F375103

General Info

Members Datasets Scaffolds Average Seq Length
267 208 259 81

Family's Representative Sequence

Representative Sequence 3300049653|Ga0501206_038395|Ga0501206_038395_400_660
Length 86
Sequence MAEDLKDAAARDGSKDRPTARKSSLVQTFKAVAWSFFGIRRSKDYANDVEKLNPVHVVIAGIVGALIFIGCLVLLVRWVVGSGVAS

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2643221656 Pelomonas sp. Root405 Isolate Unclassified
5 2738541337 Pelomonas sp. BT06 Isolate Unclassified
6 2831864461 Roseateles noduli HZ7 Isolate Nodule
7 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
73 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
91 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
92 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
99 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
100 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
101 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
102 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
103 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
104 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
105 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
106 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
107 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
108 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
111 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
143 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
144 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
145 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
146 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
147 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
154 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
157 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
158 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
159 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
160 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
161 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
164 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
165 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
169 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
170 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
171 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
172 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
173 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
174 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
175 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
176 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
179 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
180 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
181 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
182 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
183 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
186 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
187 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
188 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
189 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
190 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 1.12
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.22
Nodule 1.12
Rhizoplane 1.12
Rhizosphere 64.79
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003715 3300001979 Bacteria 6644
2 JGI25152J39213_1000752 3300002773 Bacteria 16498
3 JGI25150J39212_1004196 3300002774 Bacteria 3243
4 JGI25153J46596_10014796 3300003215 Bacteria 3221
5 rootH1_10017790 3300003316 Bacteria 2103
6 rootH2_10043945 3300003320 Bacteria 1749
7 rootL2_10000579 3300003322 Bacteria 16628
8 rootL2_10000580 3300003322 Bacteria 1644
9 rootH1_10016701 3300003323 Bacteria 1920
10 rootH1_10044409 3300003323 Bacteria 1519
11 rootH1_10125484 3300003323 Bacteria 1382
12 Ga0055526_1007400 3300003771 Bacteria 5717
13 Ga0055526_1009134 3300003771 Bacteria 4823
14 Ga0055524_1000733 3300003775 Bacteria 22506
