteria 21825
91 Ga0111539_10042603 3300009094 Bacteria 5449
92 Ga0111539_10158140 3300009094 Bacteria 2651
93 Ga0111539_10710872 3300009094 Bacteria 1170
94 Ga0111539_10807796 3300009094 Bacteria 1091
95 Ga0105245_11071704 3300009098 Unclassified 852
96 Ga0105245_11888699 3300009098 Bacteria 650
97 Ga0114129_10798835 3300009147 Bacteria 1204
98 Ga0114129_10972165 3300009147 Bacteria 1071
99 Ga0114129_12254847 3300009147 Bacteria 654
100 Ga0105243_12377550 3300009148 Bacteria 568
101 Ga0105242_10382191 3300009176 Bacteria 1309
102 Ga0105242_10688414 3300009176 Bacteria 999
103 Ga0105248_10015265 3300009177 Bacteria 8467
104 Ga0105248_10128526 3300009177 Bacteria 2859
105 Ga0105248_10224813 3300009177 Bacteria 2113
106 Ga0105248_10338909 3300009177 Bacteria 1693
107 Ga0105249_10224298 3300009553 Unclassified 1851
108 Ga0105249_12055295 3300009553 Bacteria 644
109 Ga0105246_10381241 3300011119 Bacteria 1165
110 Ga0157378_11212380 3300013297 Unclassified 794
111 Ga0163162_10011041 3300013306 Bacteria 8800
112 Ga0157375_10933887 3300013308 Bacteria 1010
113 Ga0157375_11275401 3300013308 Bacteria 863
114 Ga0157375_12958563 3300013308 Bacteria 567
115 Ga0163163_10000186 3300014325 Bacteria 63710
116 Ga0163163_11010259 3300014325 Bacteria 895
117 Ga0157380_10031890 3300014326 Bacteria 4048
118 Ga0157380_10113433 3300014326 Bacteria 2282
119 Ga0157380_10126601 3300014326 Bacteria 2172
120 Ga0157380_10356530 3300014326 Unclassified 1371
121 Ga0157380_10437112 3300014326 Bacteria 1253
122 Ga0157380_10472085 3300014326 Bacteria 1211
123 Ga0157380_10912195 3300014326 Bacteria 905
124 Ga0157380_11045861 3300014326 Bacteria 852
125 Ga0157380_11657162 3300014326 Unclassified 696
126 Ga0157379_10813691 3300014968 Bacteria 882
127 Ga0157376_10051021 3300014969 Bacteria 3435
128 Ga0157376_10597231 3300014969 Bacteria 1098
129 Ga0157376_11331039 3300014969 Bacteria 749
130 Ga0163161_10272736 3300017792 Bacteria 1324
131 Ga0207653_10069692 3300025885 Bacteria 1200
132 Ga0207642_10598483 3300025899 Bacteria 686
133 Ga0207699_10000013 3300025906 Bacteria 261480
134 Ga0207643_10735944 3300025908 Bacteria 638
135 Ga0207705_10413220 3300025909 Bacteria 1044
136 Ga0207663_10386576 3300025916 Unclassified 1067
137 Ga0207662_10724838 3300025918 Bacteria 698
138 Ga0207646_10000937 3300025922 Bacteria 37490
139 Ga0207681_10854807 3300025923 Unclassified 761
140 Ga0207650_10393485 3300025925 Bacteria 1146
141 Ga0207650_10662608 3300025925 Unclassified 880
142 Ga0207659_10123168 3300025926 Bacteria 1990
143 Ga0207659_11382788 3300025926 Bacteria 604
144 Ga0207700_11203679 3300025928 Unclassified 676
145 Ga0207664_10059652 3300025929 Bacteria 3039
146 Ga0207664_10925995 3300025929 Bacteria 782
147 Ga0207670_10054566 3300025936 Bacteria 2697
148 Ga0207670_10197386 3300025936 Unclassified 1526
149 Ga0207704_10050459 3300025938 Bacteria 2510
150 Ga0207665_10251259 3300025939 Bacteria 1307
151 Ga0207711_10027096 3300025941 Bacteria 4812
152 Ga0207711_10445403 3300025941 Bacteria 1205
153 Ga0207711_10557862 3300025941 Bacteria 1068
154 Ga0207712_10142103 3300025961 Bacteria 1843
155 Ga0207640_11119263 3300025981 Bacteria 697
156 Ga0207677_11319266 3300026023 Bacteria 663
157 Ga0207703_10830178 3300026035 Bacteria 883
158 Ga0207702_11250402 3300026078 Bacteria 737
159 Ga0207676_10465207 3300026095 Bacteria 1195
