F376177
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 170 | 268 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_11071704|Ga0105245_110717041 |
| Length | 132 |
| Sequence | VESEKVKDRIQTDRAPQAIGPYSQAVKAGGFVFASGQVAFDPATMQIVDGGIREQTERVMRNLAAVLEAAGSSMERVVKTTVFLADMNEFAAMNEVYGSFFAAEVPPARSTVEVKRLPRDVRVEIDLIALAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 111 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 113 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 115 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 118 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 122 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 144 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 145 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 97.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10102616 | 3300005290 | Bacteria | 2004 |
| 2 | Ga0065707_10015825 | 3300005295 | Bacteria | 1640 |
| 3 | Ga0070658_10659142 | 3300005327 | Unclassified | 908 |
| 4 | Ga0070676_10002684 | 3300005328 | Bacteria | 9161 |
| 5 | Ga0070690_100608549 | 3300005330 | Bacteria | 830 |
| 6 | Ga0070670_100450777 | 3300005331 | Bacteria | 1140 |
| 7 | Ga0070677_10111009 | 3300005333 | Bacteria | 1224 |
| 8 | Ga0068869_100306577 | 3300005334 | Bacteria | 1284 |
| 9 | Ga0070689_100108759 | 3300005340 | Bacteria | 2203 |
| 10 | Ga0070692_10383149 | 3300005345 | Bacteria | 883 |
| 11 | Ga0070669_100227993 | 3300005353 | Bacteria | 1475 |
| 12 | Ga0070669_100403034 | 3300005353 | Bacteria | 1119 |
| 13 | Ga0070675_100050654 | 3300005354 | Bacteria | 3410 |
| 14 | Ga0070675_100904989 | 3300005354 | Bacteria | 809 |
| 15 | Ga0070671_101077972 | 3300005355 | Bacteria | 705 |
| 16 | Ga0070688_101055378 | 3300005365 | Bacteria | 648 |
| 17 | Ga0070703_10000199 | 3300005406 | Bacteria | 29026 |
| 18 | Ga0070703_10195058 | 3300005406 | Bacteria | 791 |
| 19 | Ga0070709_10000043 | 3300005434 | Bacteria | 101915 |
| 20 | Ga0070709_10227249 | 3300005434 | Unclassified | 1334 |
| 21 | Ga0070701_10124480 | 3300005438 | Unclassified | 1457 |
| 22 | Ga0070694_100167568 | 3300005444 | Bacteria | 1616 |
| 23 | Ga0070708_100105786 | 3300005445 | Bacteria | 2582 |
| 24 | Ga0070708_100552012 | 3300005445 | Unclassified | 1087 |
| 25 | Ga0070708_101305406 | 3300005445 | Unclassified | 678 |
| 26 | Ga0068867_100347799 | 3300005459 | Bacteria | 1236 |
| 27 | Ga0068867_102133478 | 3300005459 | Unclassified | 531 |
| 28 | Ga0070707_100000554 | 3300005468 | Bacteria | 37509 |
| 29 | Ga0070707_100020078 | 3300005468 | Bacteria | 6301 |
| 30 | Ga0070699_100006643 | 3300005518 | Bacteria | 10055 |
| 31 | Ga0070686_100093215 | 3300005544 | Bacteria | 2019 |
| 32 | Ga0070686_100100192 | 3300005544 | Unclassified | 1956 |
| 33 | Ga0070696_100169134 | 3300005546 | Bacteria | 1615 |
| 34 | Ga0070704_100004227 | 3300005549 | Bacteria | 8294 |
| 35 | Ga0070704_100109949 | 3300005549 | Bacteria | 2095 |
| 36 | Ga0070704_100177128 | 3300005549 | Unclassified | 1702 |
| 37 | Ga0070704_101287031 | 3300005549 | Bacteria | 669 |
| 38 | Ga0070704_101350420 | 3300005549 | Archaea | 653 |
| 39 | Ga0068857_100041337 | 3300005577 | Bacteria | 4088 |
| 40 | Ga0068854_101742902 | 3300005578 | Bacteria | 570 |
| 41 | Ga0068856_101802203 | 3300005614 | Bacteria | 624 |
| 42 | Ga0070702_100536043 | 3300005615 | Unclassified | 866 |
| 43 | Ga0068859_100080921 | 3300005617 | Bacteria | 3290 |
| 44 | Ga0068859_100190758 | 3300005617 | Bacteria | 2134 |
| 45 | Ga0068859_102697606 | 3300005617 | Bacteria | 546 |
| 46 | Ga0068864_100253408 | 3300005618 | Unclassified | 1635 |
| 47 | Ga0068866_10410949 | 3300005718 | Bacteria | 875 |
| 48 | Ga0068861_100816075 | 3300005719 | Bacteria | 877 |
| 49 | Ga0068863_100276539 | 3300005841 | Bacteria | 1626 |
| 50 | Ga0068858_100149838 | 3300005842 | Bacteria | 2193 |
| 51 | Ga0068860_100241603 | 3300005843 | Bacteria | 1757 |
| 52 | Ga0068860_101082459 | 3300005843 | Bacteria | 821 |
| 53 | Ga0068860_101635198 | 3300005843 | Bacteria | 666 |
| 54 | Ga0068862_100015082 | 3300005844 | Bacteria | 6421 |
| 55 | Ga0068862_100837416 | 3300005844 | Bacteria | 901 |
| 56 | Ga0068862_101124127 | 3300005844 | Bacteria | 781 |
| 57 | Ga0068862_101352268 | 3300005844 | Bacteria | 715 |
| 58 | Ga0081455_10014082 | 3300005937 | Bacteria | 7861 |
| 59 | Ga0081455_10048678 | 3300005937 | Bacteria | 3661 |
| 60 | Ga0075432_10519544 | 3300006058 | Unclassified | 533 |
| 61 | Ga0070715_10729210 | 3300006163 | Unclassified | 595 |
| 62 | Ga0070716_100101499 | 3300006173 | Unclassified | 1765 |
| 63 | Ga0070712_101712309 | 3300006175 | Unclassified | 550 |
| 64 | Ga0097621_100079593 | 3300006237 | Bacteria | 2725 |
| 65 | Ga0097621_100715222 | 3300006237 | Bacteria | 923 |
| 66 | Ga0068871_100029292 | 3300006358 | Bacteria | 4322 |
