F374730

General Info

Members Datasets Scaffolds Average Seq Length
267 161 267 212

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10313694|Ga0114129_103136941
Length 239
Sequence LPQLILNGLHMSSTPSQIASNFAQTAASLSAIAKAFHARGWLLGTSGNLSAVVSRDPLRLAMSPSGIDKGELTAAQVLLVDEQAQVLSDHRGKPSDETLLHLRIVNDRHAGAVLHTHSVWNTILSDLYAADGGINIEGYEMLKGLTGIRTHEHSEWLPIIENSQDMTALASSIGETLLNNSQAHGLLLRRHGLYSWGTNLHEAKRHIEILEFLLETIGRTLELKGLGLGAQASSPAGND

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
149 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
150 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
151 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
152 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 2.25
Rhizosphere 97.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10069084 3300005293 Bacteria 806
2 Ga0065707_10101518 3300005295 Bacteria 2860
3 Ga0065707_10114841 3300005295 Unclassified 2285
4 Ga0070683_100097905 3300005329 Bacteria 2760
5 Ga0070670_100714301 3300005331 Bacteria 902
6 Ga0068869_100049981 3300005334 Unclassified 3030
7 Ga0068869_100412293 3300005334 Bacteria 1113
8 Ga0070680_100001080 3300005336 Bacteria 19582
9 Ga0068868_100231784 3300005338 Bacteria 1549
10 Ga0070689_100016955 3300005340 Bacteria 5341
11 Ga0070687_100058714 3300005343 Bacteria 2022
12 Ga0070661_100063919 3300005344 Bacteria 2704
13 Ga0070661_100363053 3300005344 Unclassified 1138
14 Ga0070692_10123472 3300005345 Unclassified 1447
15 Ga0070692_10449579 3300005345 Unclassified 824
16 Ga0070669_100229958 3300005353 Unclassified 1469
17 Ga0070669_100348676 3300005353 Bacteria 1201
18 Ga0070675_100790941 3300005354 Bacteria 867
19 Ga0070675_100937779 3300005354 Bacteria 794
20 Ga0070688_100167982 3300005365 Bacteria 1512
21 Ga0070667_100010496 3300005367 Bacteria 7650
22 Ga0070703_10002161 3300005406 Bacteria 5718
23 Ga0070701_10063560 3300005438 Bacteria 1953
24 Ga0070705_100005738 3300005440 Bacteria 6063
25 Ga0070705_100319767 3300005440 Bacteria 1120
26 Ga0070694_100007600 3300005444 Bacteria 6614
27 Ga0070694_100134836 3300005444 Bacteria 1788
28 Ga0070694_100423675 3300005444 Bacteria 1046
29 Ga0070678_100063321 3300005456 Bacteria 2736
30 Ga0070662_100686582 3300005457 Unclassified 865
31 Ga0070681_10006535 3300005458 Bacteria 11350
32 Ga0068867_100332601 3300005459 Bacteria 1262
33 Ga0070685_10158350 3300005466 Bacteria 1441
34 Ga0070707_100015435 3300005468 Bacteria 7167
35 Ga0070698_100002938 3300005471 Bacteria 18748
36 Ga0070698_100007337 3300005471 Bacteria 11935
37 Ga0070698_100009797 3300005471 Bacteria 10243
38 Ga0070698_100880694 3300005471 Bacteria 841
39 Ga0070699_100079331 3300005518 Bacteria 2860
40 Ga0070699_100510894 3300005518 Unclassified 1092
41 Ga0070679_100000502 3300005530 Bacteria 33348
42 Ga0070679_100016465 3300005530 Bacteria 7133
43 Ga0070684_100530929 3300005535 Unclassified 1091
44 Ga0068853_100057577 3300005539 Unclassified 3354
45 Ga0070695_100004154 3300005545 Bacteria 8465