160 Ga0207674_10013388 3300026116 Bacteria 9105
161 Ga0207674_11145728 3300026116 Bacteria 747
162 Ga0207683_11046211 3300026121 Bacteria 758
163 Ga0207428_10001713 3300027907 Bacteria 22495
164 Ga0207428_10004217 3300027907 Bacteria 13761
165 Ga0207428_10061223 3300027907 Bacteria 2981
166 Ga0207428_10067023 3300027907 Unclassified 2827
167 Ga0268265_10123892 3300028380 Bacteria 2135
168 Ga0268265_11023075 3300028380 Bacteria 817
169 Ga0268265_11133945 3300028380 Bacteria 777
170 Ga0268264_11484976 3300028381 Bacteria 688
171 Ga0265332_10047858 3300031238 Bacteria 1840
172 Ga0265327_10240290 3300031251 Bacteria 809
173 Ga0307513_10428607 3300031456 Bacteria 1051
174 Ga0307405_10162387 3300031731 Unclassified 1584
175 Ga0307413_11983749 3300031824 Bacteria 524
176 Ga0307406_11982740 3300031901 Bacteria 520
177 Ga0307412_10074632 3300031911 Bacteria 2324
178 Ga0307412_11305491 3300031911 Bacteria 653
179 Ga0307409_102646012 3300031995 Bacteria 530
180 Ga0307416_100676425 3300032002 Bacteria 1119
181 Ga0307414_10641231 3300032004 Bacteria 957
182 Ga0316212_1000751 3300033547 Bacteria 4121
183 Ga0373958_0170502 3300034819 Unclassified 555
184 Ga0373929_0195564 3300035085 Unclassified 564
185 Ga0373934_0001705 3300035086 Bacteria 8073
186 Ga0373953_0377565 3300035117 Bacteria 623
187 Ga0373954_0271070 3300035118 Bacteria 836
188 Ga0373956_0059936 3300035119 Bacteria 1722
189 Ga0373957_0006998 3300035120 Bacteria 3586
190 Ga0373955_0005885 3300035172 Bacteria 5544
191 Ga0373933_0012800 3300035724 Bacteria 4638
192 Ga0373937_0000914 3300036401 Bacteria 25114
193 Ga0373937_1693621 3300036401 Unclassified 579
194 Ga0450923_107671 3300042125 Bacteria 648
195 Ga0451577_0004506 3300042876 Bacteria 14676
196 Ga0451577_0242752 3300042876 Bacteria 1630
197 Ga0466969_0206555 3300044656 Bacteria 895
198 Ga0453683_0112584 3300044673 Bacteria 1712
199 Ga0453684_0000117 3300044712 Bacteria 348119
200 Ga0453684_0118087 3300044712 Bacteria 3209
201 Ga0451576_0015920 3300045051 Bacteria 8314
202 Ga0451576_1096767 3300045051 Bacteria 833
203 Ga0495592_0138527 3300046454 Unclassified 1695
204 Ga0495592_0338784 3300046454 Unclassified 967
205 Ga0495603_0015320 3300046455 Bacteria 4639
206 Ga0495638_0423081 3300046460 Unclassified 686
207 Ga0495651_0726858 3300046462 Bacteria 617
208 Ga0495594_0304700 3300046499 Bacteria 907
209 Ga0495628_0229493 3300046516 Bacteria 1392
210 Ga0495628_0394926 3300046516 Unclassified 1011
211 Ga0495586_0485389 3300046535 Unclassified 713
212 Ga0495621_0427218 3300046539 Bacteria 565
213 Ga0495645_0045998 3300046543 Bacteria 3183
214 Ga0495599_0106699 3300046678 Unclassified 1745
215 Ga0495599_0212065 3300046678 Bacteria 1187
216 Ga0495636_0043793 3300047318 Bacteria 1863
217 Ga0495674_0804724 3300047319 Unclassified 731
218 Ga0495680_0131937 3300047322 Bacteria 1835
219 Ga0495680_0480550 3300047322 Bacteria 846
220 Ga0495684_0439734 3300047471 Bacteria 908
221 Ga0496102_0802107 3300048905 Bacteria 864
222 Ga0496109_0000051 3300048912 Bacteria 126695
223 Ga0496110_0163143 3300048913 Bacteria 2020
224 Ga0496114_0906399 3300048917 Bacteria 763
225 Ga0501036_0808806 3300049572 Unclassified 772
226 Ga0501040_0049341 3300049576 Unclassified 2878
227 Ga0501041_0077144 3300049577 Unclassified 2050
228 Ga0501041_0803973 3300049577 Unclassified 603
