F375222

General Info

Members Datasets Scaffolds Average Seq Length
268 158 536 188

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10004243|rootH2_1000424323
Length 201
Sequence MDRIILASGSPRRKQLLEWAEVDFEIIVRDTPETYPAGMAVIDVPVHIARNKALAVQKVAEPGRIVIAADTVVVLDGEVIGKPRDRDDAVAILTRLSGRRHDVITGVVLLRDNGPGGEGGDARGEEQAFADRTSVWFHDLSRAELEGYVDRYRPYDKAGAYAIQEWIGVVGIRKIEGDFYNVMGLPVSRVVQALKKWQPFL

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
126 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
127 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
128 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
131 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
132 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
133 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
134 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
135 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
136 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
137 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
138 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
139 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
140 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
141 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
144 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
145 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
148 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
149 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
150 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 0.37
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 16.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10004243 3300003320 Bacteria 29145
2 rootH2_10005337 3300003320 Bacteria 13777
3 rootH2_10005691 3300003320 Bacteria 7628
4 rootH2_10032350 3300003320 Bacteria 5714
5 Ga0065714_10282835 3300005288 Unclassified 720
6 Ga0065712_10133516 3300005290 Bacteria 1521
7 Ga0070683_100996395 3300005329 Bacteria 804
8 Ga0070670_100576888 3300005331 Bacteria 1005
9 Ga0068869_100166388 3300005334 Bacteria 1720
10 Ga0070666_10138701 3300005335 Unclassified 1693
11 Ga0070666_10299818 3300005335 Bacteria 1144
12 Ga0070666_10570426 3300005335 Bacteria 824
13 Ga0068868_100352022 3300005338 Bacteria 1261
14 Ga0068868_100539866 3300005338 Bacteria 1026
15 Ga0070689_101094114 3300005340 Bacteria 712
16 Ga0070687_100137907 3300005343 Bacteria 1416
17 Ga0070687_100288261 3300005343 Bacteria 1036
18 Ga0070675_100080055 3300005354 Bacteria 2723
19 Ga0070671_100032925 3300005355 Bacteria 4284
20 Ga0070674_100010205 3300005356 Bacteria 5665
21 Ga0070688_100087901 3300005365 Bacteria 2025
22 Ga0070659_100034242 3300005366 Unclassified 3950
23 Ga0070681_10051045 3300005458 Unclassified 4126
24 Ga0068867_100089595 3300005459 Bacteria 2333
25 Ga0068867_100221838 3300005459 Bacteria 1524
26 Ga0068853_100008323 3300005539 Bacteria 8330
27 Ga0068853_100523588 3300005539 Bacteria 1121
28 Ga0070672_100042911 3300005543 Bacteria 3484
29 Ga0070693_101023608 3300005547 Unclassified 626
30 Ga0070665_100000031 3300005548 Bacteria 333365
31 Ga0068855_100011616 3300005563 Bacteria 10642