46 Ga0070695_100070872 3300005545 Unclassified 2281
47 Ga0070695_100907115 3300005545 Unclassified 712
48 Ga0070696_100057408 3300005546 Bacteria 2717
49 Ga0070696_100218746 3300005546 Bacteria 1428
50 Ga0070693_100184103 3300005547 Unclassified 1347
51 Ga0070693_100357867 3300005547 Bacteria 1001
52 Ga0070693_100543551 3300005547 Unclassified 830
53 Ga0070704_100029605 3300005549 Bacteria 3658
54 Ga0070704_100185666 3300005549 Bacteria 1667
55 Ga0068855_100042729 3300005563 Bacteria 5371
56 Ga0070664_100007448 3300005564 Bacteria 8838
57 Ga0068857_100017147 3300005577 Bacteria 6344
58 Ga0068854_100563544 3300005578 Bacteria 968
59 Ga0068856_100113111 3300005614 Bacteria 2713
60 Ga0068852_100346700 3300005616 Bacteria 1449
61 Ga0068859_100060808 3300005617 Bacteria 3806
62 Ga0068859_100125255 3300005617 Bacteria 2638
63 Ga0068859_100363724 3300005617 Bacteria 1542
64 Ga0068859_100541232 3300005617 Bacteria 1259
65 Ga0068859_100891136 3300005617 Bacteria 975
66 Ga0068864_100017378 3300005618 Bacteria 5997
67 Ga0068864_100052683 3300005618 Bacteria 3508
68 Ga0068864_100092821 3300005618 Bacteria 2665
69 Ga0068864_100135919 3300005618 Bacteria 2213
70 Ga0068864_100188936 3300005618 Bacteria 1887
71 Ga0068864_100236898 3300005618 Bacteria 1690
72 Ga0068863_100041083 3300005841 Bacteria 4396
73 Ga0068863_100094594 3300005841 Bacteria 2836
74 Ga0068858_100040731 3300005842 Unclassified 4309
75 Ga0068858_100087993 3300005842 Unclassified 2889
76 Ga0068860_100041485 3300005843 Bacteria 4395
77 Ga0068860_100460754 3300005843 Bacteria 1265
78 Ga0068860_101111814 3300005843 Bacteria 810
79 Ga0068862_100193813 3300005844 Bacteria 1830
80 Ga0068862_100387159 3300005844 Bacteria 1305
81 Ga0070716_100000009 3300006173 Bacteria 173295
82 Ga0097621_100174639 3300006237 Bacteria 1854
83 Ga0068871_100118906 3300006358 Unclassified 2230
84 Ga0075433_10014857 3300006852 Bacteria 6372
85 Ga0075433_10083601 3300006852 Unclassified 2818
86 Ga0075433_10187271 3300006852 Bacteria 1841
87 Ga0075434_100235001 3300006871 Bacteria 1853
88 Ga0075434_100379309 3300006871 Unclassified 1435
89 Ga0068865_100333243 3300006881 Bacteria 1224
90 Ga0075436_100172944 3300006914 Bacteria 1525
91 Ga0097620_100024441 3300006931 Bacteria 6061
92 Ga0097620_100060808 3300006931 Bacteria 3806
93 Ga0097620_100125252 3300006931 Bacteria 2638
94 Ga0097620_100363704 3300006931 Bacteria 1542
95 Ga0097620_100541243 3300006931 Bacteria 1259
96 Ga0097620_100891108 3300006931 Bacteria 975
97 Ga0075435_100036855 3300007076 Bacteria 3890
98 Ga0075435_100351438 3300007076 Bacteria 1263
99 Ga0111539_10005527 3300009094 Bacteria 16347
100 Ga0111539_10275515 3300009094 Unclassified 1958
101 Ga0111539_10328490 3300009094 Bacteria 1780
102 Ga0114129_10166173 3300009147 Bacteria 3011
103 Ga0114129_10248333 3300009147 Bacteria 2389
104 Ga0114129_10313694 3300009147 Unclassified 2087
105 Ga0105243_10117159 3300009148 Bacteria 2239
106 Ga0105241_10066160 3300009174 Bacteria 2794