229 Ga0501046_0302593 3300049580 Unclassified 1168
230 Ga0501048_0346421 3300049582 Bacteria 1059
231 Ga0501070_0672156 3300049586 Bacteria 821
232 Ga0501072_0079936 3300049588 Unclassified 2590
233 Ga0501074_0180920 3300049590 Bacteria 1504
234 Ga0501076_0203449 3300049592 Bacteria 1617
235 Ga0501079_0048654 3300049741 Bacteria 3272
236 Ga0501079_0138677 3300049741 Bacteria 1894
237 Ga0501045_0073989 3300049824 Unclassified 2509
238 nmdc:mga05p37_152843_c1 3300050507 Bacteria 2822
239 nmdc:mga05p37_270006_c1 3300050507 Bacteria 2033
240 nmdc:mga09592_866309_c1 3300050508 Bacteria 761
241 nmdc:mga0qj67_333516_c1 3300050509 Bacteria 1227
242 nmdc:mga06r32_320041_c1 3300050510 Bacteria 1537
243 nmdc:mga06r32_47141_c1 3300050510 Bacteria 4115
244 nmdc:mga06r32_6209_c1 3300050510 Bacteria 10722
245 nmdc:mga06r32_79869_c1 3300050510 Bacteria 3182
246 nmdc:mga06r32_880588_c1 3300050510 Bacteria 853
247 nmdc:mga08y16_1344_c1 3300050511 Bacteria 24537
248 nmdc:mga08y16_635912_c1 3300050511 Bacteria 1073
249 nmdc:mga08y16_8494_c1 3300050511 Bacteria 10754
250 nmdc:mga08y16_864290_c1 3300050511 Unclassified 893
251 nmdc:mga08y16_8976_c1 3300050511 Bacteria 10502
252 nmdc:mga0n895_933941_c1 3300050512 Bacteria 852
253 nmdc:mga0rr50_313383_c1 3300050513 Bacteria 1314
254 nmdc:mga0rr50_404581_c1 3300050513 Bacteria 1153
255 nmdc:mga08x19_972520_c1 3300050514 Unclassified 603
256 nmdc:mga0a205_12802_c1 3300050515 Bacteria 7779
257 nmdc:mga0a205_74296_c1 3300050515 Bacteria 3285
258 Ga0495601_0394820 3300053077 Unclassified 897
259 Ga0495595_0551583 3300053084 Bacteria 588
260 Ga0495595_0733130 3300053084 Unclassified 507
261 Ga0495619_0770089 3300053085 Unclassified 652
262 Ga0501084_0020249 3300054114 Bacteria 5546
263 Ga0501084_0032611 3300054114 Bacteria 4357
264 Ga0501084_0620916 3300054114 Unclassified 913
265 Ga0501082_0011625 3300060353 Bacteria 7568
266 Ga0501082_0765241 3300060353 Unclassified 845
267 Ga0501082_0966852 3300060353 Unclassified 745
268 Ga0530510_0006287 3300061734 Bacteria 8266

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2919414237 2919418537 121
2 3300005353 Ga0070669_100403034 Ga0070669_1004030343 124
3 3300005468 Ga0070707_100000554 Ga0070707_10000055411 124
4 3300005518 Ga0070699_100006643 Ga0070699_1000066433 124
5 3300005617 Ga0068859_102697606 Ga0068859_1026976061 124
6 3300005844 Ga0068862_101124127 Ga0068862_1011241271 124
7 3300005937 Ga0081455_10014082 Ga0081455_100140821 124
8 3300005937 Ga0081455_10048678 Ga0081455_100486783 124
9 3300006058 Ga0075432_10519544 Ga0075432_105195441 124
10 3300006844 Ga0075428_100278605 Ga0075428_1002786052 124
11 3300006844 Ga0075428_101654145 Ga0075428_1016541452 124
12 3300006847 Ga0075431_100078290 Ga0075431_1000782902 124
13 3300006847 Ga0075431_101289570 Ga0075431_1012895702 124
14 3300006852 Ga0075433_10381858 Ga0075433_103818582 124
15 3300006871 Ga0075434_100069918 Ga0075434_1000699182 124
16 3300006880 Ga0075429_101086935 Ga0075429_1010869352 124
17 3300006914 Ga0075436_101169621 Ga0075436_1011696211 124
18 3300006931 Ga0097620_102695969 Ga0097620_1026959691 124
19 3300007076 Ga0075435_100754431 Ga0075435_1007544312 124
20 3300009094 Ga0111539_10158140 Ga0111539_101581403 124
21 3300009147 Ga0114129_10798835 Ga0114129_107988352 124
22 3300009147 Ga0114129_12254847 Ga0114129_122548472 124