15 Ga0055524_1005494 3300003775 Bacteria 5643
16 Ga0055540_1030319 3300003792 Bacteria 1257
17 Ga0055531_10000043 3300003794 Bacteria 133906
18 Ga0055531_10007153 3300003794 Bacteria 6154
19 Ga0055531_10021663 3300003794 Bacteria 2482
20 Ga0065165_1000016 3300005262 Bacteria 286248
21 Ga0070668_100468775 3300005347 Bacteria 1086
22 Ga0070708_100110016 3300005445 Bacteria 2531
23 Ga0070678_101985509 3300005456 Bacteria 550
24 Ga0070684_100462434 3300005535 Bacteria 1173
25 Ga0068855_100123577 3300005563 Bacteria 2961
26 Ga0068857_100698488 3300005577 Bacteria 964
27 Ga0068857_101277561 3300005577 Bacteria 712
28 Ga0068856_100449837 3300005614 Bacteria 1309
29 Ga0068852_100128943 3300005616 Bacteria 2327
30 Ga0068859_101486156 3300005617 Bacteria 748
31 Ga0068862_100031437 3300005844 Bacteria 4481
32 Ga0075363_100010995 3300006048 Bacteria 4320
33 Ga0075364_10132666 3300006051 Bacteria 1672
34 Ga0075362_10031183 3300006177 Bacteria 2306
35 Ga0075367_10064695 3300006178 Bacteria 2188
36 Ga0075369_10019440 3300006186 Bacteria 2773
37 Ga0075366_10014699 3300006195 Bacteria 4474
38 Ga0075366_10039564 3300006195 Bacteria 2787
39 Ga0075366_10063663 3300006195 Bacteria 2192
40 Ga0075366_10102003 3300006195 Bacteria 1722
41 Ga0075366_10314733 3300006195 Bacteria 958
42 Ga0097621_101655439 3300006237 Bacteria 609
43 Ga0075370_10000954 3300006353 Bacteria 11903
44 Ga0075370_10096275 3300006353 Bacteria 1710
45 Ga0075370_10207573 3300006353 Bacteria 1156
46 Ga0075428_101324095 3300006844 Bacteria 757
47 Ga0068865_101116613 3300006881 Bacteria 695
48 Ga0097620_101486051 3300006931 Bacteria 748
49 Ga0099823_1000101 3300006944 Bacteria 41834
50 Ga0111539_10396325 3300009094 Bacteria 1608
51 Ga0105245_11073088 3300009098 Bacteria 851
52 Ga0105243_10318964 3300009148 Bacteria 1415
53 Ga0105248_11560771 3300009177 Bacteria 748
54 Ga0157317_1000388 3300012475 Bacteria 1808
55 Ga0157378_13074269 3300013297 Bacteria 518
56 Ga0157372_12775467 3300013307 Bacteria 562
57 Ga0157375_10159070 3300013308 Bacteria 2400
58 Ga0163163_11640227 3300014325 Bacteria 704
59 Ga0209258_119930 3300025242 Bacteria 707
60 Ga0207425_1003440 3300025245 Bacteria 5070
61 Ga0209129_1000062 3300025258 Bacteria 240655
62 Ga0209673_1013829 3300025273 Bacteria 3163
63 Ga0209673_1028406 3300025273 Bacteria 1801
64 Ga0209673_1063031 3300025273 Bacteria 916
65 Ga0209673_1071764 3300025273 Bacteria 822
66 Ga0209564_1000008 3300025295 Bacteria 953227
67 Ga0209564_1000176 3300025295 Bacteria 152363
68 Ga0209758_1000129 3300025297 Bacteria 185022
69 Ga0209758_1161485 3300025297 Bacteria 556
70 Ga0209050_1006476 3300025298 Bacteria 6915
71 Ga0209050_1010700 3300025298 Bacteria 4477
72 Ga0209256_1005979 3300025299 Bacteria 6687
73 Ga0209256_1008383 3300025299 Bacteria 4810
74 Ga0209256_1032560 3300025299 Bacteria 1412
75 Ga0209051_1002891 3300025303 Bacteria 11797
76 Ga0209051_1004957 3300025303 Bacteria 7956
77 Ga0209051_1056255 3300025303 Bacteria 1270
78 Ga0209257_1000182 3300025304 Bacteria 156672
79 Ga0209257_1002253 3300025304 Bacteria 19751
80 Ga0209257_1003886 3300025304 Bacteria 12194
81 Ga0209257_1070736 3300025304 Bacteria 920
82 Ga0207705_10758747 3300025909 Bacteria 754
83 Ga0207709_10196224 3300025935 Bacteria 1438
84 Ga0207711_10942738 3300025941 Bacteria 802
85 Ga0207712_10518317 3300025961 Bacteria 1021
86 Ga0207658_10000968 3300025986 Bacteria 23705
87 Ga0207702_11839634 3300026078 Bacteria 597
88 Ga0207674_10137753 3300026116 Bacteria 2402
89 Ga0207683_11273776 3300026121 Bacteria 681
90 Ga0207698_10108356 3300026142 Bacteria 2322
91 Ga0207698_12468615 3300026142 Bacteria 530
92 Ga0209973_1005543 3300027252 Bacteria 1347
93 Ga0209389_1001650 3300027296 Bacteria 16043
94 Ga0209371_1005027 3300027312 Bacteria 5450
95 Ga0210002_1039806 3300027617 Bacteria 797
96 Ga0209813_10046238 3300027866 Bacteria 1344
97 Ga0268265_10062205 3300028380 Bacteria 2867
98 Ga0307515_10064108 3300028794 Bacteria 5143