| 67 | Ga0068871_101400267 | 3300006358 | Bacteria | 659 |
| 68 | Ga0075428_100278605 | 3300006844 | Unclassified | 1799 |
| 69 | Ga0075428_101071929 | 3300006844 | Bacteria | 852 |
| 70 | Ga0075428_101431441 | 3300006844 | Bacteria | 725 |
| 71 | Ga0075428_101654145 | 3300006844 | Bacteria | 669 |
| 72 | Ga0075430_100228326 | 3300006846 | Bacteria | 1544 |
| 73 | Ga0075431_100078290 | 3300006847 | Bacteria | 3412 |
| 74 | Ga0075431_100565380 | 3300006847 | Bacteria | 1123 |
| 75 | Ga0075431_101289570 | 3300006847 | Bacteria | 691 |
| 76 | Ga0075433_10160583 | 3300006852 | Unclassified | 2000 |
| 77 | Ga0075433_10381858 | 3300006852 | Bacteria | 1244 |
| 78 | Ga0075434_100069918 | 3300006871 | Bacteria | 3500 |
| 79 | Ga0075434_100938180 | 3300006871 | Bacteria | 880 |
| 80 | Ga0075429_101086935 | 3300006880 | Bacteria | 699 |
| 81 | Ga0075429_101521675 | 3300006880 | Bacteria | 582 |
| 82 | Ga0068865_100229651 | 3300006881 | Unclassified | 1455 |
| 83 | Ga0075436_101169621 | 3300006914 | Unclassified | 580 |
| 84 | Ga0097620_100080919 | 3300006931 | Bacteria | 3290 |
| 85 | Ga0097620_100190771 | 3300006931 | Bacteria | 2134 |
| 86 | Ga0097620_102695969 | 3300006931 | Bacteria | 546 |
| 87 | Ga0075435_100552121 | 3300007076 | Unclassified | 998 |
| 88 | Ga0075435_100754431 | 3300007076 | Bacteria | 847 |
| 89 | Ga0111539_10001130 | 3300009094 | Bacteria | 35291 |
| 90 | Ga0111539_10003150 | 3300009094 | Bacteria | 21825 |
| 91 | Ga0111539_10042603 | 3300009094 | Bacteria | 5449 |
| 92 | Ga0111539_10158140 | 3300009094 | Bacteria | 2651 |
| 93 | Ga0111539_10710872 | 3300009094 | Bacteria | 1170 |
| 94 | Ga0111539_10807796 | 3300009094 | Bacteria | 1091 |
| 95 | Ga0105245_11071704 | 3300009098 | Unclassified | 852 |
| 96 | Ga0105245_11888699 | 3300009098 | Bacteria | 650 |
| 97 | Ga0114129_10798835 | 3300009147 | Bacteria | 1204 |
| 98 | Ga0114129_10972165 | 3300009147 | Bacteria | 1071 |
| 99 | Ga0114129_12254847 | 3300009147 | Bacteria | 654 |
| 100 | Ga0105243_12377550 | 3300009148 | Bacteria | 568 |
| 101 | Ga0105242_10382191 | 3300009176 | Bacteria | 1309 |
| 102 | Ga0105242_10688414 | 3300009176 | Bacteria | 999 |
| 103 | Ga0105248_10015265 | 3300009177 | Bacteria | 8467 |
| 104 | Ga0105248_10128526 | 3300009177 | Bacteria | 2859 |
| 105 | Ga0105248_10224813 | 3300009177 | Bacteria | 2113 |
| 106 | Ga0105248_10338909 | 3300009177 | Bacteria | 1693 |
| 107 | Ga0105249_10224298 | 3300009553 | Unclassified | 1851 |
| 108 | Ga0105249_12055295 | 3300009553 | Bacteria | 644 |
| 109 | Ga0105246_10381241 | 3300011119 | Bacteria | 1165 |
| 110 | Ga0157378_11212380 | 3300013297 | Unclassified | 794 |
| 111 | Ga0163162_10011041 | 3300013306 | Bacteria | 8800 |
| 112 | Ga0157375_10933887 | 3300013308 | Bacteria | 1010 |
| 113 | Ga0157375_11275401 | 3300013308 | Bacteria | 863 |
| 114 | Ga0157375_12958563 | 3300013308 | Bacteria | 567 |
| 115 | Ga0163163_10000186 | 3300014325 | Bacteria | 63710 |
| 116 | Ga0163163_11010259 | 3300014325 | Bacteria | 895 |
| 117 | Ga0157380_10031890 | 3300014326 | Bacteria | 4048 |
| 118 | Ga0157380_10113433 | 3300014326 | Bacteria | 2282 |
| 119 | Ga0157380_10126601 | 3300014326 | Bacteria | 2172 |
| 120 | Ga0157380_10356530 | 3300014326 | Unclassified | 1371 |
| 121 | Ga0157380_10437112 | 3300014326 | Bacteria | 1253 |
| 122 | Ga0157380_10472085 | 3300014326 | Bacteria | 1211 |
| 123 | Ga0157380_10912195 | 3300014326 | Bacteria | 905 |
| 124 | Ga0157380_11045861 | 3300014326 | Bacteria | 852 |
| 125 | Ga0157380_11657162 | 3300014326 | Unclassified | 696 |
| 126 | Ga0157379_10813691 | 3300014968 | Bacteria | 882 |
| 127 | Ga0157376_10051021 | 3300014969 | Bacteria | 3435 |
| 128 | Ga0157376_10597231 | 3300014969 | Bacteria | 1098 |
| 129 | Ga0157376_11331039 | 3300014969 | Bacteria | 749 |
| 130 | Ga0163161_10272736 | 3300017792 | Bacteria | 1324 |
| 131 | Ga0207653_10069692 | 3300025885 | Bacteria | 1200 |
| 132 | Ga0207642_10598483 | 3300025899 | Bacteria | 686 |
| 133 | Ga0207699_10000013 | 3300025906 | Bacteria | 261480 |
| 134 | Ga0207643_10735944 | 3300025908 | Bacteria | 638 |
| 135 | Ga0207705_10413220 | 3300025909 | Bacteria | 1044 |
| 136 | Ga0207663_10386576 | 3300025916 | Unclassified | 1067 |
| 137 | Ga0207662_10724838 | 3300025918 | Bacteria | 698 |
| 138 | Ga0207646_10000937 | 3300025922 | Bacteria | 37490 |
| 139 | Ga0207681_10854807 | 3300025923 | Unclassified | 761 |
| 140 | Ga0207650_10393485 | 3300025925 | Bacteria | 1146 |
| 141 | Ga0207650_10662608 | 3300025925 | Unclassified | 880 |
| 142 | Ga0207659_10123168 | 3300025926 | Bacteria | 1990 |
| 143 | Ga0207659_11382788 | 3300025926 | Bacteria | 604 |
| 144 | Ga0207700_11203679 | 3300025928 | Unclassified | 676 |
| 145 | Ga0207664_10059652 | 3300025929 | Bacteria | 3039 |
| 146 | Ga0207664_10925995 | 3300025929 | Bacteria | 782 |