23 3300009148 Ga0105243_12377550 Ga0105243_123775501 124
24 3300009177 Ga0105248_10338909 Ga0105248_103389091 124
25 3300009553 Ga0105249_12055295 Ga0105249_120552951 124
26 3300013308 Ga0157375_11275401 Ga0157375_112754012 124
27 3300014326 Ga0157380_11045861 Ga0157380_110458611 124
28 3300014326 Ga0157380_11657162 Ga0157380_116571622 124
29 3300014968 Ga0157379_10813691 Ga0157379_108136911 124
30 3300025922 Ga0207646_10000937 Ga0207646_1000093711 124
31 3300025941 Ga0207711_10445403 Ga0207711_104454032 124
32 3300027907 Ga0207428_10004217 Ga0207428_100042175 124
33 3300031238 Ga0265332_10047858 Ga0265332_100478581 124
34 3300031251 Ga0265327_10240290 Ga0265327_102402902 124
35 3300031911 Ga0307412_11305491 Ga0307412_113054912 124
36 3300031995 Ga0307409_102646012 Ga0307409_1026460121 124
37 3300042125 Ga0450923_107671 Ga0450923_107671_140_514 124
38 3300044712 Ga0453684_0118087 Ga0453684_0118087_1285_1665 124
39 3300048912 Ga0496109_0000051 Ga0496109_0000051_60458_60832 124
40 3300049572 Ga0501036_0808806 Ga0501036_0808806_157_531 124
41 3300049577 Ga0501041_0803973 Ga0501041_0803973_162_536 124
42 3300049580 Ga0501046_0302593 Ga0501046_0302593_472_846 124
43 3300050507 nmdc:mga05p37_152843_c1 nmdc:mga05p37_152843_c1_953_1327 124
44 3300050507 nmdc:mga05p37_270006_c1 nmdc:mga05p37_270006_c1_184_558 124
45 3300050510 nmdc:mga06r32_320041_c1 nmdc:mga06r32_320041_c1_135_509 124
46 3300050510 nmdc:mga06r32_47141_c1 nmdc:mga06r32_47141_c1_1220_1594 124
47 3300050510 nmdc:mga06r32_6209_c1 nmdc:mga06r32_6209_c1_422_796 124
48 3300050510 nmdc:mga06r32_880588_c1 nmdc:mga06r32_880588_c1_285_659 124
49 3300050511 nmdc:mga08y16_8976_c1 nmdc:mga08y16_8976_c1_2107_2481 124
50 3300050512 nmdc:mga0n895_933941_c1 nmdc:mga0n895_933941_c1_113_487 124
51 3300050513 nmdc:mga0rr50_313383_c1 nmdc:mga0rr50_313383_c1_231_605 124
52 3300050514 nmdc:mga08x19_972520_c1 nmdc:mga08x19_972520_c1_147_521 124
53 3300050515 nmdc:mga0a205_74296_c1 nmdc:mga0a205_74296_c1_641_1015 124
54 3300054114 Ga0501084_0032611 Ga0501084_0032611_3665_4039 124
55 3300060353 Ga0501082_0966852 Ga0501082_0966852_82_456 124
56 3300005328 Ga0070676_10002684 Ga0070676_100026845 125
57 3300005330 Ga0070690_100608549 Ga0070690_1006085491 125
58 3300005345 Ga0070692_10383149 Ga0070692_103831492 125
59 3300005406 Ga0070703_10195058 Ga0070703_101950582 125
60 3300005434 Ga0070709_10227249 Ga0070709_102272491 125
61 3300005438 Ga0070701_10124480 Ga0070701_101244803 125
62 3300005444 Ga0070694_100167568 Ga0070694_1001675683 125
63 3300005459 Ga0068867_100347799 Ga0068867_1003477991 125
64 3300005468 Ga0070707_100020078 Ga0070707_1000200782 125
65 3300005544 Ga0070686_100100192 Ga0070686_1001001922 125
66 3300005546 Ga0070696_100169134 Ga0070696_1001691342 125
67 3300005549 Ga0070704_100109949 Ga0070704_1001099492 125
68 3300005549 Ga0070704_100177128 Ga0070704_1001771282 125
69 3300005549 Ga0070704_101287031 Ga0070704_1012870312 125
70 3300005577 Ga0068857_100041337 Ga0068857_1000413374 125
71 3300005617 Ga0068859_100190758 Ga0068859_1001907584 125
72 3300005843 Ga0068860_100241603 Ga0068860_1002416032 125
73 3300005843 Ga0068860_101635198 Ga0068860_1016351981 125
74 3300005844 Ga0068862_100015082 Ga0068862_1000150822 125
75 3300005844 Ga0068862_100837416 Ga0068862_1008374161 125
76 3300005844 Ga0068862_101352268 Ga0068862_1013522682 125
