F376085

General Info

Members Datasets Scaffolds Average Seq Length
269 226 538 151

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100053071|Ga0070702_1000530712
Length 188
Sequence VEQTLTDQQTTCESVRDTGRASRFSTGLEALPPTPAKLHRPLPPFTEETARQKVQAAEDAWNTLDPERVAQAYTPDSQWRNRDEFFDGRDEIIAFLERKWGERELDYGLRKDLWAFHGNRIAVRFQYESHDASGQWWRSYGNEQWEFDDEGYMRRREASINDVRIDESERRIFGPRPESERAQPLPLR

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
205 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
211 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
212 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
213 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
214 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
215 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
216 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
217 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
218 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
219 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
220 2867475112 Streptomyces sp. TM32 Isolate Unclassified
221 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
222 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
223 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
224 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
225 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
226 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.57
Metatranscriptomes 1.12
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 8.55
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_100053071 3300005615 Bacteria 2327
2 JGI24743J22301_10037417 3300001991 Bacteria 968
3 JGI24742J22300_10099401 3300002244 Bacteria 562
4 rootH2_10123891 3300003320 Bacteria 1226
5 Ga0070683_101173174 3300005329 Bacteria 738
6 Ga0068869_100362762 3300005334 Bacteria 1183
7 Ga0070660_100150687 3300005339 Bacteria 1869
8 Ga0070689_100171195 3300005340 Bacteria 1760
9 Ga0070687_100101483 3300005343 Bacteria 1612
10 Ga0070688_100464411 3300005365 Bacteria 949
11 Ga0070659_100216317 3300005366 Bacteria 1580
12 Ga0070714_100162757 3300005435 Bacteria 2020
13 Ga0070714_100543362 3300005435 Bacteria 1112
14 Ga0070711_100030022 3300005439 Bacteria 3594
15 Ga0070663_100560865 3300005455 Bacteria 956
16 Ga0070681_10071743 3300005458 Bacteria 3428
17 Ga0068867_100451430 3300005459 Bacteria 1095
18 Ga0070685_10038634 3300005466 Bacteria 2707
19 Ga0070706_100017128 3300005467 Bacteria 6696
20 Ga0070679_100640548 3300005530 Bacteria 1006
21 Ga0070697_100924520 3300005536 Bacteria 774
22 Ga0070693_100124100 3300005547 Bacteria 1605
23 Ga0068855_100937997 3300005563 Bacteria 912
24 Ga0070664_100263297 3300005564 Bacteria 1552
25 Ga0070664_100389036 3300005564 Bacteria 1274
26 Ga0068857_100556913 3300005577 Bacteria 1081
27 Ga0068854_100205494 3300005578 Bacteria 1550
28 Ga0068859_100283820 3300005617 Bacteria 1748
29 Ga0068864_100180540 3300005618 Bacteria 1929
30 Ga0068866_10079227 3300005718 Bacteria 1759
31 Ga0068851_10212101 3300005834 Bacteria 1085
32 Ga0068858_101577908 3300005842 Bacteria 648