| 147 | Ga0207670_10054566 | 3300025936 | Bacteria | 2697 |
| 148 | Ga0207670_10197386 | 3300025936 | Unclassified | 1526 |
| 149 | Ga0207704_10050459 | 3300025938 | Bacteria | 2510 |
| 150 | Ga0207665_10251259 | 3300025939 | Bacteria | 1307 |
| 151 | Ga0207711_10027096 | 3300025941 | Bacteria | 4812 |
| 152 | Ga0207711_10445403 | 3300025941 | Bacteria | 1205 |
| 153 | Ga0207711_10557862 | 3300025941 | Bacteria | 1068 |
| 154 | Ga0207712_10142103 | 3300025961 | Bacteria | 1843 |
| 155 | Ga0207640_11119263 | 3300025981 | Bacteria | 697 |
| 156 | Ga0207677_11319266 | 3300026023 | Bacteria | 663 |
| 157 | Ga0207703_10830178 | 3300026035 | Bacteria | 883 |
| 158 | Ga0207702_11250402 | 3300026078 | Bacteria | 737 |
| 159 | Ga0207676_10465207 | 3300026095 | Bacteria | 1195 |
| 160 | Ga0207674_10013388 | 3300026116 | Bacteria | 9105 |
| 161 | Ga0207674_11145728 | 3300026116 | Bacteria | 747 |
| 162 | Ga0207683_11046211 | 3300026121 | Bacteria | 758 |
| 163 | Ga0207428_10001713 | 3300027907 | Bacteria | 22495 |
| 164 | Ga0207428_10004217 | 3300027907 | Bacteria | 13761 |
| 165 | Ga0207428_10061223 | 3300027907 | Bacteria | 2981 |
| 166 | Ga0207428_10067023 | 3300027907 | Unclassified | 2827 |
| 167 | Ga0268265_10123892 | 3300028380 | Bacteria | 2135 |
| 168 | Ga0268265_11023075 | 3300028380 | Bacteria | 817 |
| 169 | Ga0268265_11133945 | 3300028380 | Bacteria | 777 |
| 170 | Ga0268264_11484976 | 3300028381 | Bacteria | 688 |
| 171 | Ga0265332_10047858 | 3300031238 | Bacteria | 1840 |
| 172 | Ga0265327_10240290 | 3300031251 | Bacteria | 809 |
| 173 | Ga0307513_10428607 | 3300031456 | Bacteria | 1051 |
| 174 | Ga0307405_10162387 | 3300031731 | Unclassified | 1584 |
| 175 | Ga0307413_11983749 | 3300031824 | Bacteria | 524 |
| 176 | Ga0307406_11982740 | 3300031901 | Bacteria | 520 |
| 177 | Ga0307412_10074632 | 3300031911 | Bacteria | 2324 |
| 178 | Ga0307412_11305491 | 3300031911 | Bacteria | 653 |
| 179 | Ga0307409_102646012 | 3300031995 | Bacteria | 530 |
| 180 | Ga0307416_100676425 | 3300032002 | Bacteria | 1119 |
| 181 | Ga0307414_10641231 | 3300032004 | Bacteria | 957 |
| 182 | Ga0316212_1000751 | 3300033547 | Bacteria | 4121 |
| 183 | Ga0373958_0170502 | 3300034819 | Unclassified | 555 |
| 184 | Ga0373929_0195564 | 3300035085 | Unclassified | 564 |
| 185 | Ga0373934_0001705 | 3300035086 | Bacteria | 8073 |
| 186 | Ga0373953_0377565 | 3300035117 | Bacteria | 623 |
| 187 | Ga0373954_0271070 | 3300035118 | Bacteria | 836 |
| 188 | Ga0373956_0059936 | 3300035119 | Bacteria | 1722 |
| 189 | Ga0373957_0006998 | 3300035120 | Bacteria | 3586 |
| 190 | Ga0373955_0005885 | 3300035172 | Bacteria | 5544 |
| 191 | Ga0373933_0012800 | 3300035724 | Bacteria | 4638 |
| 192 | Ga0373937_0000914 | 3300036401 | Bacteria | 25114 |
| 193 | Ga0373937_1693621 | 3300036401 | Unclassified | 579 |
| 194 | Ga0450923_107671 | 3300042125 | Bacteria | 648 |
| 195 | Ga0451577_0004506 | 3300042876 | Bacteria | 14676 |
| 196 | Ga0451577_0242752 | 3300042876 | Bacteria | 1630 |
| 197 | Ga0466969_0206555 | 3300044656 | Bacteria | 895 |
| 198 | Ga0453683_0112584 | 3300044673 | Bacteria | 1712 |
| 199 | Ga0453684_0000117 | 3300044712 | Bacteria | 348119 |
| 200 | Ga0453684_0118087 | 3300044712 | Bacteria | 3209 |
| 201 | Ga0451576_0015920 | 3300045051 | Bacteria | 8314 |
| 202 | Ga0451576_1096767 | 3300045051 | Bacteria | 833 |
| 203 | Ga0495592_0138527 | 3300046454 | Unclassified | 1695 |
| 204 | Ga0495592_0338784 | 3300046454 | Unclassified | 967 |
| 205 | Ga0495603_0015320 | 3300046455 | Bacteria | 4639 |
| 206 | Ga0495638_0423081 | 3300046460 | Unclassified | 686 |
| 207 | Ga0495651_0726858 | 3300046462 | Bacteria | 617 |
| 208 | Ga0495594_0304700 | 3300046499 | Bacteria | 907 |
| 209 | Ga0495628_0229493 | 3300046516 | Bacteria | 1392 |
| 210 | Ga0495628_0394926 | 3300046516 | Unclassified | 1011 |
| 211 | Ga0495586_0485389 | 3300046535 | Unclassified | 713 |
| 212 | Ga0495621_0427218 | 3300046539 | Bacteria | 565 |
| 213 | Ga0495645_0045998 | 3300046543 | Bacteria | 3183 |
| 214 | Ga0495599_0106699 | 3300046678 | Unclassified | 1745 |
| 215 | Ga0495599_0212065 | 3300046678 | Bacteria | 1187 |
| 216 | Ga0495636_0043793 | 3300047318 | Bacteria | 1863 |
| 217 | Ga0495674_0804724 | 3300047319 | Unclassified | 731 |
| 218 | Ga0495680_0131937 | 3300047322 | Bacteria | 1835 |
| 219 | Ga0495680_0480550 | 3300047322 | Bacteria | 846 |
| 220 | Ga0495684_0439734 | 3300047471 | Bacteria | 908 |
| 221 | Ga0496102_0802107 | 3300048905 | Bacteria | 864 |
| 222 | Ga0496109_0000051 | 3300048912 | Bacteria | 126695 |
| 223 | Ga0496110_0163143 | 3300048913 | Bacteria | 2020 |
| 224 | Ga0496114_0906399 | 3300048917 | Bacteria | 763 |
| 225 | Ga0501036_0808806 | 3300049572 | Unclassified | 772 |
| 226 | Ga0501040_0049341 | 3300049576 | Unclassified | 2878 |