32 Ga0068855_100049962 3300005563 Unclassified 4929
33 Ga0068855_100291714 3300005563 Bacteria 1808
34 Ga0070664_100145885 3300005564 Unclassified 2087
35 Ga0068857_100001839 3300005577 Bacteria 17074
36 Ga0068857_101066850 3300005577 Bacteria 779
37 Ga0068854_100203318 3300005578 Bacteria 1558
38 Ga0068854_100681935 3300005578 Bacteria 885
39 Ga0068856_100024137 3300005614 Bacteria 5917
40 Ga0068856_100167721 3300005614 Archaea 2207
41 Ga0070702_100002159 3300005615 Bacteria 8362
42 Ga0068852_100006563 3300005616 Bacteria 8418
43 Ga0068852_100146849 3300005616 Bacteria 2188
44 Ga0068852_100217931 3300005616 Bacteria 1814
45 Ga0068852_100351326 3300005616 Bacteria 1440
46 Ga0068864_100069045 3300005618 Bacteria 3072
47 Ga0068864_100332763 3300005618 Bacteria 1429
48 Ga0068864_100485906 3300005618 Bacteria 1186
49 Ga0068861_100145322 3300005719 Unclassified 1940
50 Ga0068851_10116167 3300005834 Bacteria 1434
51 Ga0068860_100000072 3300005843 Bacteria 174997
52 Ga0068860_100003468 3300005843 Bacteria 16226
53 Ga0068860_100003834 3300005843 Bacteria 15463
54 Ga0081540_1024115 3300005983 Unclassified 3537
55 Ga0097621_100120684 3300006237 Bacteria 2223
56 Ga0097621_100257717 3300006237 Unclassified 1529
57 Ga0097621_100593845 3300006237 Bacteria 1011
58 Ga0068871_100210337 3300006358 Bacteria 1682
59 Ga0105240_10000152 3300009093 Bacteria 141054
60 Ga0105240_10000991 3300009093 Bacteria 50697
61 Ga0105240_10001109 3300009093 Bacteria 47404
62 Ga0105240_10012757 3300009093 Bacteria 11583
63 Ga0105240_10056788 3300009093 Bacteria 4896
64 Ga0105240_10083143 3300009093 Bacteria 3929
65 Ga0105240_10250495 3300009093 Unclassified 2049
66 Ga0105240_11599862 3300009093 Bacteria 682
67 Ga0111539_10036996 3300009094 Bacteria 5898
68 Ga0105245_10168099 3300009098 Bacteria 2086
69 Ga0105241_10003966 3300009174 Bacteria 10941
70 Ga0105242_10130848 3300009176 Bacteria 2166
71 Ga0105248_10956429 3300009177 Bacteria 967
72 Ga0105237_10005933 3300009545 Bacteria 13698
73 Ga0105237_10007237 3300009545 Bacteria 12172
74 Ga0105237_10015143 3300009545 Bacteria 8036
75 Ga0105237_10024586 3300009545 Bacteria 6159
76 Ga0105237_10039937 3300009545 Bacteria 4734
77 Ga0105237_10052115 3300009545 Bacteria 4109
78 Ga0105238_10002471 3300009551 Bacteria 18498
79 Ga0105238_10016058 3300009551 Bacteria 7574
80 Ga0105238_10043270 3300009551 Bacteria 4557
81 Ga0105238_10178024 3300009551 Bacteria 2103
82 Ga0105238_10306082 3300009551 Bacteria 1573
83 Ga0105238_10793647 3300009551 Bacteria 962
84 Ga0105249_10512111 3300009553 Bacteria 1246
85 Ga0105249_10843709 3300009553 Unclassified 982
86 Ga0105239_10000168 3300010375 Bacteria 94279
87 Ga0105239_10010270 3300010375 Bacteria 10487
88 Ga0105239_10017380 3300010375 Bacteria 7956
89 Ga0105239_10084572 3300010375 Unclassified 3495
90 Ga0157373_10004322 3300013100 Bacteria 10693
91 Ga0157371_10034470 3300013102 Bacteria 3630
92 Ga0157371_10149904 3300013102 Unclassified 1663
93 Ga0157371_10305371 3300013102 Bacteria 1152
94 Ga0157371_10644076 3300013102 Bacteria 791
95 Ga0157370_10298675 3300013104 Bacteria 1487