99 Ga0268256_1004264 3300030500 Bacteria 6002
100 Ga0265327_10143146 3300031251 Bacteria 1116
101 Ga0307513_10218198 3300031456 Bacteria 1731
102 Ga0307408_100000023 3300031548 Bacteria 295931
103 Ga0307408_100038396 3300031548 Bacteria 3379
104 Ga0307408_100272287 3300031548 Bacteria 1406
105 Ga0307408_100791379 3300031548 Bacteria 860
106 Ga0307408_101531504 3300031548 Bacteria 631
107 Ga0307508_10253381 3300031616 Bacteria 1356
108 Ga0307413_10810079 3300031824 Bacteria 788
109 Ga0307406_10819367 3300031901 Bacteria 787
110 Ga0307412_10198827 3300031911 Bacteria 1521
111 Ga0307412_10530506 3300031911 Bacteria 985
112 Ga0307416_100614945 3300032002 Bacteria 1168
113 Ga0307416_102337270 3300032002 Bacteria 635
114 Ga0307414_10055368 3300032004 Bacteria 2777
115 Ga0307414_10999680 3300032004 Bacteria 770
116 Ga0307411_10042706 3300032005 Bacteria 2895
117 Ga0307415_101829730 3300032126 Bacteria 588
118 Ga0373959_0173741 3300034820 Bacteria 556
119 Ga0373939_0000820 3300035114 Bacteria 7682
120 Ga0373960_0000664 3300035121 Bacteria 7081
121 Ga0373961_0162419 3300035241 Bacteria 768
122 Ga0373931_0000400 3300035691 Bacteria 17756
123 Ga0395905_0000071 3300037471 Bacteria 174580
124 Ga0395905_0105304 3300037471 Bacteria 2648
125 Ga0395905_0249522 3300037471 Bacteria 1658
126 Ga0451849_0785915 3300041505 Bacteria 847
127 Ga0439431_0089432 3300041997 Bacteria 838
128 Ga0439437_001189 3300042000 Bacteria 2726
129 Ga0439443_065657 3300042003 Bacteria 655
130 Ga0450912_002130 3300042116 Bacteria 1299
131 Ga0450920_047346 3300042122 Bacteria 860
132 Ga0450888_002724 3300042126 Bacteria 1755
133 Ga0450890_002129 3300042127 Bacteria 2768
134 Ga0450890_004502 3300042127 Bacteria 1820
135 Ga0450890_028243 3300042127 Bacteria 789
136 Ga0450891_000338 3300042129 Bacteria 4819
137 Ga0450898_107585 3300042134 Bacteria 587
138 Ga0450904_014733 3300042139 Bacteria 781
139 Ga0450889_001387 3300042144 Bacteria 2494
140 Ga0450909_018063 3300042185 Bacteria 1047
141 Ga0439434_0254501 3300042435 Bacteria 601
142 Ga0439459_0001722 3300042438 Bacteria 3270
143 Ga0439459_0016514 3300042438 Bacteria 1365
144 Ga0450893_0003596 3300042532 Bacteria 2443
145 Ga0451577_0457876 3300042876 Bacteria 1158
146 Ga0451577_1632007 3300042876 Bacteria 568
147 Ga0453683_0571464 3300044673 Bacteria 736
148 Ga0466965_0126294 3300044683 Bacteria 1323
149 Ga0466966_0064148 3300044684 Bacteria 2313
150 Ga0466961_0014966 3300044693 Bacteria 4980
151 Ga0466963_0014398 3300044694 Bacteria 4876
152 Ga0453684_0134527 3300044712 Bacteria 2962
153 Ga0453684_0347160 3300044712 Bacteria 1674
154 Ga0453684_0504607 3300044712 Bacteria 1339
155 Ga0466971_0012513 3300044719 Bacteria 3720
156 Ga0466970_0031867 3300044765 Bacteria 2784
157 Ga0466960_0370946 3300044901 Bacteria 820
158 Ga0466959_0000491 3300045049 Bacteria 23088
159 Ga0451576_0006110 3300045051 Bacteria 14839
160 Ga0451576_0167234 3300045051 Bacteria 2295
161 Ga0451576_0204431 3300045051 Bacteria 2062
162 Ga0466958_0003695 3300045836 Bacteria 7992
163 Ga0466967_0034904 3300045976 Bacteria 4274
164 Ga0495605_0162870 3300046474 Bacteria 989
165 Ga0495583_0058798 3300046506 Bacteria 1725
166 Ga0495632_0008136 3300046519 Bacteria 6484
167 Ga0495642_0090246 3300046528 Bacteria 1297
168 Ga0495654_0121492 3300046530 Bacteria 1182
169 Ga0495658_0873093 3300046683 Bacteria 575
170 Ga0495670_0047547 3300046691 Bacteria 2145
171 Ga0495649_0002161 3300046694 Bacteria 14071
172 Ga0495660_0098376 3300046810 Bacteria 1509
173 Ga0495687_001027 3300047443 Bacteria 27802
174 Ga0495687_012737 3300047443 Bacteria 4430
175 Ga0495679_073335 3300047446 Bacteria 982
176 Ga0495626_0196966 3300048091 Bacteria 828
177 Ga0496109_0612110 3300048912 Bacteria 1026
178 Ga0496113_0386007 3300048916 Bacteria 1124
179 Ga0496113_0916153 3300048916 Bacteria 693
180 Ga0496124_0125855 3300048927 Bacteria 2042
181 Ga0496126_1032627 3300048929 Bacteria 615
182 Ga0501291_019288 3300049514 Bacteria 1069
183 Ga0501293_044772 3300049516 Bacteria 513