| 227 | Ga0501041_0077144 | 3300049577 | Unclassified | 2050 |
| 228 | Ga0501041_0803973 | 3300049577 | Unclassified | 603 |
| 229 | Ga0501046_0302593 | 3300049580 | Unclassified | 1168 |
| 230 | Ga0501048_0346421 | 3300049582 | Bacteria | 1059 |
| 231 | Ga0501070_0672156 | 3300049586 | Bacteria | 821 |
| 232 | Ga0501072_0079936 | 3300049588 | Unclassified | 2590 |
| 233 | Ga0501074_0180920 | 3300049590 | Bacteria | 1504 |
| 234 | Ga0501076_0203449 | 3300049592 | Bacteria | 1617 |
| 235 | Ga0501079_0048654 | 3300049741 | Bacteria | 3272 |
| 236 | Ga0501079_0138677 | 3300049741 | Bacteria | 1894 |
| 237 | Ga0501045_0073989 | 3300049824 | Unclassified | 2509 |
| 238 | nmdc:mga05p37_152843_c1 | 3300050507 | Bacteria | 2822 |
| 239 | nmdc:mga05p37_270006_c1 | 3300050507 | Bacteria | 2033 |
| 240 | nmdc:mga09592_866309_c1 | 3300050508 | Bacteria | 761 |
| 241 | nmdc:mga0qj67_333516_c1 | 3300050509 | Bacteria | 1227 |
| 242 | nmdc:mga06r32_320041_c1 | 3300050510 | Bacteria | 1537 |
| 243 | nmdc:mga06r32_47141_c1 | 3300050510 | Bacteria | 4115 |
| 244 | nmdc:mga06r32_6209_c1 | 3300050510 | Bacteria | 10722 |
| 245 | nmdc:mga06r32_79869_c1 | 3300050510 | Bacteria | 3182 |
| 246 | nmdc:mga06r32_880588_c1 | 3300050510 | Bacteria | 853 |
| 247 | nmdc:mga08y16_1344_c1 | 3300050511 | Bacteria | 24537 |
| 248 | nmdc:mga08y16_635912_c1 | 3300050511 | Bacteria | 1073 |
| 249 | nmdc:mga08y16_8494_c1 | 3300050511 | Bacteria | 10754 |
| 250 | nmdc:mga08y16_864290_c1 | 3300050511 | Unclassified | 893 |
| 251 | nmdc:mga08y16_8976_c1 | 3300050511 | Bacteria | 10502 |
| 252 | nmdc:mga0n895_933941_c1 | 3300050512 | Bacteria | 852 |
| 253 | nmdc:mga0rr50_313383_c1 | 3300050513 | Bacteria | 1314 |
| 254 | nmdc:mga0rr50_404581_c1 | 3300050513 | Bacteria | 1153 |
| 255 | nmdc:mga08x19_972520_c1 | 3300050514 | Unclassified | 603 |
| 256 | nmdc:mga0a205_12802_c1 | 3300050515 | Bacteria | 7779 |
| 257 | nmdc:mga0a205_74296_c1 | 3300050515 | Bacteria | 3285 |
| 258 | Ga0495601_0394820 | 3300053077 | Unclassified | 897 |
| 259 | Ga0495595_0551583 | 3300053084 | Bacteria | 588 |
| 260 | Ga0495595_0733130 | 3300053084 | Unclassified | 507 |
| 261 | Ga0495619_0770089 | 3300053085 | Unclassified | 652 |
| 262 | Ga0501084_0020249 | 3300054114 | Bacteria | 5546 |
| 263 | Ga0501084_0032611 | 3300054114 | Bacteria | 4357 |
| 264 | Ga0501084_0620916 | 3300054114 | Unclassified | 913 |
| 265 | Ga0501082_0011625 | 3300060353 | Bacteria | 7568 |
| 266 | Ga0501082_0765241 | 3300060353 | Unclassified | 845 |
| 267 | Ga0501082_0966852 | 3300060353 | Unclassified | 745 |
| 268 | Ga0530510_0006287 | 3300061734 | Bacteria | 8266 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2919414237 | 2919418537 | 121 |
| 2 | 3300005353 | Ga0070669_100403034 | Ga0070669_1004030343 | 124 |
| 3 | 3300005468 | Ga0070707_100000554 | Ga0070707_10000055411 | 124 |
| 4 | 3300005518 | Ga0070699_100006643 | Ga0070699_1000066433 | 124 |
| 5 | 3300005617 | Ga0068859_102697606 | Ga0068859_1026976061 | 124 |
| 6 | 3300005844 | Ga0068862_101124127 | Ga0068862_1011241271 | 124 |
| 7 | 3300005937 | Ga0081455_10014082 | Ga0081455_100140821 | 124 |
| 8 | 3300005937 | Ga0081455_10048678 | Ga0081455_100486783 | 124 |
| 9 | 3300006058 | Ga0075432_10519544 | Ga0075432_105195441 | 124 |
| 10 | 3300006844 | Ga0075428_100278605 | Ga0075428_1002786052 | 124 |
| 11 | 3300006844 | Ga0075428_101654145 | Ga0075428_1016541452 | 124 |
| 12 | 3300006847 | Ga0075431_100078290 | Ga0075431_1000782902 | 124 |
| 13 | 3300006847 | Ga0075431_101289570 | Ga0075431_1012895702 | 124 |
| 14 | 3300006852 | Ga0075433_10381858 | Ga0075433_103818582 | 124 |
| 15 | 3300006871 | Ga0075434_100069918 | Ga0075434_1000699182 | 124 |
| 16 | 3300006880 | Ga0075429_101086935 | Ga0075429_1010869352 | 124 |
| 17 | 3300006914 | Ga0075436_101169621 | Ga0075436_1011696211 | 124 |
| 18 | 3300006931 | Ga0097620_102695969 | Ga0097620_1026959691 | 124 |
| 19 | 3300007076 | Ga0075435_100754431 | Ga0075435_1007544312 | 124 |
| 20 | 3300009094 | Ga0111539_10158140 | Ga0111539_101581403 | 124 |
| 21 | 3300009147 | Ga0114129_10798835 | Ga0114129_107988352 | 124 |
| 22 | 3300009147 | Ga0114129_12254847 | Ga0114129_122548472 | 124 |
| 23 | 3300009148 | Ga0105243_12377550 | Ga0105243_123775501 | 124 |
| 24 | 3300009177 | Ga0105248_10338909 | Ga0105248_103389091 | 124 |
| 25 | 3300009553 | Ga0105249_12055295 | Ga0105249_120552951 | 124 |
| 26 | 3300013308 | Ga0157375_11275401 | Ga0157375_112754012 | 124 |
| 27 | 3300014326 | Ga0157380_11045861 | Ga0157380_110458611 | 124 |
| 28 | 3300014326 | Ga0157380_11657162 | Ga0157380_116571622 | 124 |
| 29 | 3300014968 | Ga0157379_10813691 | Ga0157379_108136911 | 124 |
| 30 | 3300025922 | Ga0207646_10000937 | Ga0207646_1000093711 | 124 |
| 31 | 3300025941 | Ga0207711_10445403 | Ga0207711_104454032 | 124 |