96 Ga0157369_10059339 3300013105 Unclassified 4126
97 Ga0157369_10120812 3300013105 Bacteria 2780
98 Ga0157374_10000002 3300013296 Bacteria 1054226
99 Ga0157374_10187173 3300013296 Unclassified 2024
100 Ga0157378_10006350 3300013297 Bacteria 10342
101 Ga0163162_10000218 3300013306 Bacteria 52447
102 Ga0163162_10085698 3300013306 Bacteria 3227
103 Ga0163162_10894430 3300013306 Bacteria 1001
104 Ga0157372_10005788 3300013307 Bacteria 13169
105 Ga0157372_10007445 3300013307 Bacteria 11643
106 Ga0157372_10032451 3300013307 Bacteria 5727
107 Ga0157372_10100190 3300013307 Unclassified 3306
108 Ga0157372_10224666 3300013307 Bacteria 2177
109 Ga0157372_10374281 3300013307 Bacteria 1660
110 Ga0157375_10043063 3300013308 Bacteria 4375
111 Ga0157375_10785077 3300013308 Bacteria 1102
112 Ga0163163_10196361 3300014325 Bacteria 2066
113 Ga0163163_10378238 3300014325 Unclassified 1474
114 Ga0163163_10573062 3300014325 Bacteria 1192
115 Ga0163163_11267004 3300014325 Unclassified 799
116 Ga0157380_10007247 3300014326 Bacteria 7865
117 Ga0157379_10491942 3300014968 Bacteria 1136
118 Ga0157376_10003764 3300014969 Bacteria 10484
119 Ga0207656_10157640 3300025321 Bacteria 1078
120 Ga0207680_10208960 3300025903 Unclassified 1334
121 Ga0207680_10423167 3300025903 Bacteria 943
122 Ga0207647_10000334 3300025904 Bacteria 38696
123 Ga0207647_10027123 3300025904 Bacteria 3738
124 Ga0207647_10080839 3300025904 Archaea 1948
125 Ga0207647_10275198 3300025904 Bacteria 962
126 Ga0207645_10008391 3300025907 Bacteria 7206
127 Ga0207645_10470274 3300025907 Bacteria 849
128 Ga0207654_10002743 3300025911 Bacteria 8936
129 Ga0207654_10350417 3300025911 Bacteria 1016
130 Ga0207707_10053641 3300025912 Unclassified 3510
131 Ga0207695_10000185 3300025913 Bacteria 180225
132 Ga0207695_10000666 3300025913 Bacteria 67698
133 Ga0207695_10005845 3300025913 Bacteria 16163
134 Ga0207695_10059888 3300025913 Bacteria 3946
135 Ga0207695_10063436 3300025913 Bacteria 3810
136 Ga0207695_10077124 3300025913 Unclassified 3386
137 Ga0207695_10132969 3300025913 Bacteria 2444
138 Ga0207695_10391297 3300025913 Unclassified 1275
139 Ga0207671_10002465 3300025914 Bacteria 19764
140 Ga0207671_10008975 3300025914 Bacteria 8412
141 Ga0207671_10011253 3300025914 Bacteria 7300
142 Ga0207671_10015352 3300025914 Bacteria 5999
143 Ga0207671_10208218 3300025914 Bacteria 1529
144 Ga0207671_10211392 3300025914 Unclassified 1517
145 Ga0207657_10178146 3300025919 Bacteria 1719
146 Ga0207694_10037535 3300025924 Unclassified 3721
147 Ga0207694_10186912 3300025924 Bacteria 1682
148 Ga0207694_10350600 3300025924 Bacteria 1222
149 Ga0207694_10619701 3300025924 Bacteria 910
150 Ga0207650_10152001 3300025925 Bacteria 1827
151 Ga0207659_10020924 3300025926 Bacteria 4333
152 Ga0207659_10338078 3300025926 Bacteria 1246
153 Ga0207644_10065626 3300025931 Bacteria 2640
154 Ga0207644_10743389 3300025931 Bacteria 819
155 Ga0207644_10759441 3300025931 Bacteria 810
156 Ga0207691_10065166 3300025940 Bacteria 3299
157 Ga0207691_10164389 3300025940 Bacteria 1945
158 Ga0207689_10147058 3300025942 Bacteria 1941
159 Ga0207661_10865668 3300025944 Bacteria 832