184 Ga0501294_004503 3300049517 Bacteria 1309
185 Ga0501298_098335 3300049521 Bacteria 664
186 Ga0501300_002873 3300049523 Bacteria 2572
187 Ga0501314_002786 3300049530 Bacteria 1374
188 Ga0501318_019624 3300049534 Bacteria 845
189 Ga0501340_006083 3300049556 Bacteria 802
190 Ga0501039_0784950 3300049575 Bacteria 743
191 Ga0501071_0523602 3300049587 Bacteria 910
192 Ga0501076_1440753 3300049592 Bacteria 566
193 Ga0501199_001603 3300049650 Bacteria 2065
194 Ga0501201_002378 3300049651 Bacteria 1723
195 Ga0501202_013660 3300049652 Bacteria 1547
196 Ga0501206_038395 3300049653 Bacteria 732
197 Ga0501207_007227 3300049654 Bacteria 1580
198 Ga0501208_140340 3300049655 Bacteria 544
199 Ga0501210_000133 3300049657 Bacteria 2804
200 Ga0501211_003444 3300049658 Bacteria 1630
201 Ga0501216_010532 3300049660 Bacteria 1489
202 Ga0501217_023421 3300049661 Bacteria 1471
203 Ga0501222_021184 3300049662 Bacteria 871
204 Ga0501223_005971 3300049663 Bacteria 2534
205 Ga0501223_019207 3300049663 Bacteria 1343
206 Ga0501227_013649 3300049665 Bacteria 1792
207 Ga0501233_005538 3300049668 Bacteria 2345
208 Ga0501235_002255 3300049669 Bacteria 4149
209 Ga0501242_005876 3300049674 Bacteria 1391
210 Ga0501246_041562 3300049676 Bacteria 551
211 Ga0501249_004638 3300049679 Bacteria 2793
212 Ga0501253_002917 3300049683 Bacteria 1988
213 Ga0501255_005805 3300049684 Bacteria 1248
214 Ga0501257_081304 3300049686 Bacteria 835
215 Ga0501258_002136 3300049687 Bacteria 1704
216 Ga0501261_007192 3300049690 Bacteria 1426
217 Ga0501221_002548 3300049704 Bacteria 3003
218 Ga0501225_0015995 3300049705 Bacteria 2085
219 Ga0501229_000314 3300049706 Bacteria 5488
220 Ga0501234_007203 3300049707 Bacteria 1742
221 Ga0501232_000876 3300049757 Bacteria 2210
222 Ga0501262_002302 3300049759 Bacteria 2158
223 Ga0501262_030551 3300049759 Bacteria 774
224 Ga0501265_008532 3300049762 Bacteria 1223
225 Ga0501267_000521 3300049764 Bacteria 3015
226 Ga0501268_022716 3300049765 Bacteria 1085
227 Ga0501269_001955 3300049766 Bacteria 2603
228 Ga0501271_006399 3300049768 Bacteria 1168
229 Ga0501272_012231 3300049769 Bacteria 973
230 Ga0501274_000923 3300049771 Bacteria 2183
231 Ga0501278_015639 3300049774 Bacteria 655
232 Ga0501280_030227 3300049776 Bacteria 843
233 Ga0501035_0158828 3300049822 Bacteria 1958
234 Ga0501045_0707697 3300049824 Bacteria 743
235 Ga0501226_002953 3300049853 Bacteria 2043
236 nmdc:mga03683_9751_c1 3300050489 Bacteria 2301
237 nmdc:mga03n38_192775_c1 3300050490 Bacteria 1051
238 nmdc:mga0k408_175268_c1 3300050493 Bacteria 1278
239 nmdc:mga0k408_191030_c1 3300050493 Bacteria 1222
240 nmdc:mga0k408_225184_c1 3300050493 Bacteria 1120
241 nmdc:mga0k408_435728_c1 3300050493 Bacteria 779
242 nmdc:mga0k408_43752_c1 3300050493 Bacteria 2582
243 nmdc:mga0k408_565_c1 3300050493 Bacteria 20434
244 nmdc:mga0k408_96999_c1 3300050493 Bacteria 1736
245 nmdc:mga06z11_26746_c1 3300050494 Bacteria 2750
246 nmdc:mga04h51_112404_c1 3300050495 Bacteria 1006
247 nmdc:mga07m45_35365_c1 3300050496 Bacteria 2778
248 nmdc:mga07m45_412621_c1 3300050496 Bacteria 784
249 nmdc:mga07m45_600228_c1 3300050496 Bacteria 636
250 nmdc:mga07m45_9342_c1 3300050496 Bacteria 5083
251 nmdc:mga05p37_389871_c1 3300050507 Bacteria 1629
252 nmdc:mga08y16_1442631_c1 3300050511 Bacteria 650
253 nmdc:mga0sz30_33107_c1 3300050516 Bacteria 2147
254 Ga0500578_0288721 3300053086 Bacteria 976
255 Ga0500593_004453 3300053117 Bacteria 5424
256 Ga0500568_0043971 3300053139 Bacteria 1783
257 Ga0500622_0035639 3300053156 Bacteria 2603
258 Ga0590071_038969 3300059421 Bacteria 1142
259 Ga0466962_0022328 3300061719 Bacteria 3040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_11073088 Ga0105245_110730882 73
2 3300013307 Ga0157372_12775467 Ga0157372_127754672 74
3 3300005445 Ga0070708_100110016 Ga0070708_1001100163 75
4 3300005456 Ga0070678_101985509 Ga0070678_1019855092 75
5 3300026121 Ga0207683_11273776 Ga0207683_112737762 75
6 3300026142 Ga0207698_12468615 Ga0207698_124686152 75