33 Ga0081455_10013436 3300005937 Bacteria 8093
34 Ga0070712_100000801 3300006175 Bacteria 18657
35 Ga0070712_100060266 3300006175 Bacteria 2676
36 Ga0075433_10120858 3300006852 Bacteria 2326
37 Ga0075434_100760715 3300006871 Bacteria 986
38 Ga0097620_100283816 3300006931 Bacteria 1748
39 Ga0105240_10435768 3300009093 Bacteria 1470
40 Ga0105245_10988775 3300009098 Bacteria 885
41 Ga0105243_11470422 3300009148 Bacteria 704
42 Ga0105237_10005369 3300009545 Bacteria 14494
43 Ga0105237_10411260 3300009545 Bacteria 1358
44 Ga0105237_11694294 3300009545 Bacteria 639
45 Ga0105238_10371994 3300009551 Bacteria 1419
46 Ga0105238_11889098 3300009551 Bacteria 630
47 Ga0105249_10076760 3300009553 Bacteria 3097
48 Ga0105249_13226803 3300009553 Bacteria 524
49 Ga0099796_10210166 3300010159 Bacteria 793
50 Ga0105239_10675135 3300010375 Bacteria 1181
51 Ga0105239_11402995 3300010375 Bacteria 806
52 Ga0157320_1017743 3300012481 Bacteria 622
53 Ga0157373_10374257 3300013100 Bacteria 1018
54 Ga0157371_11117647 3300013102 Bacteria 605
55 Ga0157370_10526088 3300013104 Bacteria 1085
56 Ga0157369_10012207 3300013105 Bacteria 9753
57 Ga0157369_10181765 3300013105 Bacteria 2213
58 Ga0157374_10311347 3300013296 Bacteria 1559
59 Ga0157374_10545526 3300013296 Bacteria 1167
60 Ga0157372_10136711 3300013307 Bacteria 2823
61 Ga0157375_10408017 3300013308 Bacteria 1525
62 Ga0163163_10167667 3300014325 Bacteria 2242
63 Ga0182008_10000517 3300014497 Bacteria 28996
64 Ga0157379_10646443 3300014968 Bacteria 990
65 Ga0182007_10004522 3300015262 Bacteria 6288
66 Ga0197907_11471987 3300020069 Bacteria 673
67 Ga0206350_10763921 3300020080 Bacteria 679
68 Ga0213876_10041431 3300021384 Bacteria 2433
69 Ga0224712_10462327 3300022467 Bacteria 610
70 Ga0207642_10215827 3300025899 Bacteria 1069
71 Ga0207710_10000214 3300025900 Bacteria 51172
72 Ga0207710_10051708 3300025900 Bacteria 1846
73 Ga0207688_10643751 3300025901 Bacteria 669
74 Ga0207699_10454748 3300025906 Bacteria 919
75 Ga0207684_10040682 3300025910 Bacteria 3941
76 Ga0207707_10059993 3300025912 Bacteria 3310
77 Ga0207707_10247823 3300025912 Bacteria 1548
78 Ga0207707_10902561 3300025912 Bacteria 730
79 Ga0207671_10240562 3300025914 Bacteria 1422
80 Ga0207693_10001195 3300025915 Bacteria 23193
81 Ga0207663_10050771 3300025916 Bacteria 2579
82 Ga0207662_10096060 3300025918 Bacteria 1830
83 Ga0207657_10264830 3300025919 Bacteria 1367
84 Ga0207652_10416079 3300025921 Bacteria 1212
85 Ga0207687_10200964 3300025927 Bacteria 1558
86 Ga0207700_10222568 3300025928 Bacteria 1601
87 Ga0207664_10421778 3300025929 Bacteria 1188
88 Ga0207664_11634654 3300025929 Bacteria 566
89 Ga0207709_10301976 3300025935 Bacteria 1191
90 Ga0207670_10189000 3300025936 Bacteria 1557
91 Ga0207665_10499850 3300025939 Bacteria 939
92 Ga0207661_10237540 3300025944 Bacteria 1616
93 Ga0207679_10739681 3300025945 Bacteria 894
94 Ga0207667_10984554 3300025949 Bacteria 831
95 Ga0207712_11127315 3300025961 Bacteria 699
96 Ga0207640_10443749 3300025981 Bacteria 1068
97 Ga0207677_10149037 3300026023 Bacteria 1802