107 Ga0105241_10170697 3300009174 Bacteria 1796
108 Ga0105242_10026020 3300009176 Bacteria 4634
109 Ga0105248_10016729 3300009177 Bacteria 8075
110 Ga0105248_10066395 3300009177 Bacteria 4051
111 Ga0105238_10266904 3300009551 Bacteria 1692
112 Ga0105249_10113477 3300009553 Bacteria 2564
113 Ga0105249_10594837 3300009553 Bacteria 1160
114 Ga0105239_10308357 3300010375 Bacteria 1784
115 Ga0105246_10266412 3300011119 Bacteria 1367
116 Ga0157373_10038219 3300013100 Bacteria 3441
117 Ga0157373_10085921 3300013100 Bacteria 2217
118 Ga0157374_10054930 3300013296 Unclassified 3716
119 Ga0157378_10003980 3300013297 Bacteria 13058
120 Ga0157378_10041378 3300013297 Bacteria 4087
121 Ga0157378_10275017 3300013297 Bacteria 1621
122 Ga0157378_10818178 3300013297 Unclassified 958
123 Ga0163162_10085125 3300013306 Bacteria 3238
124 Ga0163162_10506209 3300013306 Unclassified 1338
125 Ga0157372_10074128 3300013307 Bacteria 3837
126 Ga0157372_10604012 3300013307 Bacteria 1279
127 Ga0163163_10063945 3300014325 Bacteria 3650
128 Ga0163163_10113445 3300014325 Bacteria 2740
129 Ga0163163_10136875 3300014325 Bacteria 2490
130 Ga0163163_10199451 3300014325 Bacteria 2049
131 Ga0157380_10372307 3300014326 Bacteria 1345
132 Ga0157376_10428268 3300014969 Bacteria 1285
133 Ga0163161_10082770 3300017792 Bacteria 2365
134 Ga0163161_10833335 3300017792 Bacteria 777
135 Ga0213872_10035741 3300021361 Bacteria 2271
136 Ga0207653_10010375 3300025885 Bacteria 2905
137 Ga0207643_10101451 3300025908 Bacteria 1688
138 Ga0207654_10011943 3300025911 Bacteria 4440
139 Ga0207707_10000004 3300025912 Bacteria 391281
140 Ga0207707_10010053 3300025912 Bacteria 8207
141 Ga0207660_10001262 3300025917 Bacteria 16979
142 Ga0207660_10045850 3300025917 Unclassified 3082
143 Ga0207660_10732592 3300025917 Bacteria 807
144 Ga0207662_10005106 3300025918 Bacteria 6964
145 Ga0207649_10021324 3300025920 Bacteria 3728
146 Ga0207652_10000941 3300025921 Bacteria 27359
147 Ga0207652_10006605 3300025921 Bacteria 9348
148 Ga0207646_10007518 3300025922 Bacteria 11055
149 Ga0207650_10217534 3300025925 Bacteria 1536
150 Ga0207686_10207017 3300025934 Unclassified 1408
151 Ga0207709_10249848 3300025935 Bacteria 1295
152 Ga0207670_10001000 3300025936 Bacteria 14947
153 Ga0207704_10527870 3300025938 Bacteria 956
154 Ga0207665_10000001 3300025939 Bacteria 279842
155 Ga0207711_10028793 3300025941 Bacteria 4678
156 Ga0207711_10124365 3300025941 Bacteria 2306
157 Ga0207711_10574728 3300025941 Unclassified 1051
158 Ga0207689_10093790 3300025942 Bacteria 2466
159 Ga0207689_10100091 3300025942 Bacteria 2382
160 Ga0207689_10174472 3300025942 Unclassified 1772
161 Ga0207679_10216314 3300025945 Bacteria 1610
162 Ga0207667_11006444 3300025949 Bacteria 820
163 Ga0207712_10362684 3300025961 Bacteria 1208
164 Ga0207668_10601331 3300025972 Bacteria 958
165 Ga0207640_10667164 3300025981 Bacteria 888
166 Ga0207658_10093579 3300025986 Unclassified 2337
167 Ga0207703_10148698 3300026035 Bacteria 2040