7 3300037471 Ga0395905_0105304 Ga0395905_0105304_1636_1863 75
8 3300050507 nmdc:mga05p37_389871_c1 nmdc:mga05p37_389871_c1_365_592 75
9 iso_pu_bacteria 2643221585 2643933031 75
10 iso_pu_bacteria 2643221639 2644217173 75
11 iso_pu_bacteria 2643221646 2644259054 75
12 iso_pu_bacteria 2643221656 2644314280 75
13 iso_pu_bacteria 2738541337 2739055798 75
14 3300002773 JGI25152J39213_1000752 JGI25152J39213_100075211 76
15 3300002774 JGI25150J39212_1004196 JGI25150J39212_10041963 76
16 3300003215 JGI25153J46596_10014796 JGI25153J46596_100147964 76
17 3300003771 Ga0055526_1009134 Ga0055526_10091343 76
18 3300005347 Ga0070668_100468775 Ga0070668_1004687752 76
19 3300005617 Ga0068859_101486156 Ga0068859_1014861562 76
20 3300006195 Ga0075366_10063663 Ga0075366_100636632 76
21 3300006931 Ga0097620_101486051 Ga0097620_1014860512 76
22 3300009094 Ga0111539_10396325 Ga0111539_103963253 76
23 3300009177 Ga0105248_11560771 Ga0105248_115607712 76
24 3300013308 Ga0157375_10159070 Ga0157375_101590704 76
25 3300025245 Ga0207425_1003440 Ga0207425_10034404 76
26 3300025258 Ga0209129_1000062 Ga0209129_1000062165 76
27 3300025273 Ga0209673_1013829 Ga0209673_10138294 76
28 3300025295 Ga0209564_1000176 Ga0209564_100017685 76
29 3300025297 Ga0209758_1000129 Ga0209758_10001294 76
30 3300025909 Ga0207705_10758747 Ga0207705_107587472 76
31 3300025941 Ga0207711_10942738 Ga0207711_109427382 76
32 3300025986 Ga0207658_10000968 Ga0207658_1000096817 76
33 3300028794 Ga0307515_10064108 Ga0307515_100641086 76
34 3300031251 Ga0265327_10143146 Ga0265327_101431462 76
35 3300031456 Ga0307513_10218198 Ga0307513_102181983 76
36 3300031548 Ga0307408_100791379 Ga0307408_1007913792 76
37 3300031548 Ga0307408_101531504 Ga0307408_1015315042 76
38 3300031824 Ga0307413_10810079 Ga0307413_108100792 76
39 3300031901 Ga0307406_10819367 Ga0307406_108193672 76
40 3300031911 Ga0307412_10198827 Ga0307412_101988271 76
41 3300031911 Ga0307412_10530506 Ga0307412_105305062 76
42 3300032002 Ga0307416_100614945 Ga0307416_1006149452 76
43 3300032002 Ga0307416_102337270 Ga0307416_1023372702 76
44 3300032004 Ga0307414_10999680 Ga0307414_109996802 76
45 3300032126 Ga0307415_101829730 Ga0307415_1018297301 76
46 3300041997 Ga0439431_0089432 Ga0439431_0089432_207_437 76
47 3300042127 Ga0450890_028243 Ga0450890_028243_433_663 76
48 3300042134 Ga0450898_107585 Ga0450898_107585_308_538 76
49 3300042185 Ga0450909_018063 Ga0450909_018063_337_597 76
50 3300042435 Ga0439434_0254501 Ga0439434_0254501_16_246 76
51 3300042876 Ga0451577_1632007 Ga0451577_1632007_139_372 76
52 3300044712 Ga0453684_0347160 Ga0453684_0347160_1061_1294 76
53 3300046683 Ga0495658_0873093 Ga0495658_0873093_89_319 76
54 3300048916 Ga0496113_0386007 Ga0496113_0386007_823_1053 76
55 3300048916 Ga0496113_0916153 Ga0496113_0916153_210_440 76
56 3300049587 Ga0501071_0523602 Ga0501071_0523602_77_307 76
57 3300049592 Ga0501076_1440753 Ga0501076_1440753_10_240 76
58 3300049653 Ga0501206_038395 Ga0501206_038395_400_660 76
59 3300049824 Ga0501045_0707697 Ga0501045_0707697_310_540 76
60 3300050493 nmdc:mga0k408_225184_c1 nmdc:mga0k408_225184_c1_471_704 76
61 3300050511 nmdc:mga08y16_1442631_c1 nmdc:mga08y16_1442631_c1_202_432 76
62 3300059421 Ga0590071_038969 Ga0590071_038969_539_799 76
63 3300027252 Ga0209973_1005543 Ga0209973_10055432 77
64 3300027617 Ga0210002_1039806 Ga0210002_10398062 77
65 3300037471 Ga0395905_0249522 Ga0395905_0249522_1185_1418 77
66 3300048912 Ga0496109_0612110 Ga0496109_0612110_582_815 77
67 iso_pu_bacteria 2831864461 2831869389 78
68 iso_pu_bacteria 2886848708 2886849889 78
69 3300003316 rootH1_10017790 rootH1_100177903 79
70 3300003322 rootL2_10000580 rootL2_100005802 79
71 3300003323 rootH1_10125484 rootH1_101254842 79
72 3300003794 Ga0055531_10000043 Ga0055531_10000043111 79
73 3300005577 Ga0068857_100698488 Ga0068857_1006984882 79
74 3300006048 Ga0075363_100010995 Ga0075363_1000109954 79
75 3300006051 Ga0075364_10132666 Ga0075364_101326664 79