| 32 | 3300027907 | Ga0207428_10004217 | Ga0207428_100042175 | 124 |
| 33 | 3300031238 | Ga0265332_10047858 | Ga0265332_100478581 | 124 |
| 34 | 3300031251 | Ga0265327_10240290 | Ga0265327_102402902 | 124 |
| 35 | 3300031911 | Ga0307412_11305491 | Ga0307412_113054912 | 124 |
| 36 | 3300031995 | Ga0307409_102646012 | Ga0307409_1026460121 | 124 |
| 37 | 3300042125 | Ga0450923_107671 | Ga0450923_107671_140_514 | 124 |
| 38 | 3300044712 | Ga0453684_0118087 | Ga0453684_0118087_1285_1665 | 124 |
| 39 | 3300048912 | Ga0496109_0000051 | Ga0496109_0000051_60458_60832 | 124 |
| 40 | 3300049572 | Ga0501036_0808806 | Ga0501036_0808806_157_531 | 124 |
| 41 | 3300049577 | Ga0501041_0803973 | Ga0501041_0803973_162_536 | 124 |
| 42 | 3300049580 | Ga0501046_0302593 | Ga0501046_0302593_472_846 | 124 |
| 43 | 3300050507 | nmdc:mga05p37_152843_c1 | nmdc:mga05p37_152843_c1_953_1327 | 124 |
| 44 | 3300050507 | nmdc:mga05p37_270006_c1 | nmdc:mga05p37_270006_c1_184_558 | 124 |
| 45 | 3300050510 | nmdc:mga06r32_320041_c1 | nmdc:mga06r32_320041_c1_135_509 | 124 |
| 46 | 3300050510 | nmdc:mga06r32_47141_c1 | nmdc:mga06r32_47141_c1_1220_1594 | 124 |
| 47 | 3300050510 | nmdc:mga06r32_6209_c1 | nmdc:mga06r32_6209_c1_422_796 | 124 |
| 48 | 3300050510 | nmdc:mga06r32_880588_c1 | nmdc:mga06r32_880588_c1_285_659 | 124 |
| 49 | 3300050511 | nmdc:mga08y16_8976_c1 | nmdc:mga08y16_8976_c1_2107_2481 | 124 |
| 50 | 3300050512 | nmdc:mga0n895_933941_c1 | nmdc:mga0n895_933941_c1_113_487 | 124 |
| 51 | 3300050513 | nmdc:mga0rr50_313383_c1 | nmdc:mga0rr50_313383_c1_231_605 | 124 |
| 52 | 3300050514 | nmdc:mga08x19_972520_c1 | nmdc:mga08x19_972520_c1_147_521 | 124 |
| 53 | 3300050515 | nmdc:mga0a205_74296_c1 | nmdc:mga0a205_74296_c1_641_1015 | 124 |
| 54 | 3300054114 | Ga0501084_0032611 | Ga0501084_0032611_3665_4039 | 124 |
| 55 | 3300060353 | Ga0501082_0966852 | Ga0501082_0966852_82_456 | 124 |
| 56 | 3300005328 | Ga0070676_10002684 | Ga0070676_100026845 | 125 |
| 57 | 3300005330 | Ga0070690_100608549 | Ga0070690_1006085491 | 125 |
| 58 | 3300005345 | Ga0070692_10383149 | Ga0070692_103831492 | 125 |
| 59 | 3300005406 | Ga0070703_10195058 | Ga0070703_101950582 | 125 |
| 60 | 3300005434 | Ga0070709_10227249 | Ga0070709_102272491 | 125 |
| 61 | 3300005438 | Ga0070701_10124480 | Ga0070701_101244803 | 125 |
| 62 | 3300005444 | Ga0070694_100167568 | Ga0070694_1001675683 | 125 |
| 63 | 3300005459 | Ga0068867_100347799 | Ga0068867_1003477991 | 125 |
| 64 | 3300005468 | Ga0070707_100020078 | Ga0070707_1000200782 | 125 |
| 65 | 3300005544 | Ga0070686_100100192 | Ga0070686_1001001922 | 125 |
| 66 | 3300005546 | Ga0070696_100169134 | Ga0070696_1001691342 | 125 |
| 67 | 3300005549 | Ga0070704_100109949 | Ga0070704_1001099492 | 125 |
| 68 | 3300005549 | Ga0070704_100177128 | Ga0070704_1001771282 | 125 |
| 69 | 3300005549 | Ga0070704_101287031 | Ga0070704_1012870312 | 125 |
| 70 | 3300005577 | Ga0068857_100041337 | Ga0068857_1000413374 | 125 |
| 71 | 3300005617 | Ga0068859_100190758 | Ga0068859_1001907584 | 125 |
| 72 | 3300005843 | Ga0068860_100241603 | Ga0068860_1002416032 | 125 |
| 73 | 3300005843 | Ga0068860_101635198 | Ga0068860_1016351981 | 125 |
| 74 | 3300005844 | Ga0068862_100015082 | Ga0068862_1000150822 | 125 |
| 75 | 3300005844 | Ga0068862_100837416 | Ga0068862_1008374161 | 125 |
| 76 | 3300005844 | Ga0068862_101352268 | Ga0068862_1013522682 | 125 |
| 77 | 3300006852 | Ga0075433_10160583 | Ga0075433_101605831 | 125 |
| 78 | 3300006871 | Ga0075434_100938180 | Ga0075434_1009381802 | 125 |
| 79 | 3300006880 | Ga0075429_101521675 | Ga0075429_1015216751 | 125 |
| 80 | 3300006931 | Ga0097620_100190771 | Ga0097620_1001907714 | 125 |
| 81 | 3300007076 | Ga0075435_100552121 | Ga0075435_1005521212 | 125 |
| 82 | 3300009094 | Ga0111539_10001130 | Ga0111539_1000113015 | 125 |
| 83 | 3300009147 | Ga0114129_10972165 | Ga0114129_109721653 | 125 |
| 84 | 3300009553 | Ga0105249_10224298 | Ga0105249_102242982 | 125 |
| 85 | 3300011119 | Ga0105246_10381241 | Ga0105246_103812412 | 125 |
| 86 | 3300014326 | Ga0157380_10031890 | Ga0157380_100318903 | 125 |
| 87 | 3300014326 | Ga0157380_10356530 | Ga0157380_103565302 | 125 |
| 88 | 3300014326 | Ga0157380_10437112 | Ga0157380_104371122 | 125 |
| 89 | 3300014326 | Ga0157380_10912195 | Ga0157380_109121951 | 125 |
| 90 | 3300025885 | Ga0207653_10069692 | Ga0207653_100696922 | 125 |
| 91 | 3300025908 | Ga0207643_10735944 | Ga0207643_107359441 | 125 |
| 92 | 3300025916 | Ga0207663_10386576 | Ga0207663_103865762 | 125 |
| 93 | 3300025926 | Ga0207659_11382788 | Ga0207659_113827881 | 125 |
| 94 | 3300025928 | Ga0207700_11203679 | Ga0207700_112036791 | 125 |
| 95 | 3300025929 | Ga0207664_10059652 | Ga0207664_100596524 | 125 |
| 96 | 3300025936 | Ga0207670_10197386 | Ga0207670_101973863 | 125 |
| 97 | 3300025961 | Ga0207712_10142103 | Ga0207712_101421032 | 125 |