168 Ga0207703_10603895 3300026035 Bacteria 1038
169 Ga0207703_10702024 3300026035 Bacteria 962
170 Ga0207639_10091125 3300026041 Bacteria 2440
171 Ga0207641_10047474 3300026088 Bacteria 3621
172 Ga0207641_10171235 3300026088 Unclassified 1982
173 Ga0207641_10388939 3300026088 Unclassified 1337
174 Ga0207648_10062791 3300026089 Unclassified 3238
175 Ga0207676_10005029 3300026095 Bacteria 9360
176 Ga0207676_10052858 3300026095 Bacteria 3177
177 Ga0207676_10311076 3300026095 Unclassified 1442
178 Ga0207676_10479892 3300026095 Bacteria 1177
179 Ga0207674_10000054 3300026116 Bacteria 114198
180 Ga0207674_10869749 3300026116 Unclassified 869
181 Ga0207683_10322140 3300026121 Bacteria 1416
182 Ga0207698_10242141 3300026142 Bacteria 1645
183 Ga0207698_10778627 3300026142 Bacteria 957
184 Ga0207428_10141254 3300027907 Unclassified 1838
185 Ga0268265_10011995 3300028380 Bacteria 5865
186 Ga0268265_10709196 3300028380 Bacteria 973
187 Ga0268264_10080882 3300028381 Unclassified 2775
188 Ga0268264_10399751 3300028381 Bacteria 1320
189 Ga0268264_10602923 3300028381 Bacteria 1082
190 Ga0265760_10113544 3300031090 Unclassified 865
191 Ga0307408_100063031 3300031548 Bacteria 2711
192 Ga0307408_100299298 3300031548 Bacteria 1347
193 Ga0307405_10036576 3300031731 Bacteria 2943
194 Ga0307413_10001823 3300031824 Bacteria 8370
195 Ga0307410_10000199 3300031852 Bacteria 22521
196 Ga0307410_10001494 3300031852 Bacteria 10606
197 Ga0307406_10054480 3300031901 Bacteria 2553
198 Ga0307406_10326510 3300031901 Unclassified 1189
199 Ga0307407_10008628 3300031903 Bacteria 4693
200 Ga0307407_10053186 3300031903 Bacteria 2329
201 Ga0307412_10261452 3300031911 Bacteria 1349
202 Ga0307412_10375793 3300031911 Unclassified 1149
203 Ga0307409_100001157 3300031995 Bacteria 12567
204 Ga0307409_100001367 3300031995 Bacteria 11903
205 Ga0307409_100020369 3300031995 Bacteria 4518
206 Ga0307409_100576876 3300031995 Bacteria 1108
207 Ga0307416_100001886 3300032002 Bacteria 11701
208 Ga0307416_100034361 3300032002 Bacteria 3858
209 Ga0307416_100089763 3300032002 Bacteria 2633
210 Ga0307416_100497345 3300032002 Unclassified 1283
211 Ga0307414_10031552 3300032004 Bacteria 3478
212 Ga0307411_10010663 3300032005 Bacteria 4913
213 Ga0307411_10563803 3300032005 Bacteria 974
214 Ga0307415_100011451 3300032126 Bacteria 5077
215 Ga0307415_100017288 3300032126 Bacteria 4322
216 Ga0307415_100030313 3300032126 Unclassified 3470
217 Ga0373960_0130037 3300035121 Unclassified 844
218 Ga0373942_0065425 3300035207 Bacteria 1050
219 Ga0373925_0186467 3300037068 Bacteria 1645
220 Ga0395905_0202489 3300037471 Bacteria 1861
221 Ga0395905_0341769 3300037471 Unclassified 1388
222 Ga0395901_0291719 3300038443 Bacteria 1693
223 Ga0242420_000919 3300038996 Bacteria 3677
224 Ga0436361_0345110 3300039447 Bacteria 2746
225 Ga0436361_0586031 3300039447 Bacteria 14421
226 Ga0453683_0731595 3300044673 Unclassified 649
227 Ga0451576_0489807 3300045051 Bacteria 1292