76 3300006177 Ga0075362_10031183 Ga0075362_100311834 79
77 3300006178 Ga0075367_10064695 Ga0075367_100646954 79
78 3300006186 Ga0075369_10019440 Ga0075369_100194404 79
79 3300006195 Ga0075366_10102003 Ga0075366_101020031 79
80 3300006195 Ga0075366_10314733 Ga0075366_103147332 79
81 3300006237 Ga0097621_101655439 Ga0097621_1016554392 79
82 3300006353 Ga0075370_10207573 Ga0075370_102075732 79
83 3300006881 Ga0068865_101116613 Ga0068865_1011166132 79
84 3300009148 Ga0105243_10318964 Ga0105243_103189642 79
85 3300014325 Ga0163163_11640227 Ga0163163_116402272 79
86 3300025298 Ga0209050_1006476 Ga0209050_10064766 79
87 3300025303 Ga0209051_1004957 Ga0209051_10049574 79
88 3300025304 Ga0209257_1000182 Ga0209257_1000182102 79
89 3300025304 Ga0209257_1070736 Ga0209257_10707362 79
90 3300025935 Ga0207709_10196224 Ga0207709_101962242 79
91 3300026116 Ga0207674_10137753 Ga0207674_101377532 79
92 3300027866 Ga0209813_10046238 Ga0209813_100462382 79
93 3300031548 Ga0307408_100000023 Ga0307408_10000002330 79
94 3300031548 Ga0307408_100272287 Ga0307408_1002722874 79
95 3300031616 Ga0307508_10253381 Ga0307508_102533812 79
96 3300032004 Ga0307414_10055368 Ga0307414_100553684 79
97 3300032005 Ga0307411_10042706 Ga0307411_100427064 79
98 3300034820 Ga0373959_0173741 Ga0373959_0173741_217_459 79
99 3300035114 Ga0373939_0000820 Ga0373939_0000820_5330_5572 79
100 3300035121 Ga0373960_0000664 Ga0373960_0000664_1846_2088 79
101 3300035241 Ga0373961_0162419 Ga0373961_0162419_366_608 79
102 3300035691 Ga0373931_0000400 Ga0373931_0000400_16340_16582 79
103 3300041505 Ga0451849_0785915 Ga0451849_0785915_503_745 79
104 3300042000 Ga0439437_001189 Ga0439437_001189_1669_1911 79
105 3300042116 Ga0450912_002130 Ga0450912_002130_555_797 79
106 3300042122 Ga0450920_047346 Ga0450920_047346_241_483 79
107 3300042126 Ga0450888_002724 Ga0450888_002724_1297_1539 79
108 3300042127 Ga0450890_002129 Ga0450890_002129_2310_2552 79
109 3300042129 Ga0450891_000338 Ga0450891_000338_1479_1721 79
110 3300042139 Ga0450904_014733 Ga0450904_014733_364_606 79
111 3300042144 Ga0450889_001387 Ga0450889_001387_1646_1888 79
112 3300042438 Ga0439459_0016514 Ga0439459_0016514_192_434 79
113 3300042532 Ga0450893_0003596 Ga0450893_0003596_97_339 79
114 3300044712 Ga0453684_0504607 Ga0453684_0504607_707_949 79
115 3300045051 Ga0451576_0167234 Ga0451576_0167234_1061_1303 79
116 3300045051 Ga0451576_0204431 Ga0451576_0204431_1659_1901 79
117 3300046474 Ga0495605_0162870 Ga0495605_0162870_24_275 79
118 3300046506 Ga0495583_0058798 Ga0495583_0058798_338_589 79
119 3300046519 Ga0495632_0008136 Ga0495632_0008136_87_338 79
120 3300046528 Ga0495642_0090246 Ga0495642_0090246_440_691 79
121 3300046530 Ga0495654_0121492 Ga0495654_0121492_429_680 79
122 3300046694 Ga0495649_0002161 Ga0495649_0002161_12657_12908 79
123 3300046810 Ga0495660_0098376 Ga0495660_0098376_320_571 79
124 3300047443 Ga0495687_012737 Ga0495687_012737_2016_2267 79
125 3300047446 Ga0495679_073335 Ga0495679_073335_692_943 79
126 3300048091 Ga0495626_0196966 Ga0495626_0196966_23_274 79
127 3300049514 Ga0501291_019288 Ga0501291_019288_88_330 79
128 3300049516 Ga0501293_044772 Ga0501293_044772_27_269 79
129 3300049517 Ga0501294_004503 Ga0501294_004503_384_626 79
130 3300049521 Ga0501298_098335 Ga0501298_098335_185_427 79
131 3300049523 Ga0501300_002873 Ga0501300_002873_810_1052 79
132 3300049530 Ga0501314_002786 Ga0501314_002786_1036_1278 79
133 3300049534 Ga0501318_019624 Ga0501318_019624_64_306 79
134 3300049556 Ga0501340_006083 Ga0501340_006083_101_343 79
135 3300049650 Ga0501199_001603 Ga0501199_001603_1132_1374 79
136 3300049651 Ga0501201_002378 Ga0501201_002378_1009_1251 79
137 3300049652 Ga0501202_013660 Ga0501202_013660_832_1074 79
138 3300049654 Ga0501207_007227 Ga0501207_007227_1174_1416 79
139 3300049655 Ga0501208_140340 Ga0501208_140340_22_264 79
140 3300049657 Ga0501210_000133 Ga0501210_000133_1399_1641 79
141 3300049658 Ga0501211_003444 Ga0501211_003444_726_968 79