77 3300006852 Ga0075433_10160583 Ga0075433_101605831 125
78 3300006871 Ga0075434_100938180 Ga0075434_1009381802 125
79 3300006880 Ga0075429_101521675 Ga0075429_1015216751 125
80 3300006931 Ga0097620_100190771 Ga0097620_1001907714 125
81 3300007076 Ga0075435_100552121 Ga0075435_1005521212 125
82 3300009094 Ga0111539_10001130 Ga0111539_1000113015 125
83 3300009147 Ga0114129_10972165 Ga0114129_109721653 125
84 3300009553 Ga0105249_10224298 Ga0105249_102242982 125
85 3300011119 Ga0105246_10381241 Ga0105246_103812412 125
86 3300014326 Ga0157380_10031890 Ga0157380_100318903 125
87 3300014326 Ga0157380_10356530 Ga0157380_103565302 125
88 3300014326 Ga0157380_10437112 Ga0157380_104371122 125
89 3300014326 Ga0157380_10912195 Ga0157380_109121951 125
90 3300025885 Ga0207653_10069692 Ga0207653_100696922 125
91 3300025908 Ga0207643_10735944 Ga0207643_107359441 125
92 3300025916 Ga0207663_10386576 Ga0207663_103865762 125
93 3300025926 Ga0207659_11382788 Ga0207659_113827881 125
94 3300025928 Ga0207700_11203679 Ga0207700_112036791 125
95 3300025929 Ga0207664_10059652 Ga0207664_100596524 125
96 3300025936 Ga0207670_10197386 Ga0207670_101973863 125
97 3300025961 Ga0207712_10142103 Ga0207712_101421032 125
98 3300026116 Ga0207674_10013388 Ga0207674_100133883 125
99 3300027907 Ga0207428_10067023 Ga0207428_100670232 125
100 3300028380 Ga0268265_10123892 Ga0268265_101238924 125
101 3300028380 Ga0268265_11023075 Ga0268265_110230752 125
102 3300028381 Ga0268264_11484976 Ga0268264_114849761 125
103 3300033547 Ga0316212_1000751 Ga0316212_10007514 125
104 3300042876 Ga0451577_0242752 Ga0451577_0242752_1059_1439 125
105 3300044673 Ga0453683_0112584 Ga0453683_0112584_1058_1441 125
106 3300045051 Ga0451576_1096767 Ga0451576_1096767_253_633 125
107 3300046455 Ga0495603_0015320 Ga0495603_0015320_1894_2277 125
108 3300046499 Ga0495594_0304700 Ga0495594_0304700_319_702 125
109 3300047318 Ga0495636_0043793 Ga0495636_0043793_984_1367 125
110 3300050511 nmdc:mga08y16_1344_c1 nmdc:mga08y16_1344_c1_11535_11933 125
111 3300050513 nmdc:mga0rr50_404581_c1 nmdc:mga0rr50_404581_c1_357_734 125
112 3300050515 nmdc:mga0a205_12802_c1 nmdc:mga0a205_12802_c1_5902_6300 125
113 3300054114 Ga0501084_0620916 Ga0501084_0620916_386_763 125
114 3300005295 Ga0065707_10015825 Ga0065707_100158252 126
115 3300005327 Ga0070658_10659142 Ga0070658_106591422 126
116 3300005331 Ga0070670_100450777 Ga0070670_1004507772 126
117 3300005353 Ga0070669_100227993 Ga0070669_1002279931 126
118 3300005365 Ga0070688_101055378 Ga0070688_1010553782 126
119 3300005445 Ga0070708_100552012 Ga0070708_1005520122 126
120 3300005445 Ga0070708_101305406 Ga0070708_1013054061 126
121 3300005459 Ga0068867_102133478 Ga0068867_1021334781 126
122 3300005549 Ga0070704_101350420 Ga0070704_1013504202 126
123 3300005578 Ga0068854_101742902 Ga0068854_1017429022 126
124 3300005614 Ga0068856_101802203 Ga0068856_1018022032 126
125 3300005615 Ga0070702_100536043 Ga0070702_1005360432 126
126 3300005618 Ga0068864_100253408 Ga0068864_1002534081 126
127 3300005718 Ga0068866_10410949 Ga0068866_104109491 126
128 3300005842 Ga0068858_100149838 Ga0068858_1001498385 126
129 3300005843 Ga0068860_101082459 Ga0068860_1010824591 126
130 3300006237 Ga0097621_100079593 Ga0097621_1000795933 126
131 3300006237 Ga0097621_100715222 Ga0097621_1007152221 126