228 Ga0495592_0306900 3300046454 Bacteria 1030
229 Ga0495582_0117744 3300046473 Bacteria 1495
230 Ga0495639_0061829 3300046475 Bacteria 1717
231 Ga0495628_0076124 3300046516 Unclassified 2612
232 Ga0495635_0031340 3300046663 Bacteria 3692
233 Ga0495599_0104986 3300046678 Bacteria 1760
234 Ga0495658_0040220 3300046683 Unclassified 2599
235 Ga0495669_0005658 3300046684 Bacteria 5215
236 Ga0496104_0402041 3300048907 Bacteria 1282
237 Ga0496106_0190452 3300048909 Unclassified 1631
238 Ga0496107_0233332 3300048910 Unclassified 1369
239 Ga0496112_0383810 3300048915 Unclassified 1346
240 Ga0496113_0169045 3300048916 Bacteria 1731
241 Ga0496115_0256617 3300048918 Bacteria 1438
242 Ga0501296_004197 3300049519 Unclassified 1562
243 Ga0501298_012094 3300049521 Unclassified 1508
244 Ga0501224_034348 3300049664 Unclassified 761
245 Ga0501227_077816 3300049665 Unclassified 867
246 Ga0501233_029744 3300049668 Unclassified 1227
247 Ga0501236_043827 3300049670 Unclassified 748
248 Ga0501239_033165 3300049672 Unclassified 686
249 Ga0501257_027869 3300049686 Unclassified 1353
250 nmdc:mga05p37_257961_c1 3300050507 Unclassified 2088
251 nmdc:mga05p37_27057_c1 3300050507 Bacteria 6980
252 nmdc:mga08y16_40359_c1 3300050511 Bacteria 4893
253 nmdc:mga08y16_90550_c1 3300050511 Bacteria 3189
254 nmdc:mga0n895_55764_c1 3300050512 Bacteria 3890
255 nmdc:mga0n895_58317_c1 3300050512 Unclassified 3806
256 nmdc:mga0n895_776741_c1 3300050512 Bacteria 950
257 nmdc:mga0rr50_206055_c1 3300050513 Bacteria 1618
258 nmdc:mga0rr50_60804_c1 3300050513 Bacteria 2843
259 nmdc:mga0a205_120597_c1 3300050515 Bacteria 2522
260 nmdc:mga0a205_158987_c1 3300050515 Bacteria 2157
261 nmdc:mga0a205_283868_c1 3300050515 Bacteria 1531
262 nmdc:mga0a205_35118_c1 3300050515 Bacteria 4814
263 nmdc:mga0a205_35265_c1 3300050515 Bacteria 4803
264 nmdc:mga0a205_389229_c1 3300050515 Bacteria 1259
265 Ga0495619_0015915 3300053085 Bacteria 4763
266 Ga0500568_0006749 3300053139 Bacteria 5734
267 Ga0590077_008750 3300059426 Bacteria 2073

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100063031 Ga0307408_1000630313 181
2 3300031852 Ga0307410_10000199 Ga0307410_1000019912 181
3 3300031901 Ga0307406_10054480 Ga0307406_100544802 181
4 3300031903 Ga0307407_10053186 Ga0307407_100531863 181
5 3300031995 Ga0307409_100001157 Ga0307409_1000011579 181
6 3300032002 Ga0307416_100001886 Ga0307416_1000018866 181
7 3300049672 Ga0501239_033165 Ga0501239_033165_20_640 181
8 3300046683 Ga0495658_0040220 Ga0495658_0040220_16_618 182
9 3300005354 Ga0070675_100937779 Ga0070675_1009377791 195
10 3300009094 Ga0111539_10328490 Ga0111539_103284903 195
11 3300005334 Ga0068869_100049981 Ga0068869_1000499814 196
12 3300005367 Ga0070667_100010496 Ga0070667_1000104967 196
13 3300005617 Ga0068859_100891136 Ga0068859_1008911361 196
14 3300005618 Ga0068864_100092821 Ga0068864_1000928215 196
15 3300005842 Ga0068858_100087993 Ga0068858_1000879935 196
16 3300005843 Ga0068860_100041485 Ga0068860_1000414852 196