142 3300049660 Ga0501216_010532 Ga0501216_010532_1117_1359 79
143 3300049661 Ga0501217_023421 Ga0501217_023421_402_644 79
144 3300049662 Ga0501222_021184 Ga0501222_021184_519_761 79
145 3300049663 Ga0501223_005971 Ga0501223_005971_2043_2285 79
146 3300049663 Ga0501223_019207 Ga0501223_019207_1067_1309 79
147 3300049665 Ga0501227_013649 Ga0501227_013649_658_900 79
148 3300049668 Ga0501233_005538 Ga0501233_005538_489_731 79
149 3300049669 Ga0501235_002255 Ga0501235_002255_1113_1355 79
150 3300049674 Ga0501242_005876 Ga0501242_005876_887_1129 79
151 3300049676 Ga0501246_041562 Ga0501246_041562_79_321 79
152 3300049679 Ga0501249_004638 Ga0501249_004638_1473_1715 79
153 3300049683 Ga0501253_002917 Ga0501253_002917_1267_1509 79
154 3300049684 Ga0501255_005805 Ga0501255_005805_728_970 79
155 3300049686 Ga0501257_081304 Ga0501257_081304_271_513 79
156 3300049687 Ga0501258_002136 Ga0501258_002136_491_733 79
157 3300049690 Ga0501261_007192 Ga0501261_007192_328_570 79
158 3300049704 Ga0501221_002548 Ga0501221_002548_1133_1375 79
159 3300049705 Ga0501225_0015995 Ga0501225_0015995_796_1038 79
160 3300049706 Ga0501229_000314 Ga0501229_000314_4207_4449 79
161 3300049707 Ga0501234_007203 Ga0501234_007203_15_257 79
162 3300049757 Ga0501232_000876 Ga0501232_000876_555_797 79
163 3300049759 Ga0501262_002302 Ga0501262_002302_1486_1728 79
164 3300049759 Ga0501262_030551 Ga0501262_030551_95_337 79
165 3300049762 Ga0501265_008532 Ga0501265_008532_538_780 79
166 3300049764 Ga0501267_000521 Ga0501267_000521_1174_1416 79
167 3300049765 Ga0501268_022716 Ga0501268_022716_417_659 79
168 3300049766 Ga0501269_001955 Ga0501269_001955_1291_1533 79
169 3300049768 Ga0501271_006399 Ga0501271_006399_750_992 79
170 3300049769 Ga0501272_012231 Ga0501272_012231_100_342 79
171 3300049771 Ga0501274_000923 Ga0501274_000923_1703_1945 79
172 3300049774 Ga0501278_015639 Ga0501278_015639_402_644 79
173 3300049776 Ga0501280_030227 Ga0501280_030227_368_610 79
174 3300049853 Ga0501226_002953 Ga0501226_002953_528_770 79
175 3300050489 nmdc:mga03683_9751_c1 nmdc:mga03683_9751_c1_1482_1733 79
176 3300050490 nmdc:mga03n38_192775_c1 nmdc:mga03n38_192775_c1_630_881 79
177 3300050493 nmdc:mga0k408_435728_c1 nmdc:mga0k408_435728_c1_338_580 79
178 3300050493 nmdc:mga0k408_565_c1 nmdc:mga0k408_565_c1_15126_15377 79
179 3300050493 nmdc:mga0k408_565_c1 nmdc:mga0k408_565_c1_18198_18449 79
180 3300050493 nmdc:mga0k408_96999_c1 nmdc:mga0k408_96999_c1_1399_1650 79
181 3300050494 nmdc:mga06z11_26746_c1 nmdc:mga06z11_26746_c1_1253_1504 79
182 3300050495 nmdc:mga04h51_112404_c1 nmdc:mga04h51_112404_c1_225_476 79
183 3300050496 nmdc:mga07m45_600228_c1 nmdc:mga07m45_600228_c1_79_321 79
184 3300050496 nmdc:mga07m45_9342_c1 nmdc:mga07m45_9342_c1_1285_1536 79
185 3300050516 nmdc:mga0sz30_33107_c1 nmdc:mga0sz30_33107_c1_1209_1460 79
186 3300053086 Ga0500578_0288721 Ga0500578_0288721_581_832 79
187 3300053139 Ga0500568_0043971 Ga0500568_0043971_553_804 79
188 3300005614 Ga0068856_100449837 Ga0068856_1004498371 80
189 3300005844 Ga0068862_100031437 Ga0068862_1000314374 80
190 3300006195 Ga0075366_10014699 Ga0075366_100146994 80
191 3300025299 Ga0209256_1032560 Ga0209256_10325602 80
192 3300025961 Ga0207712_10518317 Ga0207712_105183171 80
193 3300026078 Ga0207702_11839634 Ga0207702_118396342 80
194 3300028380 Ga0268265_10062205 Ga0268265_100622053 80
195 3300037471 Ga0395905_0000071 Ga0395905_0000071_84614_84859 80
196 3300044901 Ga0466960_0370946 Ga0466960_0370946_196_441 80
197 3300050493 nmdc:mga0k408_43752_c1 nmdc:mga0k408_43752_c1_339_581 80
198 3300053117 Ga0500593_004453 Ga0500593_004453_4213_4458 81
199 3300001979 JGI24740J21852_10003715 JGI24740J21852_100037154 82
200 3300003320 rootH2_10043945 rootH2_100439452 82
201 3300003322 rootL2_10000579 rootL2_1000057918 82
202 3300003323 rootH1_10016701 rootH1_100167012 82
203 3300003323 rootH1_10044409 rootH1_100444092 82
204 3300003771 Ga0055526_1007400 Ga0055526_10074005 82
205 3300003775 Ga0055524_1000733 Ga0055524_100073321 82