98 Ga0207703_10774188 3300026035 Bacteria 915
99 Ga0207639_10247617 3300026041 Bacteria 1553
100 Ga0207702_10690055 3300026078 Bacteria 1006
101 Ga0207702_10810414 3300026078 Bacteria 926
102 Ga0207648_10039916 3300026089 Bacteria 4126
103 Ga0207676_10195083 3300026095 Bacteria 1785
104 Ga0207675_100054201 3300026118 Bacteria 3741
105 Ga0207683_10054966 3300026121 Bacteria 3491
106 Ga0207428_10375371 3300027907 Bacteria 1044
107 Ga0265357_1017417 3300028023 Bacteria 770
108 Ga0268265_10659866 3300028380 Bacteria 1006
109 Ga0268264_10501177 3300028381 Bacteria 1184
110 Ga0316181_1122073 3300030744 Bacteria 788
111 Ga0307513_10507892 3300031456 Bacteria 922
112 Ga0307509_10009368 3300031507 Bacteria 12267
113 Ga0307514_10008253 3300031649 Bacteria 8887
114 Ga0307516_10000862 3300031730 Bacteria 41576
115 Ga0307516_10013126 3300031730 Bacteria 8856
116 Ga0307516_10046117 3300031730 Bacteria 4302
117 Ga0307405_10000044 3300031731 Bacteria 77117
118 Ga0307413_10789483 3300031824 Bacteria 797
119 Ga0307518_10131224 3300031838 Bacteria 1761
120 Ga0307410_10597296 3300031852 Bacteria 920
121 Ga0307406_10019546 3300031901 Bacteria 3977
122 Ga0307407_10000007 3300031903 Bacteria 210716
123 Ga0307409_100080452 3300031995 Unclassified 2629
124 Ga0307416_100000015 3300032002 Bacteria 210716
125 Ga0307416_101071131 3300032002 Bacteria 910
126 Ga0307414_10015081 3300032004 Bacteria 4656
127 Ga0307415_100596490 3300032126 Bacteria 982
128 Ga0307510_10197491 3300033180 Bacteria 1551
129 Ga0307510_10344331 3300033180 Bacteria 942
130 Ga0373959_0156917 3300034820 Bacteria 579
131 Ga0373949_0215664 3300035090 Bacteria 582
132 Ga0373939_0047008 3300035114 Bacteria 1324
133 Ga0373941_0127341 3300035115 Bacteria 914
134 Ga0373957_0330720 3300035120 Bacteria 649
135 Ga0373960_0374913 3300035121 Bacteria 544
136 Ga0373955_0178804 3300035172 Bacteria 1258
137 Ga0373962_0242828 3300035242 Bacteria 623
138 Ga0373924_0042999 3300035410 Bacteria 1855
139 Ga0373931_0005298 3300035691 Bacteria 5950
140 Ga0373931_0558590 3300035691 Bacteria 744
141 Ga0373933_0157227 3300035724 Bacteria 1442
142 Ga0373937_0050612 3300036401 Bacteria 3805
143 Ga0395901_0338434 3300038443 Bacteria 1555
144 Ga0436365_1820273 3300039437 Bacteria 9459
145 Ga0436363_0217461 3300039450 Bacteria 1206
146 Ga0436363_0457184 3300039450 Bacteria 1292
147 Ga0436362_0293949 3300039453 Bacteria 1014
148 Ga0436362_0972732 3300039453 Bacteria 2301
149 Ga0439436_0007321 3300041404 Bacteria 3397
150 Ga0439439_0002600 3300041406 Bacteria 3863
151 Ga0451807_1177130 3300041486 Bacteria 589
152 Ga0439433_0020722 3300041999 Bacteria 1469
153 Ga0439449_0003550 3300042007 Bacteria 6058
154 Ga0439449_0005577 3300042007 Bacteria 4817
155 Ga0439457_004004 3300042014 Bacteria 3917
156 Ga0466969_0040342 3300044656 Bacteria 2339
157 Ga0466965_0360891 3300044683 Bacteria 797
158 Ga0466961_0022802 3300044693 Bacteria 4027
159 Ga0466961_0755277 3300044693 Bacteria 581
160 Ga0466963_0189788 3300044694 Bacteria 1435
161 Ga0466963_0198147 3300044694 Bacteria 1404
162 Ga0466964_0030837 3300044706 Bacteria 2124