132 3300006358 Ga0068871_100029292 Ga0068871_1000292921 126
133 3300006358 Ga0068871_101400267 Ga0068871_1014002671 126
134 3300006844 Ga0075428_101071929 Ga0075428_1010719291 126
135 3300006846 Ga0075430_100228326 Ga0075430_1002283262 126
136 3300006847 Ga0075431_100565380 Ga0075431_1005653802 126
137 3300006881 Ga0068865_100229651 Ga0068865_1002296511 126
138 3300009094 Ga0111539_10807796 Ga0111539_108077962 126
139 3300009098 Ga0105245_11071704 Ga0105245_110717041 126
140 3300009098 Ga0105245_11888699 Ga0105245_118886992 126
141 3300009176 Ga0105242_10688414 Ga0105242_106884142 126
142 3300013308 Ga0157375_12958563 Ga0157375_129585631 126
143 3300014325 Ga0163163_10000186 Ga0163163_1000018658 126
144 3300014326 Ga0157380_10113433 Ga0157380_101134334 126
145 3300014326 Ga0157380_10472085 Ga0157380_104720852 126
146 3300014969 Ga0157376_10597231 Ga0157376_105972312 126
147 3300014969 Ga0157376_11331039 Ga0157376_113310392 126
148 3300017792 Ga0163161_10272736 Ga0163161_102727362 126
149 3300025899 Ga0207642_10598483 Ga0207642_105984832 126
150 3300025909 Ga0207705_10413220 Ga0207705_104132202 126
151 3300025925 Ga0207650_10393485 Ga0207650_103934852 126
152 3300025981 Ga0207640_11119263 Ga0207640_111192632 126
153 3300026035 Ga0207703_10830178 Ga0207703_108301782 126
154 3300026078 Ga0207702_11250402 Ga0207702_112504022 126
155 3300026095 Ga0207676_10465207 Ga0207676_104652071 126
156 3300026116 Ga0207674_11145728 Ga0207674_111457282 126
157 3300026121 Ga0207683_11046211 Ga0207683_110462112 126
158 3300028380 Ga0268265_11133945 Ga0268265_111339452 126
159 3300031731 Ga0307405_10162387 Ga0307405_101623871 126
160 3300031824 Ga0307413_11983749 Ga0307413_119837491 126
161 3300031901 Ga0307406_11982740 Ga0307406_119827401 126
162 3300031911 Ga0307412_10074632 Ga0307412_100746322 126
163 3300032002 Ga0307416_100676425 Ga0307416_1006764252 126
164 3300035086 Ga0373934_0001705 Ga0373934_0001705_4065_4445 126
165 3300035117 Ga0373953_0377565 Ga0373953_0377565_123_503 126
166 3300035118 Ga0373954_0271070 Ga0373954_0271070_108_488 126
167 3300035119 Ga0373956_0059936 Ga0373956_0059936_113_493 126
168 3300035120 Ga0373957_0006998 Ga0373957_0006998_776_1156 126
169 3300035172 Ga0373955_0005885 Ga0373955_0005885_3875_4255 126
170 3300035724 Ga0373933_0012800 Ga0373933_0012800_4137_4517 126
171 3300036401 Ga0373937_0000914 Ga0373937_0000914_4064_4444 126
172 3300042876 Ga0451577_0004506 Ga0451577_0004506_12727_13119 126
173 3300044712 Ga0453684_0000117 Ga0453684_0000117_48191_48583 126
174 3300045051 Ga0451576_0015920 Ga0451576_0015920_4090_4473 126
175 3300046462 Ga0495651_0726858 Ga0495651_0726858_49_429 126
176 3300046539 Ga0495621_0427218 Ga0495621_0427218_36_422 126
177 3300047322 Ga0495680_0131937 Ga0495680_0131937_748_1128 126
178 3300048905 Ga0496102_0802107 Ga0496102_0802107_168_551 126
179 3300048913 Ga0496110_0163143 Ga0496110_0163143_570_953 126
180 3300048917 Ga0496114_0906399 Ga0496114_0906399_244_627 126
181 3300049576 Ga0501040_0049341 Ga0501040_0049341_1910_2290 126
182 3300049577 Ga0501041_0077144 Ga0501041_0077144_790_1170 126
183 3300049582 Ga0501048_0346421 Ga0501048_0346421_632_1012 126
184 3300049586 Ga0501070_0672156 Ga0501070_0672156_263_646 126
185 3300049588 Ga0501072_0079936 Ga0501072_0079936_776_1156 126
186 3300049590 Ga0501074_0180920 Ga0501074_0180920_1038_1418 126