160 Ga0207679_10036004 3300025945 Bacteria 3507
161 Ga0207667_10001931 3300025949 Bacteria 25993
162 Ga0207667_10007792 3300025949 Bacteria 12802
163 Ga0207651_10166124 3300025960 Bacteria 1735
164 Ga0207640_10225073 3300025981 Bacteria 1439
165 Ga0207640_10596717 3300025981 Bacteria 934
166 Ga0207658_10207537 3300025986 Bacteria 1640
167 Ga0207677_10066146 3300026023 Unclassified 2526
168 Ga0207677_10141782 3300026023 Unclassified 1841
169 Ga0207677_10204293 3300026023 Bacteria 1573
170 Ga0207703_10371189 3300026035 Bacteria 1321
171 Ga0207639_10011298 3300026041 Bacteria 6197
172 Ga0207639_10333856 3300026041 Unclassified 1350
173 Ga0207708_10642432 3300026075 Unclassified 903
174 Ga0207702_10030535 3300026078 Bacteria 4491
175 Ga0207702_10177887 3300026078 Archaea 1957
176 Ga0207648_10058604 3300026089 Bacteria 3358
177 Ga0207648_10076893 3300026089 Bacteria 2910
178 Ga0207648_10238906 3300026089 Bacteria 1617
179 Ga0207676_10264434 3300026095 Bacteria 1555
180 Ga0207676_10934082 3300026095 Bacteria 852
181 Ga0207674_10001616 3300026116 Bacteria 28994
182 Ga0207675_100064660 3300026118 Bacteria 3419
183 Ga0207675_100248046 3300026118 Unclassified 1722
184 Ga0207698_10500565 3300026142 Bacteria 1182
185 Ga0207698_10529542 3300026142 Bacteria 1151
186 Ga0207698_11103118 3300026142 Bacteria 806
187 Ga0209974_10019197 3300027876 Bacteria 2266
188 Ga0268266_10000088 3300028379 Bacteria 199029
189 Ga0268264_10000484 3300028381 Bacteria 52947
190 Ga0268264_10004151 3300028381 Bacteria 12386
191 Ga0268264_10032229 3300028381 Bacteria 4299
192 Ga0307517_10188824 3300028786 Bacteria 1313
193 Ga0265327_10008375 3300031251 Bacteria 7714
194 Ga0307509_10127662 3300031507 Unclassified 2506
195 Ga0307516_10124817 3300031730 Bacteria 2360
196 Ga0307414_10107420 3300032004 Bacteria 2115
197 Ga0307414_10202764 3300032004 Bacteria 1615
198 Ga0307510_10000074 3300033180 Bacteria 75194
199 Ga0307510_10306796 3300033180 Unclassified 1047
200 Ga0373950_0137670 3300034818 Bacteria 551
201 Ga0373937_1066781 3300036401 Bacteria 757
202 Ga0395905_0003517 3300037471 Bacteria 16707
203 Ga0395905_0043253 3300037471 Bacteria 4226
204 Ga0436365_0807683 3300039437 Bacteria 1070
205 Ga0439439_0109725 3300041406 Bacteria 764
206 Ga0439449_0004630 3300042007 Bacteria 5311
207 Ga0439457_023253 3300042014 Bacteria 1371
208 Ga0451577_0162396 3300042876 Unclassified 2012
209 Ga0466972_0005305 3300044658 Bacteria 6452
210 Ga0466972_0419615 3300044658 Bacteria 628
211 Ga0453683_0042942 3300044673 Bacteria 2838
212 Ga0466965_0010408 3300044683 Bacteria 4337
213 Ga0466961_0051410 3300044693 Bacteria 2632
214 Ga0466964_0044643 3300044706 Unclassified 1801
215 Ga0453684_0092803 3300044712 Bacteria 3720
216 Ga0453684_0371910 3300044712 Unclassified 1606
217 Ga0466968_0144539 3300044735 Unclassified 1090
218 Ga0466959_0003437 3300045049 Bacteria 10362
219 Ga0451576_0849851 3300045051 Unclassified 958
220 Ga0495638_0055219 3300046460 Bacteria 2467
221 Ga0495606_0011207 3300046507 Bacteria 7338
222 Ga0495648_0000294 3300046524 Bacteria 55789
223 Ga0495611_0000274 3300046648 Bacteria 35206
224 Ga0495611_0024784 3300046648 Bacteria 2611