| 98 | 3300026116 | Ga0207674_10013388 | Ga0207674_100133883 | 125 |
| 99 | 3300027907 | Ga0207428_10067023 | Ga0207428_100670232 | 125 |
| 100 | 3300028380 | Ga0268265_10123892 | Ga0268265_101238924 | 125 |
| 101 | 3300028380 | Ga0268265_11023075 | Ga0268265_110230752 | 125 |
| 102 | 3300028381 | Ga0268264_11484976 | Ga0268264_114849761 | 125 |
| 103 | 3300033547 | Ga0316212_1000751 | Ga0316212_10007514 | 125 |
| 104 | 3300042876 | Ga0451577_0242752 | Ga0451577_0242752_1059_1439 | 125 |
| 105 | 3300044673 | Ga0453683_0112584 | Ga0453683_0112584_1058_1441 | 125 |
| 106 | 3300045051 | Ga0451576_1096767 | Ga0451576_1096767_253_633 | 125 |
| 107 | 3300046455 | Ga0495603_0015320 | Ga0495603_0015320_1894_2277 | 125 |
| 108 | 3300046499 | Ga0495594_0304700 | Ga0495594_0304700_319_702 | 125 |
| 109 | 3300047318 | Ga0495636_0043793 | Ga0495636_0043793_984_1367 | 125 |
| 110 | 3300050511 | nmdc:mga08y16_1344_c1 | nmdc:mga08y16_1344_c1_11535_11933 | 125 |
| 111 | 3300050513 | nmdc:mga0rr50_404581_c1 | nmdc:mga0rr50_404581_c1_357_734 | 125 |
| 112 | 3300050515 | nmdc:mga0a205_12802_c1 | nmdc:mga0a205_12802_c1_5902_6300 | 125 |
| 113 | 3300054114 | Ga0501084_0620916 | Ga0501084_0620916_386_763 | 125 |
| 114 | 3300005295 | Ga0065707_10015825 | Ga0065707_100158252 | 126 |
| 115 | 3300005327 | Ga0070658_10659142 | Ga0070658_106591422 | 126 |
| 116 | 3300005331 | Ga0070670_100450777 | Ga0070670_1004507772 | 126 |
| 117 | 3300005353 | Ga0070669_100227993 | Ga0070669_1002279931 | 126 |
| 118 | 3300005365 | Ga0070688_101055378 | Ga0070688_1010553782 | 126 |
| 119 | 3300005445 | Ga0070708_100552012 | Ga0070708_1005520122 | 126 |
| 120 | 3300005445 | Ga0070708_101305406 | Ga0070708_1013054061 | 126 |
| 121 | 3300005459 | Ga0068867_102133478 | Ga0068867_1021334781 | 126 |
| 122 | 3300005549 | Ga0070704_101350420 | Ga0070704_1013504202 | 126 |
| 123 | 3300005578 | Ga0068854_101742902 | Ga0068854_1017429022 | 126 |
| 124 | 3300005614 | Ga0068856_101802203 | Ga0068856_1018022032 | 126 |
| 125 | 3300005615 | Ga0070702_100536043 | Ga0070702_1005360432 | 126 |
| 126 | 3300005618 | Ga0068864_100253408 | Ga0068864_1002534081 | 126 |
| 127 | 3300005718 | Ga0068866_10410949 | Ga0068866_104109491 | 126 |
| 128 | 3300005842 | Ga0068858_100149838 | Ga0068858_1001498385 | 126 |
| 129 | 3300005843 | Ga0068860_101082459 | Ga0068860_1010824591 | 126 |
| 130 | 3300006237 | Ga0097621_100079593 | Ga0097621_1000795933 | 126 |
| 131 | 3300006237 | Ga0097621_100715222 | Ga0097621_1007152221 | 126 |
| 132 | 3300006358 | Ga0068871_100029292 | Ga0068871_1000292921 | 126 |
| 133 | 3300006358 | Ga0068871_101400267 | Ga0068871_1014002671 | 126 |
| 134 | 3300006844 | Ga0075428_101071929 | Ga0075428_1010719291 | 126 |
| 135 | 3300006846 | Ga0075430_100228326 | Ga0075430_1002283262 | 126 |
| 136 | 3300006847 | Ga0075431_100565380 | Ga0075431_1005653802 | 126 |
| 137 | 3300006881 | Ga0068865_100229651 | Ga0068865_1002296511 | 126 |
| 138 | 3300009094 | Ga0111539_10807796 | Ga0111539_108077962 | 126 |
| 139 | 3300009098 | Ga0105245_11071704 | Ga0105245_110717041 | 126 |
| 140 | 3300009098 | Ga0105245_11888699 | Ga0105245_118886992 | 126 |
| 141 | 3300009176 | Ga0105242_10688414 | Ga0105242_106884142 | 126 |
| 142 | 3300013308 | Ga0157375_12958563 | Ga0157375_129585631 | 126 |
| 143 | 3300014325 | Ga0163163_10000186 | Ga0163163_1000018658 | 126 |
| 144 | 3300014326 | Ga0157380_10113433 | Ga0157380_101134334 | 126 |
| 145 | 3300014326 | Ga0157380_10472085 | Ga0157380_104720852 | 126 |
| 146 | 3300014969 | Ga0157376_10597231 | Ga0157376_105972312 | 126 |
| 147 | 3300014969 | Ga0157376_11331039 | Ga0157376_113310392 | 126 |
| 148 | 3300017792 | Ga0163161_10272736 | Ga0163161_102727362 | 126 |
| 149 | 3300025899 | Ga0207642_10598483 | Ga0207642_105984832 | 126 |
| 150 | 3300025909 | Ga0207705_10413220 | Ga0207705_104132202 | 126 |
| 151 | 3300025925 | Ga0207650_10393485 | Ga0207650_103934852 | 126 |
| 152 | 3300025981 | Ga0207640_11119263 | Ga0207640_111192632 | 126 |
| 153 | 3300026035 | Ga0207703_10830178 | Ga0207703_108301782 | 126 |
| 154 | 3300026078 | Ga0207702_11250402 | Ga0207702_112504022 | 126 |
| 155 | 3300026095 | Ga0207676_10465207 | Ga0207676_104652071 | 126 |
| 156 | 3300026116 | Ga0207674_11145728 | Ga0207674_111457282 | 126 |
| 157 | 3300026121 | Ga0207683_11046211 | Ga0207683_110462112 | 126 |
| 158 | 3300028380 | Ga0268265_11133945 | Ga0268265_111339452 | 126 |
| 159 | 3300031731 | Ga0307405_10162387 | Ga0307405_101623871 | 126 |
| 160 | 3300031824 | Ga0307413_11983749 | Ga0307413_119837491 | 126 |
| 161 | 3300031901 | Ga0307406_11982740 | Ga0307406_119827401 | 126 |
| 162 | 3300031911 | Ga0307412_10074632 | Ga0307412_100746322 | 126 |
| 163 | 3300032002 | Ga0307416_100676425 | Ga0307416_1006764252 | 126 |