187 3300049592 Ga0501076_0203449 Ga0501076_0203449_614_994 126
188 3300049741 Ga0501079_0048654 Ga0501079_0048654_2813_3193 126
189 3300049824 Ga0501045_0073989 Ga0501045_0073989_1682_2062 126
190 3300050508 nmdc:mga09592_866309_c1 nmdc:mga09592_866309_c1_50_430 126
191 3300050509 nmdc:mga0qj67_333516_c1 nmdc:mga0qj67_333516_c1_764_1144 126
192 3300050510 nmdc:mga06r32_79869_c1 nmdc:mga06r32_79869_c1_2327_2707 126
193 3300053077 Ga0495601_0394820 Ga0495601_0394820_458_841 126
194 3300053084 Ga0495595_0551583 Ga0495595_0551583_86_466 126
195 3300053084 Ga0495595_0733130 Ga0495595_0733130_98_484 126
196 3300053085 Ga0495619_0770089 Ga0495619_0770089_43_429 126
197 3300054114 Ga0501084_0020249 Ga0501084_0020249_3693_4073 126
198 3300060353 Ga0501082_0011625 Ga0501082_0011625_4102_4482 126
199 3300060353 Ga0501082_0765241 Ga0501082_0765241_340_720 126
200 3300061734 Ga0530510_0006287 Ga0530510_0006287_5252_5635 126
201 3300005290 Ga0065712_10102616 Ga0065712_101026162 127
202 3300005333 Ga0070677_10111009 Ga0070677_101110093 127
203 3300005334 Ga0068869_100306577 Ga0068869_1003065771 127
204 3300005340 Ga0070689_100108759 Ga0070689_1001087594 127
205 3300005354 Ga0070675_100050654 Ga0070675_1000506542 127
206 3300005354 Ga0070675_100904989 Ga0070675_1009049892 127
207 3300005355 Ga0070671_101077972 Ga0070671_1010779721 127
208 3300005406 Ga0070703_10000199 Ga0070703_100001993 127
209 3300005434 Ga0070709_10000043 Ga0070709_1000004391 127
210 3300005445 Ga0070708_100105786 Ga0070708_1001057862 127
211 3300005544 Ga0070686_100093215 Ga0070686_1000932154 127
212 3300005549 Ga0070704_100004227 Ga0070704_1000042271 127
213 3300005617 Ga0068859_100080921 Ga0068859_1000809212 127
214 3300005719 Ga0068861_100816075 Ga0068861_1008160752 127
215 3300005841 Ga0068863_100276539 Ga0068863_1002765391 127
216 3300006163 Ga0070715_10729210 Ga0070715_107292101 127
217 3300006173 Ga0070716_100101499 Ga0070716_1001014993 127
218 3300006175 Ga0070712_101712309 Ga0070712_1017123092 127
219 3300006844 Ga0075428_101431441 Ga0075428_1014314412 127
220 3300006931 Ga0097620_100080919 Ga0097620_1000809193 127
221 3300009094 Ga0111539_10003150 Ga0111539_1000315016 127
222 3300009094 Ga0111539_10042603 Ga0111539_100426033 127
223 3300009094 Ga0111539_10710872 Ga0111539_107108722 127
224 3300009176 Ga0105242_10382191 Ga0105242_103821911 127
225 3300009177 Ga0105248_10015265 Ga0105248_100152653 127
226 3300009177 Ga0105248_10128526 Ga0105248_101285263 127
227 3300009177 Ga0105248_10224813 Ga0105248_102248132 127
228 3300013297 Ga0157378_11212380 Ga0157378_112123802 127
229 3300013306 Ga0163162_10011041 Ga0163162_100110417 127
230 3300013308 Ga0157375_10933887 Ga0157375_109338872 127
231 3300014325 Ga0163163_11010259 Ga0163163_110102592 127
232 3300014326 Ga0157380_10126601 Ga0157380_101266012 127
233 3300014969 Ga0157376_10051021 Ga0157376_100510213 127
234 3300025906 Ga0207699_10000013 Ga0207699_10000013128 127
235 3300025918 Ga0207662_10724838 Ga0207662_107248382 127
236 3300025923 Ga0207681_10854807 Ga0207681_108548071 127
237 3300025925 Ga0207650_10662608 Ga0207650_106626082 127
238 3300025926 Ga0207659_10123168 Ga0207659_101231684 127
239 3300025929 Ga0207664_10925995 Ga0207664_109259951 127
240 3300025936 Ga0207670_10054566 Ga0207670_100545664 127