225 Ga0495625_0096400 3300046660 Bacteria 2038
226 Ga0495649_0105703 3300046694 Bacteria 1494
227 Ga0495687_000010 3300047443 Bacteria 413735
228 Ga0495686_0000102 3300047472 Bacteria 177525
229 Ga0496115_0774816 3300048918 Bacteria 748
230 Ga0501290_031516 3300049513 Bacteria 762
231 Ga0501296_010864 3300049519 Bacteria 1084
232 Ga0501298_000945 3300049521 Bacteria 4116
233 Ga0501299_008269 3300049522 Bacteria 1688
234 Ga0501047_0741287 3300049581 Unclassified 799
235 Ga0501201_000643 3300049651 Bacteria 3262
236 Ga0501202_000113 3300049652 Bacteria 9378
237 Ga0501206_005152 3300049653 Bacteria 1680
238 Ga0501207_002202 3300049654 Bacteria 2503
239 Ga0501207_019966 3300049654 Bacteria 1067
240 Ga0501217_036156 3300049661 Bacteria 1238
241 Ga0501217_054375 3300049661 Bacteria 1054
242 Ga0501223_002209 3300049663 Bacteria 4359
243 Ga0501228_001498 3300049666 Bacteria 1716
244 Ga0501233_001932 3300049668 Bacteria 3600
245 Ga0501233_201529 3300049668 Unclassified 579
246 Ga0501242_003236 3300049674 Bacteria 1755
247 Ga0501243_037716 3300049675 Bacteria 841
248 Ga0501251_003203 3300049681 Bacteria 1623
249 Ga0501252_008369 3300049682 Bacteria 1188
250 Ga0501257_011596 3300049686 Bacteria 2013
251 Ga0501259_009119 3300049688 Bacteria 1606
252 Ga0501259_056130 3300049688 Bacteria 812
253 Ga0501261_000200 3300049690 Bacteria 8552
254 Ga0501221_004610 3300049704 Bacteria 2285
255 Ga0501225_0000895 3300049705 Bacteria 9261
256 Ga0501245_005082 3300049708 Bacteria 1818
257 Ga0501279_002051 3300049775 Bacteria 2667
258 Ga0501280_028526 3300049776 Unclassified 862
259 Ga0501212_002035 3300049851 Bacteria 2391
260 nmdc:mga08y16_28396_c1 3300050511 Bacteria 5898
261 Ga0500644_0212527 3300053088 Unclassified 804
262 Ga0500583_0001682 3300053092 Bacteria 6456
263 Ga0500568_0054324 3300053139 Unclassified 1567
264 Ga0500588_0000267 3300053146 Bacteria 7604
265 Ga0500588_0205029 3300053146 Unclassified 731
266 Ga0500616_0206023 3300053153 Bacteria 868
267 Ga0500622_0006929 3300053156 Bacteria 6492
268 Ga0466962_0028916 3300061719 Bacteria 2654
269 rootH2_10004243
270 rootH2_10005337
271 rootH2_10005691
272 rootH2_10032350
273 Ga0065714_10282835
274 Ga0065712_10133516
275 Ga0070683_100996395
276 Ga0070670_100576888
277 Ga0068869_100166388
278 Ga0070666_10138701
279 Ga0070666_10299818
280 Ga0070666_10570426
281 Ga0068868_100352022
282 Ga0068868_100539866
283 Ga0070689_101094114
284 Ga0070687_100137907
285 Ga0070687_100288261
286 Ga0070675_100080055
287 Ga0070671_100032925
288 Ga0070674_100010205
289 Ga0070688_100087901
290 Ga0070659_100034242
291 Ga0070681_10051045
292 Ga0068867_100089595
293 Ga0068867_100221838
294 Ga0068853_100008323
295 Ga0068853_100523588
296 Ga0070672_100042911
297 Ga0070693_101023608
298 Ga0070665_100000031
299 Ga0068855_100011616
300 Ga0068855_100049962
301 Ga0068855_100291714
302 Ga0070664_100145885
303 Ga0068857_100001839
304 Ga0068857_101066850
305 Ga0068854_100203318
306 Ga0068854_100681935
307 Ga0068856_100024137
308 Ga0068856_100167721
309 Ga0070702_100002159
310 Ga0068852_100006563
311 Ga0068852_100146849
312 Ga0068852_100217931
313 Ga0068852_100351326
314 Ga0068864_100069045
315 Ga0068864_100332763
316 Ga0068864_100485906
317 Ga0068861_100145322
318 Ga0068851_10116167
319 Ga0068860_100000072
320 Ga0068860_100003468
321 Ga0068860_100003834
322 Ga0081540_1024115
323 Ga0097621_100120684
324 Ga0097621_100257717
325 Ga0097621_100593845
326 Ga0068871_100210337
327 Ga0105240_10000152
328 Ga0105240_10000991
329 Ga0105240_10001109
330 Ga0105240_10012757
331 Ga0105240_10056788
332 Ga0105240_10083143
333 Ga0105240_10250495
334 Ga0105240_11599862
335 Ga0111539_10036996
336 Ga0105245_10168099
337 Ga0105241_10003966
338 Ga0105242_10130848
339 Ga0105248_10956429
340 Ga0105237_10005933
341 Ga0105237_10007237
342 Ga0105237_10015143
343 Ga0105237_10024586
344 Ga0105237_10039937
345 Ga0105237_10052115
346 Ga0105238_10002471
347 Ga0105238_10016058
348 Ga0105238_10043270
349 Ga0105238_10178024
350 Ga0105238_10306082
351 Ga0105238_10793647
352 Ga0105249_10512111
353 Ga0105249_10843709
354 Ga0105239_10000168
355 Ga0105239_10010270
356 Ga0105239_10017380
357 Ga0105239_10084572
358 Ga0157373_10004322
359 Ga0157371_10034470
360 Ga0157371_10149904
361 Ga0157371_10305371
362 Ga0157371_10644076
363 Ga0157370_10298675
364 Ga0157369_10059339
365 Ga0157369_10120812
366 Ga0157374_10000002
367 Ga0157374_10187173
368 Ga0157378_10006350
369 Ga0163162_10000218
370 Ga0163162_10085698
371 Ga0163162_10894430
372 Ga0157372_10005788
373 Ga0157372_10007445
374 Ga0157372_10032451
375 Ga0157372_10100190
376 Ga0157372_10224666
377 Ga0157372_10374281
378 Ga0157375_10043063
379 Ga0157375_10785077
380 Ga0163163_10196361
381 Ga0163163_10378238
382 Ga0163163_10573062
383 Ga0163163_11267004
384 Ga0157380_10007247
385 Ga0157379_10491942
386 Ga0157376_10003764
387 Ga0207656_10157640
388 Ga0207680_10208960
389 Ga0207680_10423167
390 Ga0207647_10000334
391 Ga0207647_10027123
392 Ga0207647_10080839
393 Ga0207647_10275198
394 Ga0207645_10008391
395 Ga0207645_10470274
396 Ga0207654_10002743
397 Ga0207654_10350417
398 Ga0207707_10053641
399 Ga0207695_10000185
400 Ga0207695_10000666
401 Ga0207695_10005845
402 Ga0207695_10059888
403 Ga0207695_10063436
404 Ga0207695_10077124
405 Ga0207695_10132969
406 Ga0207695_10391297
407 Ga0207671_10002465
408 Ga0207671_10008975
409 Ga0207671_10011253
410 Ga0207671_10015352
411 Ga0207671_10208218
412 Ga0207671_10211392
413 Ga0207657_10178146
414 Ga0207694_10037535
415 Ga0207694_10186912
416 Ga0207694_10350600
417 Ga0207694_10619701
418 Ga0207650_10152001
419 Ga0207659_10020924
420 Ga0207659_10338078
421 Ga0207644_10065626
422 Ga0207644_10743389
423 Ga0207644_10759441
424 Ga0207691_10065166
425 Ga0207691_10164389
426 Ga0207689_10147058
427 Ga0207661_10865668
428 Ga0207679_10036004
429 Ga0207667_10001931
430 Ga0207667_10007792
431 Ga0207651_10166124
432 Ga0207640_10225073
433 Ga0207640_10596717
434 Ga0207658_10207537
435 Ga0207677_10066146
436 Ga0207677_10141782
437 Ga0207677_10204293
438 Ga0207703_10371189
439 Ga0207639_10011298
440 Ga0207639_10333856
441 Ga0207708_10642432
442 Ga0207702_10030535
443 Ga0207702_10177887
444 Ga0207648_10058604
445 Ga0207648_10076893
446 Ga0207648_10238906
447 Ga0207676_10264434