| 164 | 3300035086 | Ga0373934_0001705 | Ga0373934_0001705_4065_4445 | 126 |
| 165 | 3300035117 | Ga0373953_0377565 | Ga0373953_0377565_123_503 | 126 |
| 166 | 3300035118 | Ga0373954_0271070 | Ga0373954_0271070_108_488 | 126 |
| 167 | 3300035119 | Ga0373956_0059936 | Ga0373956_0059936_113_493 | 126 |
| 168 | 3300035120 | Ga0373957_0006998 | Ga0373957_0006998_776_1156 | 126 |
| 169 | 3300035172 | Ga0373955_0005885 | Ga0373955_0005885_3875_4255 | 126 |
| 170 | 3300035724 | Ga0373933_0012800 | Ga0373933_0012800_4137_4517 | 126 |
| 171 | 3300036401 | Ga0373937_0000914 | Ga0373937_0000914_4064_4444 | 126 |
| 172 | 3300042876 | Ga0451577_0004506 | Ga0451577_0004506_12727_13119 | 126 |
| 173 | 3300044712 | Ga0453684_0000117 | Ga0453684_0000117_48191_48583 | 126 |
| 174 | 3300045051 | Ga0451576_0015920 | Ga0451576_0015920_4090_4473 | 126 |
| 175 | 3300046462 | Ga0495651_0726858 | Ga0495651_0726858_49_429 | 126 |
| 176 | 3300046539 | Ga0495621_0427218 | Ga0495621_0427218_36_422 | 126 |
| 177 | 3300047322 | Ga0495680_0131937 | Ga0495680_0131937_748_1128 | 126 |
| 178 | 3300048905 | Ga0496102_0802107 | Ga0496102_0802107_168_551 | 126 |
| 179 | 3300048913 | Ga0496110_0163143 | Ga0496110_0163143_570_953 | 126 |
| 180 | 3300048917 | Ga0496114_0906399 | Ga0496114_0906399_244_627 | 126 |
| 181 | 3300049576 | Ga0501040_0049341 | Ga0501040_0049341_1910_2290 | 126 |
| 182 | 3300049577 | Ga0501041_0077144 | Ga0501041_0077144_790_1170 | 126 |
| 183 | 3300049582 | Ga0501048_0346421 | Ga0501048_0346421_632_1012 | 126 |
| 184 | 3300049586 | Ga0501070_0672156 | Ga0501070_0672156_263_646 | 126 |
| 185 | 3300049588 | Ga0501072_0079936 | Ga0501072_0079936_776_1156 | 126 |
| 186 | 3300049590 | Ga0501074_0180920 | Ga0501074_0180920_1038_1418 | 126 |
| 187 | 3300049592 | Ga0501076_0203449 | Ga0501076_0203449_614_994 | 126 |
| 188 | 3300049741 | Ga0501079_0048654 | Ga0501079_0048654_2813_3193 | 126 |
| 189 | 3300049824 | Ga0501045_0073989 | Ga0501045_0073989_1682_2062 | 126 |
| 190 | 3300050508 | nmdc:mga09592_866309_c1 | nmdc:mga09592_866309_c1_50_430 | 126 |
| 191 | 3300050509 | nmdc:mga0qj67_333516_c1 | nmdc:mga0qj67_333516_c1_764_1144 | 126 |
| 192 | 3300050510 | nmdc:mga06r32_79869_c1 | nmdc:mga06r32_79869_c1_2327_2707 | 126 |
| 193 | 3300053077 | Ga0495601_0394820 | Ga0495601_0394820_458_841 | 126 |
| 194 | 3300053084 | Ga0495595_0551583 | Ga0495595_0551583_86_466 | 126 |
| 195 | 3300053084 | Ga0495595_0733130 | Ga0495595_0733130_98_484 | 126 |
| 196 | 3300053085 | Ga0495619_0770089 | Ga0495619_0770089_43_429 | 126 |
| 197 | 3300054114 | Ga0501084_0020249 | Ga0501084_0020249_3693_4073 | 126 |
| 198 | 3300060353 | Ga0501082_0011625 | Ga0501082_0011625_4102_4482 | 126 |
| 199 | 3300060353 | Ga0501082_0765241 | Ga0501082_0765241_340_720 | 126 |
| 200 | 3300061734 | Ga0530510_0006287 | Ga0530510_0006287_5252_5635 | 126 |
| 201 | 3300005290 | Ga0065712_10102616 | Ga0065712_101026162 | 127 |
| 202 | 3300005333 | Ga0070677_10111009 | Ga0070677_101110093 | 127 |
| 203 | 3300005334 | Ga0068869_100306577 | Ga0068869_1003065771 | 127 |
| 204 | 3300005340 | Ga0070689_100108759 | Ga0070689_1001087594 | 127 |
| 205 | 3300005354 | Ga0070675_100050654 | Ga0070675_1000506542 | 127 |
| 206 | 3300005354 | Ga0070675_100904989 | Ga0070675_1009049892 | 127 |
| 207 | 3300005355 | Ga0070671_101077972 | Ga0070671_1010779721 | 127 |
| 208 | 3300005406 | Ga0070703_10000199 | Ga0070703_100001993 | 127 |
| 209 | 3300005434 | Ga0070709_10000043 | Ga0070709_1000004391 | 127 |
| 210 | 3300005445 | Ga0070708_100105786 | Ga0070708_1001057862 | 127 |
| 211 | 3300005544 | Ga0070686_100093215 | Ga0070686_1000932154 | 127 |
| 212 | 3300005549 | Ga0070704_100004227 | Ga0070704_1000042271 | 127 |
| 213 | 3300005617 | Ga0068859_100080921 | Ga0068859_1000809212 | 127 |
| 214 | 3300005719 | Ga0068861_100816075 | Ga0068861_1008160752 | 127 |
| 215 | 3300005841 | Ga0068863_100276539 | Ga0068863_1002765391 | 127 |
| 216 | 3300006163 | Ga0070715_10729210 | Ga0070715_107292101 | 127 |
| 217 | 3300006173 | Ga0070716_100101499 | Ga0070716_1001014993 | 127 |
| 218 | 3300006175 | Ga0070712_101712309 | Ga0070712_1017123092 | 127 |
| 219 | 3300006844 | Ga0075428_101431441 | Ga0075428_1014314412 | 127 |
| 220 | 3300006931 | Ga0097620_100080919 | Ga0097620_1000809193 | 127 |
| 221 | 3300009094 | Ga0111539_10003150 | Ga0111539_1000315016 | 127 |
| 222 | 3300009094 | Ga0111539_10042603 | Ga0111539_100426033 | 127 |
| 223 | 3300009094 | Ga0111539_10710872 | Ga0111539_107108722 | 127 |
| 224 | 3300009176 | Ga0105242_10382191 | Ga0105242_103821911 | 127 |
| 225 | 3300009177 | Ga0105248_10015265 | Ga0105248_100152653 | 127 |
| 226 | 3300009177 | Ga0105248_10128526 | Ga0105248_101285263 | 127 |
| 227 | 3300009177 | Ga0105248_10224813 | Ga0105248_102248132 | 127 |
| 228 | 3300013297 | Ga0157378_11212380 | Ga0157378_112123802 | 127 |