241 3300025938 Ga0207704_10050459 Ga0207704_100504594 127
242 3300025939 Ga0207665_10251259 Ga0207665_102512591 127
243 3300025941 Ga0207711_10027096 Ga0207711_100270963 127
244 3300025941 Ga0207711_10557862 Ga0207711_105578621 127
245 3300026023 Ga0207677_11319266 Ga0207677_113192661 127
246 3300027907 Ga0207428_10001713 Ga0207428_100017133 127
247 3300027907 Ga0207428_10061223 Ga0207428_100612232 127
248 3300031456 Ga0307513_10428607 Ga0307513_104286071 127
249 3300032004 Ga0307414_10641231 Ga0307414_106412312 127
250 3300034819 Ga0373958_0170502 Ga0373958_0170502_103_492 127
251 3300035085 Ga0373929_0195564 Ga0373929_0195564_77_460 127
252 3300036401 Ga0373937_1693621 Ga0373937_1693621_167_559 127
253 3300044656 Ga0466969_0206555 Ga0466969_0206555_157_546 127
254 3300046454 Ga0495592_0138527 Ga0495592_0138527_247_639 127
255 3300046454 Ga0495592_0338784 Ga0495592_0338784_153_542 127
256 3300046460 Ga0495638_0423081 Ga0495638_0423081_231_617 127
257 3300046516 Ga0495628_0229493 Ga0495628_0229493_991_1380 127
258 3300046516 Ga0495628_0394926 Ga0495628_0394926_440_832 127
259 3300046535 Ga0495586_0485389 Ga0495586_0485389_64_459 127
260 3300046543 Ga0495645_0045998 Ga0495645_0045998_1083_1475 127
261 3300046678 Ga0495599_0106699 Ga0495599_0106699_974_1366 127
262 3300046678 Ga0495599_0212065 Ga0495599_0212065_666_1055 127
263 3300047319 Ga0495674_0804724 Ga0495674_0804724_277_669 127
264 3300047322 Ga0495680_0480550 Ga0495680_0480550_270_659 127
265 3300047471 Ga0495684_0439734 Ga0495684_0439734_105_494 127
266 3300049741 Ga0501079_0138677 Ga0501079_0138677_545_937 127
267 3300050511 nmdc:mga08y16_635912_c1 nmdc:mga08y16_635912_c1_185_610 127
268 3300050511 nmdc:mga08y16_8494_c1 nmdc:mga08y16_8494_c1_10062_10448 127
269 3300050511 nmdc:mga08y16_864290_c1 nmdc:mga08y16_864290_c1_97_480 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

12

131

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9863 1 124
1xrg-assembly1.cif.gz_C conserved hypothetical protein from clostridium thermocellum cth-2968 0.9861 2 124
1nq3-assembly2.cif.gz_E crystal structure of the mammalian tumor associated antigen uk114 0.9836 1 127
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9831 3 124
1qah-assembly1.cif.gz_B crystal structure of perchloric acid soluble protein-a translational inhibitor 0.983 1 127
ID Description Score Start End Superfamily
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9831 3 124 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9811 1 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9774 18 125 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9733 2 125 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9706 1 126 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2D6QWS1-F1-model_v4 Reactive intermediate/imine deaminase 0.9924 1 125 GO:0005829
GO:0019239
AF-A0A3E1E6X0-F1-model_v4 2-iminobutanoate/2-iminopropanoate deaminase 0.991 1 124 GO:0005829
GO:0019239
AF-A0A368X8D8-F1-model_v4 2-iminobutanoate/2-iminopropanoate deaminase 0.9903 1 124 GO:0005829
GO:0019239
AF-A0A321LJU5-F1-model_v4 Reactive intermediate/imine deaminase 0.99 1 124 GO:0005829
GO:0019239
AF-E0NRC8-F1-model_v4 Putative endoribonuclease L-PSP 0.99 1 124 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
96.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map