163 Ga0466968_0008451 3300044735 Bacteria 3944
164 Ga0466957_0579034 3300044842 Bacteria 784
165 Ga0466960_0186346 3300044901 Bacteria 1127
166 Ga0466960_0336946 3300044901 Bacteria 857
167 Ga0466959_0049430 3300045049 Bacteria 3090
168 Ga0466959_0906379 3300045049 Bacteria 588
169 Ga0466958_0008956 3300045836 Bacteria 5561
170 Ga0466958_0014463 3300045836 Bacteria 4507
171 Ga0466958_0108927 3300045836 Bacteria 1728
172 Ga0466958_0745707 3300045836 Bacteria 638
173 Ga0466967_0027335 3300045976 Bacteria 4744
174 Ga0466967_0028499 3300045976 Bacteria 4661
175 Ga0466967_0526993 3300045976 Bacteria 1161
176 Ga0466967_0641372 3300045976 Bacteria 1050
177 Ga0466967_0738668 3300045976 Bacteria 976
178 Ga0495592_0037998 3300046454 Bacteria 3623
179 Ga0495651_0020739 3300046462 Bacteria 5102
180 Ga0495653_0031638 3300046463 Bacteria 4204
181 Ga0495664_0306741 3300046477 Bacteria 958
182 Ga0495608_0039759 3300046511 Bacteria 3151
183 Ga0495618_0147008 3300046514 Bacteria 1506
184 Ga0495628_0125899 3300046516 Bacteria 1963
185 Ga0495630_0276527 3300046517 Bacteria 1283
186 Ga0495652_0148873 3300046529 Bacteria 1831
187 Ga0495665_0173541 3300046531 Bacteria 1122
188 Ga0495640_0103726 3300046533 Bacteria 1864
189 Ga0495587_0029187 3300046536 Bacteria 3350
190 Ga0495645_0064485 3300046543 Bacteria 2651
191 Ga0495667_0066242 3300046559 Bacteria 2361
192 Ga0495635_0002714 3300046663 Bacteria 12118
193 Ga0495635_0023292 3300046663 Bacteria 4316
194 Ga0495657_0058960 3300046675 Bacteria 2547
195 Ga0495599_0016356 3300046678 Bacteria 4606
196 Ga0495623_0100647 3300046679 Bacteria 1761
197 Ga0495646_0014262 3300046680 Bacteria 5055
198 Ga0495613_0133248 3300046689 Bacteria 1779
199 Ga0495600_0119097 3300046809 Bacteria 1717
200 Ga0495581_0347681 3300047315 Bacteria 865
201 Ga0495604_0028657 3300047317 Bacteria 4430
202 Ga0495674_0110956 3300047319 Bacteria 2325
203 Ga0495676_0708334 3300047321 Bacteria 651
204 Ga0495680_0007284 3300047322 Bacteria 10181
205 Ga0495675_0056912 3300047444 Bacteria 2479
206 Ga0495684_0022779 3300047471 Bacteria 4817
207 Ga0495593_0174136 3300047673 Bacteria 1084
208 Ga0495602_0075967 3300048088 Bacteria 2849
209 Ga0496101_0103448 3300048904 Bacteria 2134
210 Ga0496102_0114223 3300048905 Bacteria 2519
211 Ga0496103_0125162 3300048906 Bacteria 1639
212 Ga0496104_0149145 3300048907 Bacteria 2245
213 Ga0496105_0047309 3300048908 Bacteria 3550
214 Ga0496105_0159329 3300048908 Bacteria 1853
215 Ga0496106_1293422 3300048909 Bacteria 566
216 Ga0496107_0417819 3300048910 Bacteria 997
217 Ga0496108_0143735 3300048911 Bacteria 2056
218 Ga0496109_0033520 3300048912 Bacteria 4621
219 Ga0496109_0295666 3300048912 Bacteria 1527
220 Ga0496109_0803574 3300048912 Bacteria 878
221 Ga0496110_0549600 3300048913 Bacteria 1049
222 Ga0496111_0030673 3300048914 Bacteria 3824
223 Ga0496112_0050037 3300048915 Bacteria 4096
224 Ga0496112_1518807 3300048915 Bacteria 583
225 Ga0496114_0054718 3300048917 Bacteria 3328
226 Ga0496114_0110164 3300048917 Bacteria 2358
227 Ga0496115_0049919 3300048918 Bacteria 3350
228 Ga0496115_0201187 3300048918 Bacteria 1645
229 Ga0496126_0081365 3300048929 Bacteria 2863
230 Ga0501034_0759307 3300049571 Bacteria 865
231 Ga0501038_0167128 3300049574 Bacteria 1784
232 Ga0501046_0189230 3300049580 Bacteria 1536
233 Ga0501047_0235678 3300049581 Bacteria 1682
234 Ga0501069_0048402 3300049585 Bacteria 2361
235 Ga0501069_0149042 3300049585 Bacteria 1344
236 Ga0501072_1113205 3300049588 Bacteria 614
237 Ga0501080_0000008 3300049742 Bacteria 134920
238 nmdc:mga0n895_407793_c1 3300050512 Bacteria 1374
239 nmdc:mga0a205_430729_c1 3300050515 Bacteria 1180
240 nmdc:mga0sz30_104438_c1 3300050516 Bacteria 1239
241 Ga0495601_0056102 3300053077 Bacteria 2495
242 Ga0495612_0019277 3300053078 Bacteria 2733
243 Ga0495595_0022493 3300053084 Bacteria 2767
244 Ga0500578_0463214 3300053086 Bacteria 719
245 Ga0500651_0265082 3300053093 Bacteria 995
246 Ga0500597_003260 3300053120 Bacteria 4747
247 Ga0500614_001097 3300053123 Bacteria 6685
248 Ga0500568_0071571 3300053139 Bacteria 1327
249 Ga0500568_0118481 3300053139 Bacteria 987
250 Ga0500603_085458 3300053150 Bacteria 920
251 Ga0500645_000046 3300053730 Bacteria 106127
252 Ga0466962_0166121 3300061719 Bacteria 1074
253 2554258395 2554235005 Bacteria 6457341
254 2599928963 2599185299 Bacteria 4854625
255 2650899554 2648501693 Bacteria 5069560
256 2673166572 2671180531 Bacteria 9045424
257 2676483935 2675903059 Bacteria 8644972
258 2686355450 2684622997 Bacteria 4624240
259 2739330608 2738543028 Bacteria 6917070
260 2776371860 2775506925 Bacteria 7237746
261 2842914736 2842909656 Bacteria 6185908
262 2863074857 2863067949 Bacteria 8541735
263 2867476841 2867475112 Bacteria 6909112
264 2870785298 2870782633 Bacteria 9624083
265 2912728197 2912723979 Bacteria 8557534
266 2984494909 2984494565 Bacteria 5000175
267 2990264605 2990261002 Bacteria 4919493
268 3006494144 3006493962 Bacteria 8825450
269 8056207890 8056207758 Bacteria 8639239
270 Ga0070702_100053071
271 JGI24743J22301_10037417
272 JGI24742J22300_10099401
273 rootH2_10123891
274 Ga0070683_101173174
275 Ga0068869_100362762
276 Ga0070660_100150687
277 Ga0070689_100171195
278 Ga0070687_100101483
279 Ga0070688_100464411
280 Ga0070659_100216317
281 Ga0070714_100162757
282 Ga0070714_100543362
283 Ga0070711_100030022
284 Ga0070663_100560865
285 Ga0070681_10071743
286 Ga0068867_100451430
287 Ga0070685_10038634
288 Ga0070706_100017128
289 Ga0070679_100640548
290 Ga0070697_100924520
291 Ga0070693_100124100
292 Ga0068855_100937997
293 Ga0070664_100263297
294 Ga0070664_100389036
295 Ga0068857_100556913
296 Ga0068854_100205494
297 Ga0068859_100283820
298 Ga0068864_100180540
299 Ga0068866_10079227
300 Ga0068851_10212101
301 Ga0068858_101577908
302 Ga0081455_10013436
303 Ga0070712_100000801
304 Ga0070712_100060266
305 Ga0075433_10120858
306 Ga0075434_100760715
307 Ga0097620_100283816
308 Ga0105240_10435768
309 Ga0105245_10988775
310 Ga0105243_11470422
311 Ga0105237_10005369
312 Ga0105237_10411260
313 Ga0105237_11694294
314 Ga0105238_10371994
315 Ga0105238_11889098
316 Ga0105249_10076760
317 Ga0105249_13226803
318 Ga0099796_10210166
319 Ga0105239_10675135
320 Ga0105239_11402995
321 Ga0157320_1017743
322 Ga0157373_10374257
323 Ga0157371_11117647
324 Ga0157370_10526088
325 Ga0157369_10012207
326 Ga0157369_10181765
327 Ga0157374_10311347
328 Ga0157374_10545526
329 Ga0157372_10136711
330 Ga0157375_10408017
331 Ga0163163_10167667
332 Ga0182008_10000517
333 Ga0157379_10646443
334 Ga0182007_10004522
335 Ga0197907_11471987
336 Ga0206350_10763921
337 Ga0213876_10041431
338 Ga0224712_10462327
339 Ga0207642_10215827
340 Ga0207710_10000214
341 Ga0207710_10051708
342 Ga0207688_10643751
343 Ga0207699_10454748
344 Ga0207684_10040682
345 Ga0207707_10059993
346 Ga0207707_10247823
347 Ga0207707_10902561
348 Ga0207671_10240562
349 Ga0207693_10001195
350 Ga0207663_10050771
351 Ga0207662_10096060
352 Ga0207657_10264830
353 Ga0207652_10416079
354 Ga0207687_10200964
355 Ga0207700_10222568
356 Ga0207664_10421778
357 Ga0207664_11634654
358 Ga0207709_10301976
359 Ga0207670_10189000
360 Ga0207665_10499850
361 Ga0207661_10237540
362 Ga0207679_10739681
363 Ga0207667_10984554
364 Ga0207712_11127315
365 Ga0207640_10443749
366 Ga0207677_10149037
367 Ga0207703_10774188
368 Ga0207639_10247617
369 Ga0207702_10690055
370 Ga0207702_10810414
371 Ga0207648_10039916
372 Ga0207676_10195083
373 Ga0207675_100054201
374 Ga0207683_10054966
375 Ga0207428_10375371
376 Ga0265357_1017417
377 Ga0268265_10659866
378 Ga0268264_10501177
379 Ga0316181_1122073
380 Ga0307513_10507892
381 Ga0307509_10009368
382 Ga0307514_10008253
383 Ga0307516_10000862
384 Ga0307516_10013126
385 Ga0307516_10046117
386 Ga0307405_10000044
387 Ga0307413_10789483
388 Ga0307518_10131224
389 Ga0307410_10597296
390 Ga0307406_10019546
391 Ga0307407_10000007
392 Ga0307409_100080452
393 Ga0307416_100000015
394 Ga0307416_101071131
395 Ga0307414_10015081
396 Ga0307415_100596490
397 Ga0307510_10197491
398 Ga0307510_10344331
399 Ga0373959_0156917
400 Ga0373949_0215664
401 Ga0373939_0047008
402 Ga0373941_0127341
403 Ga0373957_0330720
404 Ga0373960_0374913
405 Ga0373955_0178804
406 Ga0373962_0242828
407 Ga0373924_0042999
408 Ga0373931_0005298
409 Ga0373931_0558590
410 Ga0373933_0157227
411 Ga0373937_0050612
412 Ga0395901_0338434
413 Ga0436365_1820273
414 Ga0436363_0217461
415 Ga0436363_0457184
416 Ga0436362_0293949
417 Ga0436362_0972732
418 Ga0439436_0007321
419 Ga0439439_0002600
420 Ga0451807_1177130
421 Ga0439433_0020722
422 Ga0439449_0003550
423 Ga0439449_0005577
424 Ga0439457_004004
425 Ga0466969_0040342
426 Ga0466965_0360891
427 Ga0466961_0022802
428 Ga0466961_0755277
429 Ga0466963_0189788
430 Ga0466963_0198147
431 Ga0466964_0030837
432 Ga0466968_0008451
433 Ga0466957_0579034
434 Ga0466960_0186346
435 Ga0466960_0336946
436 Ga0466959_0049430
437 Ga0466959_0906379
438 Ga0466958_0008956
439 Ga0466958_0014463
440 Ga0466958_0108927
441 Ga0466958_0745707
442 Ga0466967_0027335
443 Ga0466967_0028499
444 Ga0466967_0526993
445 Ga0466967_0641372
446 Ga0466967_0738668
447 Ga0495592_0037998
448 Ga0495651_0020739
449 Ga0495653_0031638
450 Ga0495664_0306741
451 Ga0495608_0039759
452 Ga0495618_0147008
453 Ga0495628_0125899
454 Ga0495630_0276527
455 Ga0495652_0148873
456 Ga0495665_0173541
457 Ga0495640_0103726
458 Ga0495587_0029187
459 Ga0495645_0064485
460 Ga0495667_0066242
461 Ga0495635_0002714
462 Ga0495635_0023292
463 Ga0495657_0058960
464 Ga0495599_0016356
465 Ga0495623_0100647
466 Ga0495646_0014262
467 Ga0495613_0133248
468 Ga0495600_0119097
469 Ga0495581_0347681
470 Ga0495604_0028657
471 Ga0495674_0110956
472 Ga0495676_0708334
473 Ga0495680_0007284
474 Ga0495675_0056912
475 Ga0495684_0022779
476 Ga0495593_0174136
477 Ga0495602_0075967
478 Ga0496101_0103448
479 Ga0496102_0114223
480 Ga0496103_0125162
481 Ga0496104_0149145
482 Ga0496105_0047309
483 Ga0496105_0159329
484 Ga0496106_1293422
485 Ga0496107_0417819
486 Ga0496108_0143735
487 Ga0496109_0033520
488 Ga0496109_0295666
489 Ga0496109_0803574
490 Ga0496110_0549600
491 Ga0496111_0030673
492 Ga0496112_0050037
493 Ga0496112_1518807
494 Ga0496114_0054718
495 Ga0496114_0110164
496 Ga0496115_0049919
497 Ga0496115_0201187
498 Ga0496126_0081365
499 Ga0501034_0759307
500 Ga0501038_0167128
501 Ga0501046_0189230
502 Ga0501047_0235678
503 Ga0501069_0048402
504 Ga0501069_0149042
505 Ga0501072_1113205
506 Ga0501080_0000008
507 nmdc:mga0n895_407793_c1
508 nmdc:mga0a205_430729_c1
509 nmdc:mga0sz30_104438_c1
510 Ga0495601_0056102
511 Ga0495612_0019277
512 Ga0495595_0022493
513 Ga0500578_0463214
514 Ga0500651_0265082
515 Ga0500597_003260
516 Ga0500614_001097
517 Ga0500568_0071571
518 Ga0500568_0118481
519 Ga0500603_085458
520 Ga0500645_000046
521 Ga0466962_0166121
522 2554258395
523 2599928963
524 2650899554
525 2673166572
526 2676483935
527 2686355450
528 2739330608
529 2776371860
530 2842914736
531 2863074857
532 2867476841
533 2870785298
534 2912728197
535 2984494909
536 2990264605
537 3006494144
538 8056207890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

43

173

0.99

PF12680

SnoaL_2

SnoaL-like domain

54

155

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9661 4 150
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9227 4 150
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8819 17 128
3mki-assembly2.cif.gz_C crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) 0.8639 12 125
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.8495 15 128
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9484 13 150 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9285 13 150 3.10.450.50
af_Q6TMK2_24_122_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8563 40 128 3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8425 39 128 3.10.450.50
af_A0A1D8PLG7_12_136_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8405 36 128 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2R5GW03-F1-model_v4 Uncharacterized protein 1.002 5 137
AF-A0A7Y7B283-F1-model_v4 Nuclear transport factor 2 family protein 1.002 12 139
AF-A0A519YSE8-F1-model_v4 Nuclear transport factor 2 family protein 1.002 21 139
AF-A0A1N6DYQ3-F1-model_v4 DUF4440 domain-containing protein 1.001 5 140
AF-A0A1H4QTG3-F1-model_v4 SnoaL-like domain-containing protein 1.001 5 139

Map