| 229 | 3300013306 | Ga0163162_10011041 | Ga0163162_100110417 | 127 |
| 230 | 3300013308 | Ga0157375_10933887 | Ga0157375_109338872 | 127 |
| 231 | 3300014325 | Ga0163163_11010259 | Ga0163163_110102592 | 127 |
| 232 | 3300014326 | Ga0157380_10126601 | Ga0157380_101266012 | 127 |
| 233 | 3300014969 | Ga0157376_10051021 | Ga0157376_100510213 | 127 |
| 234 | 3300025906 | Ga0207699_10000013 | Ga0207699_10000013128 | 127 |
| 235 | 3300025918 | Ga0207662_10724838 | Ga0207662_107248382 | 127 |
| 236 | 3300025923 | Ga0207681_10854807 | Ga0207681_108548071 | 127 |
| 237 | 3300025925 | Ga0207650_10662608 | Ga0207650_106626082 | 127 |
| 238 | 3300025926 | Ga0207659_10123168 | Ga0207659_101231684 | 127 |
| 239 | 3300025929 | Ga0207664_10925995 | Ga0207664_109259951 | 127 |
| 240 | 3300025936 | Ga0207670_10054566 | Ga0207670_100545664 | 127 |
| 241 | 3300025938 | Ga0207704_10050459 | Ga0207704_100504594 | 127 |
| 242 | 3300025939 | Ga0207665_10251259 | Ga0207665_102512591 | 127 |
| 243 | 3300025941 | Ga0207711_10027096 | Ga0207711_100270963 | 127 |
| 244 | 3300025941 | Ga0207711_10557862 | Ga0207711_105578621 | 127 |
| 245 | 3300026023 | Ga0207677_11319266 | Ga0207677_113192661 | 127 |
| 246 | 3300027907 | Ga0207428_10001713 | Ga0207428_100017133 | 127 |
| 247 | 3300027907 | Ga0207428_10061223 | Ga0207428_100612232 | 127 |
| 248 | 3300031456 | Ga0307513_10428607 | Ga0307513_104286071 | 127 |
| 249 | 3300032004 | Ga0307414_10641231 | Ga0307414_106412312 | 127 |
| 250 | 3300034819 | Ga0373958_0170502 | Ga0373958_0170502_103_492 | 127 |
| 251 | 3300035085 | Ga0373929_0195564 | Ga0373929_0195564_77_460 | 127 |
| 252 | 3300036401 | Ga0373937_1693621 | Ga0373937_1693621_167_559 | 127 |
| 253 | 3300044656 | Ga0466969_0206555 | Ga0466969_0206555_157_546 | 127 |
| 254 | 3300046454 | Ga0495592_0138527 | Ga0495592_0138527_247_639 | 127 |
| 255 | 3300046454 | Ga0495592_0338784 | Ga0495592_0338784_153_542 | 127 |
| 256 | 3300046460 | Ga0495638_0423081 | Ga0495638_0423081_231_617 | 127 |
| 257 | 3300046516 | Ga0495628_0229493 | Ga0495628_0229493_991_1380 | 127 |
| 258 | 3300046516 | Ga0495628_0394926 | Ga0495628_0394926_440_832 | 127 |
| 259 | 3300046535 | Ga0495586_0485389 | Ga0495586_0485389_64_459 | 127 |
| 260 | 3300046543 | Ga0495645_0045998 | Ga0495645_0045998_1083_1475 | 127 |
| 261 | 3300046678 | Ga0495599_0106699 | Ga0495599_0106699_974_1366 | 127 |
| 262 | 3300046678 | Ga0495599_0212065 | Ga0495599_0212065_666_1055 | 127 |
| 263 | 3300047319 | Ga0495674_0804724 | Ga0495674_0804724_277_669 | 127 |
| 264 | 3300047322 | Ga0495680_0480550 | Ga0495680_0480550_270_659 | 127 |
| 265 | 3300047471 | Ga0495684_0439734 | Ga0495684_0439734_105_494 | 127 |
| 266 | 3300049741 | Ga0501079_0138677 | Ga0501079_0138677_545_937 | 127 |
| 267 | 3300050511 | nmdc:mga08y16_635912_c1 | nmdc:mga08y16_635912_c1_185_610 | 127 |
| 268 | 3300050511 | nmdc:mga08y16_8494_c1 | nmdc:mga08y16_8494_c1_10062_10448 | 127 |
| 269 | 3300050511 | nmdc:mga08y16_864290_c1 | nmdc:mga08y16_864290_c1_97_480 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xrg-assembly1.cif.gz_A | conserved hypothetical protein from clostridium thermocellum cth-2968 | 0.9863 | 1 | 124 |
| 1xrg-assembly1.cif.gz_C | conserved hypothetical protein from clostridium thermocellum cth-2968 | 0.9861 | 2 | 124 |
| 1nq3-assembly2.cif.gz_E | crystal structure of the mammalian tumor associated antigen uk114 | 0.9836 | 1 | 127 |
| 2dyy-assembly3.cif.gz_G | crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii | 0.9831 | 3 | 124 |
| 1qah-assembly1.cif.gz_B | crystal structure of perchloric acid soluble protein-a translational inhibitor | 0.983 | 1 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dyyG00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9831 | 3 | 124 | 3.30.1330.40 |
| 1nq3C00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9811 | 1 | 126 | 3.30.1330.40 |
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9774 | 18 | 125 | 3.30.1330.40 |
| 3mqwD00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9733 | 2 | 125 | 3.30.1330.40 |
| af_Q86KR5_2_129_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9706 | 1 | 126 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6QWS1-F1-model_v4 | Reactive intermediate/imine deaminase | 0.9924 | 1 | 125 |
GO:0005829
GO:0019239 |
| AF-A0A3E1E6X0-F1-model_v4 | 2-iminobutanoate/2-iminopropanoate deaminase | 0.991 | 1 | 124 |
GO:0005829
GO:0019239 |
| AF-A0A368X8D8-F1-model_v4 | 2-iminobutanoate/2-iminopropanoate deaminase | 0.9903 | 1 | 124 |
GO:0005829
GO:0019239 |
| AF-A0A321LJU5-F1-model_v4 | Reactive intermediate/imine deaminase | 0.99 | 1 | 124 |
GO:0005829
GO:0019239 |
| AF-E0NRC8-F1-model_v4 | Putative endoribonuclease L-PSP | 0.99 | 1 | 124 |
GO:0005829
GO:0019239 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar