F376069

General Info

Members Datasets Scaffolds Average Seq Length
269 167 538 251

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100010441|Ga0070665_1000104413
Length 259
Sequence MTEPGPGGGGLRNSIYRRVSRSQRRMTASRRFLYSLAVPLGLGIIRLWWASCRVVKIEGQEHLDAALAKAPSLVPCYWHQHQLFCGKYLVDQGALTNAAGQPRIKVGWLISPSVDGEIGAMMVRRFGGHVIRGSSTSTGALALKDYYTALVKEGVSPVITPDGPRGPRFEFKPGAILLGQMSGRPILPMAYAASRAWLIKWDKFVVPFPFSRIVIAVGAPRYVPRVTDAAAIERMQSELKTDLKNLYRQARAALGGRAS

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 4.46
Rhizosphere 82.53
Stem 0
Stem Tuber 0
Unclassified 18.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100010441 3300005548 Bacteria 9397
2 JGI25406J46586_10019931 3300003203 Bacteria 2724
3 JGI25406J46586_10020642 3300003203 Bacteria 2659
4 rootH2_10214390 3300003320 Bacteria 1396
5 rootH1_10051774 3300003323 Bacteria 5626
6 rootH1_10169536 3300003323 Bacteria 3068
7 Ga0065707_10083198 3300005295 Bacteria 10058
8 Ga0070683_100077777 3300005329 Unclassified 3103
9 Ga0070666_10001795 3300005335 Bacteria 13075
10 Ga0070680_100085569 3300005336 Bacteria 2605
11 Ga0070680_100369593 3300005336 Bacteria 1220
12 Ga0068868_100011554 3300005338 Bacteria 6431
13 Ga0070671_100000151 3300005355 Bacteria 45208
14 Ga0070671_100008496 3300005355 Bacteria 8230
15 Ga0070667_100911382 3300005367 Unclassified 818
16 Ga0070709_10031875 3300005434 Bacteria 3175
17 Ga0070713_100002021 3300005436 Bacteria 13102
18 Ga0070713_100024124 3300005436 Bacteria 4734
19 Ga0070713_100154037 3300005436 Unclassified 2047
20 Ga0070713_100456328 3300005436 Viruses 1201
21 Ga0070710_10021769 3300005437 Bacteria 3347
22 Ga0070711_100008338 3300005439 Bacteria 6343
23 Ga0070711_100170754 3300005439 Unclassified 1657
24 Ga0070663_100546704 3300005455 Bacteria 967
25 Ga0070678_100038424 3300005456 Bacteria 3370
26 Ga0070681_10011935 3300005458 Bacteria 8615
27 Ga0070681_10025049 3300005458 Bacteria 6004
28 Ga0070681_10036236 3300005458 Bacteria 4954
29 Ga0068867_100148998 3300005459 Bacteria 1836
30 Ga0070679_100000427 3300005530 Bacteria 35832
31 Ga0070679_100041699 3300005530 Bacteria 4568
32 Ga0070679_100145398 3300005530 Unclassified 2349
33 Ga0070693_100090013 3300005547 Bacteria 1848
34 Ga0070665_100011330 3300005548 Bacteria 9020
35 Ga0070665_100032520 3300005548 Bacteria 5250
36 Ga0070665_100037383 3300005548 Bacteria 4883
37 Ga0068855_100116245 3300005563 Bacteria 3066
38 Ga0068855_100170574 3300005563 Bacteria 2464
39 Ga0068852_100068380 3300005616 Bacteria 3109
40 Ga0068859_100000406 3300005617 Bacteria 42822
41 Ga0068859_100166121 3300005617 Bacteria 2287
42 Ga0068859_100169334 3300005617 Bacteria 2265
43 Ga0068864_100508618 3300005618 Bacteria 1160
44 Ga0068866_10005491 3300005718 Bacteria 5237
45 Ga0068861_100596478 3300005719 Unclassified 1013
46 Ga0068863_100006174 3300005841 Bacteria 11752
47 Ga0068863_100036656 3300005841 Bacteria 4671
48 Ga0068858_100000330 3300005842 Bacteria 50101
49 Ga0068858_100018029 3300005842 Bacteria 6611
50 Ga0068860_100000086 3300005843 Bacteria 165786
51 Ga0068860_100052328 3300005843 Bacteria 3884
52 Ga0068860_100284556 3300005843 Bacteria 1616
53 Ga0068860_100718994 3300005843 Unclassified 1009
54 Ga0068862_100081078 3300005844 Bacteria 2814
55 Ga0081455_10000055 3300005937 Bacteria 121650
56 Ga0081539_10000123 3300005985 Bacteria 181245
57 Ga0070717_10018359 3300006028 Bacteria 5458
58 Ga0070715_10052059 3300006163 Bacteria 1765
59 Ga0070716_100002562 3300006173 Bacteria 8407
60 Ga0070716_100430395 3300006173 Unclassified 957
61 Ga0070712_100011666 3300006175 Bacteria 5581
62 Ga0070712_100210309 3300006175 Unclassified 1533
63 Ga0097621_100036367 3300006237 Bacteria 3940
64 Ga0097621_100230959 3300006237 Unclassified 1615
65 Ga0068871_100003468 3300006358 Bacteria 10838
66 Ga0075434_100768081 3300006871 Unclassified 980
67 Ga0068865_100005671 3300006881 Bacteria 7580
68 Ga0097620_100000406 3300006931 Bacteria 42822
69 Ga0097620_100166123 3300006931 Bacteria 2287
70 Ga0097620_100169329 3300006931 Bacteria 2265
71 Ga0075435_100040097 3300007076 Bacteria 3739
72 Ga0099794_10045810 3300007265 Unclassified 2093
73 Ga0105250_10025222 3300009092 Bacteria 2396
74 Ga0105240_10010706 3300009093 Bacteria 12871
75 Ga0105240_10019580 3300009093 Bacteria 9040
76 Ga0105240_10083098 3300009093 Bacteria 3931
77 Ga0105240_10113895 3300009093 Bacteria 3267
78 Ga0105240_10235487 3300009093 Unclassified 2125
79 Ga0105240_10571942 3300009093 Bacteria 1248
80 Ga0105245_10005670 3300009098 Bacteria 10973
81 Ga0105247_10000121 3300009101 Bacteria 75837
82 Ga0105247_10023523 3300009101 Bacteria 3712
83 Ga0105241_10144442 3300009174 Bacteria 1941
84 Ga0105242_10004242 3300009176 Bacteria 11176
85 Ga0105248_10020191 3300009177 Bacteria 7381
86 Ga0105248_10042547 3300009177 Bacteria 5095
87 Ga0105237_10012748 3300009545 Bacteria 8841
88 Ga0105237_10118811 3300009545 Bacteria 2638
89 Ga0105238_10099771 3300009551 Unclassified 2886
90 Ga0105238_10102894 3300009551 Bacteria 2837
91 Ga0105238_10374296 3300009551 Bacteria 1415
92 Ga0105249_10102304 3300009553 Bacteria 2696
93 Ga0105249_10122209 3300009553 Bacteria 2476
94 Ga0105249_10440591 3300009553 Bacteria 1340
95 Ga0099796_10008002 3300010159 Unclassified 2795
96 Ga0105239_10029577 3300010375 Bacteria 6023
97 Ga0105239_10031593 3300010375 Bacteria 5821
98 Ga0105239_10413053 3300010375 Bacteria 1528
99 Ga0105239_10813688 3300010375 Bacteria 1070
100 Ga0157370_10372409 3300013104 Unclassified 1316
101 Ga0157369_10281551 3300013105 Unclassified 1732
102 Ga0157369_10352454 3300013105 Archaea 1528
103 Ga0157374_10003413 3300013296 Bacteria 13345
104 Ga0157378_10011719 3300013297 Bacteria 7675
105 Ga0157372_10130802 3300013307 Bacteria 2888
106 Ga0157372_10422791 3300013307 Unclassified 1553
107 Ga0157372_10529287 3300013307 Unclassified 1374
108 Ga0157375_10024763 3300013308 Bacteria 5561
109 Ga0157375_10960959 3300013308 Bacteria 996
110 Ga0163163_10016416 3300014325 Bacteria 6881
111 Ga0163163_10262873 3300014325 Bacteria 1777
112 Ga0157379_10118221 3300014968 Bacteria 2384
113 Ga0157379_10183333 3300014968 Bacteria 1891
114 Ga0157379_10618185 3300014968 Bacteria 1012
115 Ga0157376_10938006 3300014969 Unclassified 885
116 Ga0213873_10004750 3300021358 Bacteria 2559
117 Ga0213874_10065190 3300021377 Unclassified 1150
118 Ga0207692_10022017 3300025898 Bacteria 2926
119 Ga0207710_10000156 3300025900 Bacteria 73078
120 Ga0207680_10041507 3300025903 Bacteria 2685
121 Ga0207685_10001108 3300025905 Bacteria 5346
122 Ga0207699_10159890 3300025906 Unclassified 1499
123 Ga0207654_10028102 3300025911 Bacteria 3064
124 Ga0207707_10000836 3300025912 Bacteria 30280
125 Ga0207707_10026399 3300025912 Bacteria 5076
126 Ga0207707_10027526 3300025912 Bacteria 4971
127 Ga0207707_10043533 3300025912 Bacteria 3916
128 Ga0207707_10114978 3300025912 Unclassified 2351
129 Ga0207707_10425290 3300025912 Unclassified 1138
130 Ga0207695_10015658 3300025913 Bacteria 8919
131 Ga0207695_10025806 3300025913 Bacteria 6569
132 Ga0207695_10050568 3300025913 Bacteria 4371
133 Ga0207695_10069618 3300025913 Bacteria 3600
134 Ga0207671_10019772 3300025914 Bacteria 5141
135 Ga0207671_10125900 3300025914 Bacteria 1963
136 Ga0207671_10257168 3300025914 Bacteria 1374
137 Ga0207693_10000391 3300025915 Bacteria 40291
138 Ga0207693_10063835 3300025915 Unclassified 2885
139 Ga0207660_10026281 3300025917 Bacteria 3963
140 Ga0207649_10399720 3300025920 Bacteria 1028
141 Ga0207687_10298057 3300025927 Bacteria 1298
142 Ga0207700_10176990 3300025928 Bacteria 1783
143 Ga0207700_10481961 3300025928 Unclassified 1096
144 Ga0207700_10642060 3300025928 Bacteria 946
145 Ga0207664_10383416 3300025929 Unclassified 1248
146 Ga0207644_10000799 3300025931 Bacteria 19939
147 Ga0207704_10056166 3300025938 Bacteria 2410
148 Ga0207665_10023116 3300025939 Bacteria 4095
149 Ga0207665_10036699 3300025939 Bacteria 3260
150 Ga0207661_10015266 3300025944 Bacteria 5648
151 Ga0207661_10058064 3300025944 Unclassified 3114
152 Ga0207667_10003178 3300025949 Bacteria 20321
153 Ga0207667_10443561 3300025949 Unclassified 1319
154 Ga0207712_10026623 3300025961 Bacteria 3855
155 Ga0207712_10077343 3300025961 Bacteria 2411
156 Ga0207658_10015014 3300025986 Bacteria 5310
157 Ga0207658_10112956 3300025986 Bacteria 2151
158 Ga0207677_10357890 3300026023 Bacteria 1225
159 Ga0207703_10000366 3300026035 Bacteria 48363
160 Ga0207703_10008541 3300026035 Bacteria 8089
161 Ga0207703_10282552 3300026035 Bacteria 1508
162 Ga0207678_10020652 3300026067 Bacteria 5773
163 Ga0207702_10046128 3300026078 Bacteria 3668
164 Ga0207702_10613365 3300026078 Bacteria 1068
165 Ga0207641_10000411 3300026088 Bacteria 50003
166 Ga0207648_10170968 3300026089 Bacteria 1921
167 Ga0207676_10082612 3300026095 Unclassified 2614
168 Ga0207676_10462746 3300026095 Bacteria 1198
169 Ga0207683_10002242 3300026121 Bacteria 16990
170 Ga0207698_10057549 3300026142 Bacteria 3009
171 Ga0265355_1002333 3300028036 Unclassified 1322
172 Ga0268266_10008290 3300028379 Bacteria 9258
173 Ga0268266_10022417 3300028379 Bacteria 5383
174 Ga0268266_10054464 3300028379 Bacteria 3437
175 Ga0268266_10126069 3300028379 Bacteria 2285
176 Ga0268265_10152851 3300028380 Bacteria 1949
177 Ga0268265_10347490 3300028380 Bacteria 1353
178 Ga0268264_10000044 3300028381 Bacteria 368079
179 Ga0268264_10004694 3300028381 Bacteria 11613
180 Ga0265334_10048772 3300028573 Bacteria 1630
181 Ga0307515_10025958 3300028794 Bacteria 10107
182 Ga0307515_10304562 3300028794 Unclassified 1275
183 Ga0265338_10057851 3300028800 Bacteria 3427
184 Ga0307511_10005807 3300030521 Bacteria 12478
185 Ga0307511_10087132 3300030521 Bacteria 2145
186 Ga0265770_1002645 3300030878 Bacteria 2437
187 Ga0265760_10001793 3300031090 Bacteria 6303
188 Ga0265340_10010888 3300031247 Bacteria 4852
189 Ga0265340_10045583 3300031247 Bacteria 2141
190 Ga0265331_10025747 3300031250 Bacteria 2966
191 Ga0307513_10066784 3300031456 Unclassified 3777
192 Ga0307509_10000162 3300031507 Bacteria 104449
193 Ga0307509_10333735 3300031507 Unclassified 1247
194 Ga0307406_10166394 3300031901 Bacteria 1591
195 Ga0307409_100009863 3300031995 Bacteria 5895
196 Ga0307409_100154363 3300031995 Bacteria 1998
197 Ga0307409_100691774 3300031995 Unclassified 1018
198 Ga0307510_10000011 3300033180 Bacteria 355464
199 Ga0373923_0143590 3300035111 Bacteria 1080
200 Ga0373927_0022207 3300035695 Bacteria 4157
201 Ga0373937_0261418 3300036401 Bacteria 1632
202 Ga0436360_0882282 3300039438 Unclassified 3609
203 Ga0436360_0989605 3300039438 Unclassified 1854
204 Ga0436360_1304973 3300039438 Bacteria 1166
205 Ga0436361_0161973 3300039447 Bacteria 1455
206 Ga0436363_0120521 3300039450 Unclassified 1227
207 Ga0436363_1234027 3300039450 Bacteria 1455
208 Ga0436362_0656358 3300039453 Bacteria 3613
209 Ga0451795_0210835 3300041456 Unclassified 875
210 Ga0466972_0066495 3300044658 Bacteria 1723
211 Ga0466972_0068288 3300044658 Bacteria 1698
212 Ga0466966_0000375 3300044684 Bacteria 29156
213 Ga0466966_0038008 3300044684 Bacteria 3103
214 Ga0466961_0001014 3300044693 Bacteria 17335
215 Ga0466964_0007289 3300044706 Bacteria 4135
216 Ga0466971_0000522 3300044719 Bacteria 15195
217 Ga0466970_0005390 3300044765 Bacteria 6344
218 Ga0466959_0001255 3300045049 Bacteria 15327
219 Ga0466959_0020135 3300045049 Bacteria 4912
220 Ga0466959_0058967 3300045049 Bacteria 2796
221 Ga0466958_0107774 3300045836 Bacteria 1738
222 Ga0495638_0045733 3300046460 Bacteria 2753
223 Ga0495580_0048265 3300046472 Bacteria 3015
224 Ga0495580_0065613 3300046472 Bacteria 2542
225 Ga0495608_0099581 3300046511 Bacteria 1875
226 Ga0495632_0013673 3300046519 Bacteria 4619
227 Ga0495648_0057032 3300046524 Bacteria 2346
228 Ga0495652_0499140 3300046529 Bacteria 844
229 Ga0495665_0084996 3300046531 Bacteria 1663
230 Ga0495587_0131387 3300046536 Bacteria 1431
231 Ga0495657_0100505 3300046675 Bacteria 1844
232 Ga0495647_0073258 3300046681 Bacteria 1375
233 Ga0495604_0055982 3300047317 Bacteria 3038
234 Ga0496101_0008760 3300048904 Bacteria 6620
235 Ga0496102_0009340 3300048905 Bacteria 8424
236 Ga0496102_0011862 3300048905 Bacteria 7523
237 Ga0496102_0017467 3300048905 Bacteria 6283
238 Ga0496103_0093181 3300048906 Unclassified 1902
239 Ga0496104_0269657 3300048907 Unclassified 1615
240 Ga0496107_0040992 3300048910 Bacteria 3324
241 Ga0496109_0171776 3300048912 Bacteria 2034
242 Ga0496112_0023864 3300048915 Bacteria 5851
243 Ga0496114_0082880 3300048917 Unclassified 2712
244 Ga0496115_0108615 3300048918 Unclassified 2278
245 Ga0496116_0061232 3300048919 Unclassified 2437
246 Ga0496117_0000095 3300048920 Bacteria 198731
247 Ga0496118_0001497 3300048921 Bacteria 34886
248 Ga0496118_0123119 3300048921 Bacteria 1685
249 Ga0496119_0000836 3300048922 Bacteria 40927
250 Ga0496119_0000940 3300048922 Bacteria 37554
251 Ga0496120_0000579 3300048923 Bacteria 55722
252 Ga0496121_0000547 3300048924 Bacteria 70979
253 Ga0496121_0066335 3300048924 Unclassified 2931
254 Ga0496121_0071474 3300048924 Unclassified 2790
255 Ga0496121_0153315 3300048924 Unclassified 1693
256 Ga0496124_0185147 3300048927 Unclassified 1598
257 Ga0496124_0412785 3300048927 Unclassified 933
258 Ga0496125_0000112 3300048928 Bacteria 188192
259 Ga0496125_0003498 3300048928 Bacteria 18978
260 Ga0496125_0024491 3300048928 Bacteria 5550
261 Ga0496126_0009146 3300048929 Bacteria 10573
262 Ga0496126_0087086 3300048929 Bacteria 2752
263 Ga0501080_0617946 3300049742 Bacteria 961
264 nmdc:mga0n895_904143_c1 3300050512 Unclassified 868
265 nmdc:mga08x19_43802_c1 3300050514 Bacteria 2855
266 Ga0500583_0007859 3300053092 Bacteria 3786
267 Ga0500573_0137019 3300053140 Unclassified 1351
268 Ga0500616_0000030 3300053153 Bacteria 415224
269 Ga0466962_0000053 3300061719 Bacteria 47290
270 Ga0070665_100010441
271 JGI25406J46586_10019931
272 JGI25406J46586_10020642
273 rootH2_10214390
274 rootH1_10051774
275 rootH1_10169536
276 Ga0065707_10083198
277 Ga0070683_100077777
278 Ga0070666_10001795
279 Ga0070680_100085569
280 Ga0070680_100369593
281 Ga0068868_100011554
282 Ga0070671_100000151
283 Ga0070671_100008496
284 Ga0070667_100911382
285 Ga0070709_10031875
286 Ga0070713_100002021
287 Ga0070713_100024124
288 Ga0070713_100154037
289 Ga0070713_100456328
290 Ga0070710_10021769
291 Ga0070711_100008338
292 Ga0070711_100170754
293 Ga0070663_100546704
294 Ga0070678_100038424
295 Ga0070681_10011935
296 Ga0070681_10025049
297 Ga0070681_10036236
298 Ga0068867_100148998
299 Ga0070679_100000427
300 Ga0070679_100041699
301 Ga0070679_100145398
302 Ga0070693_100090013
303 Ga0070665_100011330
304 Ga0070665_100032520
305 Ga0070665_100037383
306 Ga0068855_100116245
307 Ga0068855_100170574
308 Ga0068852_100068380
309 Ga0068859_100000406
310 Ga0068859_100166121
311 Ga0068859_100169334
312 Ga0068864_100508618
313 Ga0068866_10005491
314 Ga0068861_100596478
315 Ga0068863_100006174
316 Ga0068863_100036656
317 Ga0068858_100000330
318 Ga0068858_100018029
319 Ga0068860_100000086
320 Ga0068860_100052328
321 Ga0068860_100284556
322 Ga0068860_100718994
323 Ga0068862_100081078
324 Ga0081455_10000055
325 Ga0081539_10000123
326 Ga0070717_10018359
327 Ga0070715_10052059
328 Ga0070716_100002562
329 Ga0070716_100430395
330 Ga0070712_100011666
331 Ga0070712_100210309
332 Ga0097621_100036367
333 Ga0097621_100230959
334 Ga0068871_100003468
335 Ga0075434_100768081
336 Ga0068865_100005671
337 Ga0097620_100000406
338 Ga0097620_100166123
339 Ga0097620_100169329
340 Ga0075435_100040097
341 Ga0099794_10045810
342 Ga0105250_10025222
343 Ga0105240_10010706
344 Ga0105240_10019580
345 Ga0105240_10083098
346 Ga0105240_10113895
347 Ga0105240_10235487
348 Ga0105240_10571942
349 Ga0105245_10005670
350 Ga0105247_10000121
351 Ga0105247_10023523
352 Ga0105241_10144442
353 Ga0105242_10004242
354 Ga0105248_10020191
355 Ga0105248_10042547
356 Ga0105237_10012748
357 Ga0105237_10118811
358 Ga0105238_10099771
359 Ga0105238_10102894
360 Ga0105238_10374296
361 Ga0105249_10102304
362 Ga0105249_10122209
363 Ga0105249_10440591
364 Ga0099796_10008002
365 Ga0105239_10029577
366 Ga0105239_10031593
367 Ga0105239_10413053
368 Ga0105239_10813688
369 Ga0157370_10372409
370 Ga0157369_10281551
371 Ga0157369_10352454
372 Ga0157374_10003413
373 Ga0157378_10011719
374 Ga0157372_10130802
375 Ga0157372_10422791
376 Ga0157372_10529287
377 Ga0157375_10024763
378 Ga0157375_10960959
379 Ga0163163_10016416
380 Ga0163163_10262873
381 Ga0157379_10118221
382 Ga0157379_10183333
383 Ga0157379_10618185
384 Ga0157376_10938006
385 Ga0213873_10004750
386 Ga0213874_10065190
387 Ga0207692_10022017
388 Ga0207710_10000156
389 Ga0207680_10041507
390 Ga0207685_10001108
391 Ga0207699_10159890
392 Ga0207654_10028102
393 Ga0207707_10000836
394 Ga0207707_10026399
395 Ga0207707_10027526
396 Ga0207707_10043533
397 Ga0207707_10114978
398 Ga0207707_10425290
399 Ga0207695_10015658
400 Ga0207695_10025806
401 Ga0207695_10050568
402 Ga0207695_10069618
403 Ga0207671_10019772
404 Ga0207671_10125900
405 Ga0207671_10257168
406 Ga0207693_10000391
407 Ga0207693_10063835
408 Ga0207660_10026281
409 Ga0207649_10399720
410 Ga0207687_10298057
411 Ga0207700_10176990
412 Ga0207700_10481961
413 Ga0207700_10642060
414 Ga0207664_10383416
415 Ga0207644_10000799
416 Ga0207704_10056166
417 Ga0207665_10023116
418 Ga0207665_10036699
419 Ga0207661_10015266
420 Ga0207661_10058064
421 Ga0207667_10003178
422 Ga0207667_10443561
423 Ga0207712_10026623
424 Ga0207712_10077343
425 Ga0207658_10015014
426 Ga0207658_10112956
427 Ga0207677_10357890
428 Ga0207703_10000366
429 Ga0207703_10008541
430 Ga0207703_10282552
431 Ga0207678_10020652
432 Ga0207702_10046128
433 Ga0207702_10613365
434 Ga0207641_10000411
435 Ga0207648_10170968
436 Ga0207676_10082612
437 Ga0207676_10462746
438 Ga0207683_10002242
439 Ga0207698_10057549
440 Ga0265355_1002333
441 Ga0268266_10008290
442 Ga0268266_10022417
443 Ga0268266_10054464
444 Ga0268266_10126069
445 Ga0268265_10152851
446 Ga0268265_10347490
447 Ga0268264_10000044
448 Ga0268264_10004694
449 Ga0265334_10048772
450 Ga0307515_10025958
451 Ga0307515_10304562
452 Ga0265338_10057851
453 Ga0307511_10005807
454 Ga0307511_10087132
455 Ga0265770_1002645
456 Ga0265760_10001793
457 Ga0265340_10010888
458 Ga0265340_10045583
459 Ga0265331_10025747
460 Ga0307513_10066784
461 Ga0307509_10000162
462 Ga0307509_10333735
463 Ga0307406_10166394
464 Ga0307409_100009863
465 Ga0307409_100154363
466 Ga0307409_100691774
467 Ga0307510_10000011
468 Ga0373923_0143590
469 Ga0373927_0022207
470 Ga0373937_0261418
471 Ga0436360_0882282
472 Ga0436360_0989605
473 Ga0436360_1304973