206 3300003775 Ga0055524_1005494 Ga0055524_10054946 82
207 3300003792 Ga0055540_1030319 Ga0055540_10303192 82
208 3300003794 Ga0055531_10007153 Ga0055531_100071531 82
209 3300003794 Ga0055531_10021663 Ga0055531_100216632 82
210 3300005262 Ga0065165_1000016 Ga0065165_1000016160 82
211 3300005535 Ga0070684_100462434 Ga0070684_1004624342 82
212 3300005563 Ga0068855_100123577 Ga0068855_1001235772 82
213 3300005577 Ga0068857_101277561 Ga0068857_1012775612 82
214 3300005616 Ga0068852_100128943 Ga0068852_1001289432 82
215 3300006195 Ga0075366_10039564 Ga0075366_100395644 82
216 3300006353 Ga0075370_10000954 Ga0075370_100009549 82
217 3300006353 Ga0075370_10096275 Ga0075370_100962754 82
218 3300006844 Ga0075428_101324095 Ga0075428_1013240952 82
219 3300006944 Ga0099823_1000101 Ga0099823_100010111 82
220 3300012475 Ga0157317_1000388 Ga0157317_10003882 82
221 3300013297 Ga0157378_13074269 Ga0157378_130742692 82
222 3300025242 Ga0209258_119930 Ga0209258_1199302 82
223 3300025273 Ga0209673_1028406 Ga0209673_10284064 82
224 3300025273 Ga0209673_1063031 Ga0209673_10630311 82
225 3300025273 Ga0209673_1071764 Ga0209673_10717642 82
226 3300025295 Ga0209564_1000008 Ga0209564_1000008383 82
227 3300025297 Ga0209758_1161485 Ga0209758_11614851 82
228 3300025298 Ga0209050_1010700 Ga0209050_10107004 82
229 3300025299 Ga0209256_1005979 Ga0209256_10059794 82
230 3300025299 Ga0209256_1008383 Ga0209256_10083834 82
231 3300025303 Ga0209051_1002891 Ga0209051_10028913 82
232 3300025303 Ga0209051_1056255 Ga0209051_10562552 82
233 3300025304 Ga0209257_1002253 Ga0209257_10022534 82
234 3300025304 Ga0209257_1003886 Ga0209257_10038865 82
235 3300026142 Ga0207698_10108356 Ga0207698_101083564 82
236 3300027296 Ga0209389_1001650 Ga0209389_10016507 82
237 3300027312 Ga0209371_1005027 Ga0209371_10050274 82
238 3300030500 Ga0268256_1004264 Ga0268256_10042646 82
239 3300031548 Ga0307408_100038396 Ga0307408_1000383964 82
240 3300042003 Ga0439443_065657 Ga0439443_065657_342_593 82
241 3300042127 Ga0450890_004502 Ga0450890_004502_482_733 82
242 3300042438 Ga0439459_0001722 Ga0439459_0001722_1549_1800 82
243 3300042876 Ga0451577_0457876 Ga0451577_0457876_78_329 82
244 3300044673 Ga0453683_0571464 Ga0453683_0571464_455_706 82
245 3300044683 Ga0466965_0126294 Ga0466965_0126294_203_460 82
246 3300044684 Ga0466966_0064148 Ga0466966_0064148_938_1195 82
247 3300044693 Ga0466961_0014966 Ga0466961_0014966_1245_1502 82
248 3300044694 Ga0466963_0014398 Ga0466963_0014398_1673_1930 82
249 3300044712 Ga0453684_0134527 Ga0453684_0134527_1103_1354 82
250 3300044719 Ga0466971_0012513 Ga0466971_0012513_2743_3000 82
251 3300044765 Ga0466970_0031867 Ga0466970_0031867_863_1120 82
252 3300045049 Ga0466959_0000491 Ga0466959_0000491_19664_19921 82
253 3300045051 Ga0451576_0006110 Ga0451576_0006110_1270_1521 82
254 3300045836 Ga0466958_0003695 Ga0466958_0003695_5299_5556 82
255 3300045976 Ga0466967_0034904 Ga0466967_0034904_2121_2378 82
256 3300046691 Ga0495670_0047547 Ga0495670_0047547_433_684 82
257 3300047443 Ga0495687_001027 Ga0495687_001027_1152_1412 82
258 3300048927 Ga0496124_0125855 Ga0496124_0125855_1413_1664 82
259 3300048929 Ga0496126_1032627 Ga0496126_1032627_212_466 82
260 3300049575 Ga0501039_0784950 Ga0501039_0784950_174_428 82
261 3300049822 Ga0501035_0158828 Ga0501035_0158828_1131_1385 82
262 3300050493 nmdc:mga0k408_175268_c1 nmdc:mga0k408_175268_c1_255_524 82
263 3300050493 nmdc:mga0k408_191030_c1 nmdc:mga0k408_191030_c1_841_1104 82
264 3300050496 nmdc:mga07m45_35365_c1 nmdc:mga07m45_35365_c1_223_474 82
265 3300050496 nmdc:mga07m45_412621_c1 nmdc:mga07m45_412621_c1_110_373 82
266 3300053156 Ga0500622_0035639 Ga0500622_0035639_1270_1521 82
267 3300061719 Ga0466962_0022328 Ga0466962_0022328_1665_1922 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11174

DUF2970

Protein of unknown function (DUF2970)

25

80

0.98

Feature Viewer

pLDDT pTM Quality
70.62 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map