448 Ga0207676_10934082
449 Ga0207674_10001616
450 Ga0207675_100064660
451 Ga0207675_100248046
452 Ga0207698_10500565
453 Ga0207698_10529542
454 Ga0207698_11103118
455 Ga0209974_10019197
456 Ga0268266_10000088
457 Ga0268264_10000484
458 Ga0268264_10004151
459 Ga0268264_10032229
460 Ga0307517_10188824
461 Ga0265327_10008375
462 Ga0307509_10127662
463 Ga0307516_10124817
464 Ga0307414_10107420
465 Ga0307414_10202764
466 Ga0307510_10000074
467 Ga0307510_10306796
468 Ga0373950_0137670
469 Ga0373937_1066781
470 Ga0395905_0003517
471 Ga0395905_0043253
472 Ga0436365_0807683
473 Ga0439439_0109725
474 Ga0439449_0004630
475 Ga0439457_023253
476 Ga0451577_0162396
477 Ga0466972_0005305
478 Ga0466972_0419615
479 Ga0453683_0042942
480 Ga0466965_0010408
481 Ga0466961_0051410
482 Ga0466964_0044643
483 Ga0453684_0092803
484 Ga0453684_0371910
485 Ga0466968_0144539
486 Ga0466959_0003437
487 Ga0451576_0849851
488 Ga0495638_0055219
489 Ga0495606_0011207
490 Ga0495648_0000294
491 Ga0495611_0000274
492 Ga0495611_0024784
493 Ga0495625_0096400
494 Ga0495649_0105703
495 Ga0495687_000010
496 Ga0495686_0000102
497 Ga0496115_0774816
498 Ga0501290_031516
499 Ga0501296_010864
500 Ga0501298_000945
501 Ga0501299_008269
502 Ga0501047_0741287
503 Ga0501201_000643
504 Ga0501202_000113
505 Ga0501206_005152
506 Ga0501207_002202
507 Ga0501207_019966
508 Ga0501217_036156
509 Ga0501217_054375
510 Ga0501223_002209
511 Ga0501228_001498
512 Ga0501233_001932
513 Ga0501233_201529
514 Ga0501242_003236
515 Ga0501243_037716
516 Ga0501251_003203
517 Ga0501252_008369
518 Ga0501257_011596
519 Ga0501259_009119
520 Ga0501259_056130
521 Ga0501261_000200
522 Ga0501221_004610
523 Ga0501225_0000895
524 Ga0501245_005082
525 Ga0501279_002051
526 Ga0501280_028526
527 Ga0501212_002035
528 nmdc:mga08y16_28396_c1
529 Ga0500644_0212527
530 Ga0500583_0001682
531 Ga0500568_0054324
532 Ga0500588_0000267
533 Ga0500588_0205029
534 Ga0500616_0206023
535 Ga0500622_0006929
536 Ga0466962_0028916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

3

197

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.942 4 196
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9396 1 197
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9396 4 196
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9199 4 196
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9198 1 197
ID Description Score Start End Superfamily
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9396 4 196 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9199 4 196 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9078 4 199 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.894 4 199 3.90.950.10
4lu1B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8926 4 196 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A353REG9-F1-model_v4 Septum formation inhibitor Maf 0.9681 4 138 GO:0047429
AF-A0A1F7RSY6-F1-model_v4 Septum formation protein Maf 0.962 4 149 GO:0047429
AF-A0A7V9SK19-F1-model_v4 Maf family protein 0.9536 4 137 GO:0047429
AF-A0A353REG9-F1-model_v4 Septum formation inhibitor Maf 0.953 4 138 GO:0047429
AF-A0A5C7WDB6-F1-model_v4 deleted 0.9503 4 198

Map