474 Ga0436361_0161973
475 Ga0436363_0120521
476 Ga0436363_1234027
477 Ga0436362_0656358
478 Ga0451795_0210835
479 Ga0466972_0066495
480 Ga0466972_0068288
481 Ga0466966_0000375
482 Ga0466966_0038008
483 Ga0466961_0001014
484 Ga0466964_0007289
485 Ga0466971_0000522
486 Ga0466970_0005390
487 Ga0466959_0001255
488 Ga0466959_0020135
489 Ga0466959_0058967
490 Ga0466958_0107774
491 Ga0495638_0045733
492 Ga0495580_0048265
493 Ga0495580_0065613
494 Ga0495608_0099581
495 Ga0495632_0013673
496 Ga0495648_0057032
497 Ga0495652_0499140
498 Ga0495665_0084996
499 Ga0495587_0131387
500 Ga0495657_0100505
501 Ga0495647_0073258
502 Ga0495604_0055982
503 Ga0496101_0008760
504 Ga0496102_0009340
505 Ga0496102_0011862
506 Ga0496102_0017467
507 Ga0496103_0093181
508 Ga0496104_0269657
509 Ga0496107_0040992
510 Ga0496109_0171776
511 Ga0496112_0023864
512 Ga0496114_0082880
513 Ga0496115_0108615
514 Ga0496116_0061232
515 Ga0496117_0000095
516 Ga0496118_0001497
517 Ga0496118_0123119
518 Ga0496119_0000836
519 Ga0496119_0000940
520 Ga0496120_0000579
521 Ga0496121_0000547
522 Ga0496121_0066335
523 Ga0496121_0071474
524 Ga0496121_0153315
525 Ga0496124_0185147
526 Ga0496124_0412785
527 Ga0496125_0000112
528 Ga0496125_0003498
529 Ga0496125_0024491
530 Ga0496126_0009146
531 Ga0496126_0087086
532 Ga0501080_0617946
533 nmdc:mga0n895_904143_c1
534 nmdc:mga08x19_43802_c1
535 Ga0500583_0007859
536 Ga0500573_0137019
537 Ga0500616_0000030
538 Ga0466962_0000053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04028

DUF374

Domain of unknown function (DUF374)

100

168

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oaw-assembly1.cif.gz_A crystal structure of aspergillus fumigatus n-acetylphosphoglucosamine mutase in complex with glcnac-6p and magnesium 0.5883 85 140
4eit-assembly1.cif.gz_A crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae 0.5796 71 145
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.5783 31 235
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.5766 25 236
5tf4-assembly2.cif.gz_F crystal structure of enoyl-(acyl carrier protein) reductase from bartonella henselae in complext with nad 0.5738 71 145
ID Description Score Start End Superfamily
af_Q5JK26_123_351_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.6864 40 242 3.40.1130.10
af_Q94F16_113_260_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6522 52 176 3.40.50.620
af_P33333_55_242_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.6463 49 235 3.40.1130.10
af_P33333_55_242_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.6334 49 235 3.40.1130.10
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6252 71 178 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A534GGD5-F1-model_v4 DUF374 domain-containing protein 0.9489 9 249 GO:0016020
AF-A0A534JD07-F1-model_v4 DUF374 domain-containing protein 0.9486 9 249 GO:0016020
AF-A0A3B1A464-F1-model_v4 DUF374 domain-containing protein 0.9447 23 249
AF-A0A2G6KL19-F1-model_v4 DUF374 domain-containing protein 0.9428 38 250
AF-A0A4Q6BWS6-F1-model_v4 DUF374 domain-containing protein 0.9411 64 247

Map