17 3300006237 Ga0097621_100174639 Ga0097621_1001746393 196
18 3300006358 Ga0068871_100118906 Ga0068871_1001189063 196
19 3300006914 Ga0075436_100172944 Ga0075436_1001729442 196
20 3300006931 Ga0097620_100891108 Ga0097620_1008911082 196
21 3300009176 Ga0105242_10026020 Ga0105242_100260203 196
22 3300009553 Ga0105249_10113477 Ga0105249_101134772 196
23 3300013306 Ga0163162_10085125 Ga0163162_100851254 196
24 3300014969 Ga0157376_10428268 Ga0157376_104282682 196
25 3300025934 Ga0207686_10207017 Ga0207686_102070173 196
26 3300025942 Ga0207689_10174472 Ga0207689_101744721 196
27 3300025961 Ga0207712_10362684 Ga0207712_103626842 196
28 3300025986 Ga0207658_10093579 Ga0207658_100935792 196
29 3300026088 Ga0207641_10171235 Ga0207641_101712353 196
30 3300026089 Ga0207648_10062791 Ga0207648_100627914 196
31 3300028381 Ga0268264_10080882 Ga0268264_100808823 196
32 3300044673 Ga0453683_0731595 Ga0453683_0731595_30_638 196
33 3300005578 Ga0068854_100563544 Ga0068854_1005635441 197
34 3300017792 Ga0163161_10082770 Ga0163161_100827703 197
35 3300005444 Ga0070694_100423675 Ga0070694_1004236752 201
36 3300005617 Ga0068859_100541232 Ga0068859_1005412322 201
37 3300006931 Ga0097620_100541243 Ga0097620_1005412432 201
38 3300005618 Ga0068864_100236898 Ga0068864_1002368983 202
39 3300026095 Ga0207676_10479892 Ga0207676_104798921 202
40 3300005340 Ga0070689_100016955 Ga0070689_1000169554 203
41 3300005618 Ga0068864_100017378 Ga0068864_1000173787 203
42 3300005841 Ga0068863_100094594 Ga0068863_1000945943 203
43 3300005843 Ga0068860_100460754 Ga0068860_1004607541 203
44 3300005844 Ga0068862_100193813 Ga0068862_1001938132 203
45 3300007076 Ga0075435_100036855 Ga0075435_1000368553 203
46 3300025936 Ga0207670_10001000 Ga0207670_1000100012 203
47 3300025941 Ga0207711_10124365 Ga0207711_101243653 203
48 3300026095 Ga0207676_10005029 Ga0207676_100050299 203
49 3300028380 Ga0268265_10011995 Ga0268265_100119955 203
50 3300028381 Ga0268264_10602923 Ga0268264_106029231 203
51 3300050513 nmdc:mga0rr50_60804_c1 nmdc:mga0rr50_60804_c1_1374_2078 203
52 3300005444 Ga0070694_100134836 Ga0070694_1001348363 204
53 3300005549 Ga0070704_100185666 Ga0070704_1001856662 204
54 3300005844 Ga0068862_100387159 Ga0068862_1003871592 204
55 3300006881 Ga0068865_100333243 Ga0068865_1003332432 204
56 3300025908 Ga0207643_10101451 Ga0207643_101014512 204
57 3300025917 Ga0207660_10732592 Ga0207660_107325921 204
58 3300025935 Ga0207709_10249848 Ga0207709_102498482 204
59 3300031995 Ga0307409_100576876 Ga0307409_1005768762 204
60 3300032005 Ga0307411_10563803 Ga0307411_105638031 204
61 3300032126 Ga0307415_100011451 Ga0307415_1000114512 204
62 3300037471 Ga0395905_0202489 Ga0395905_0202489_228_875 204
63 3300005344 Ga0070661_100063919 Ga0070661_1000639192 205
64 3300005458 Ga0070681_10006535 Ga0070681_100065358 205
65 3300005530 Ga0070679_100016465 Ga0070679_1000164658 205
66 3300005539 Ga0068853_100057577 Ga0068853_1000575775 205
67 3300005563 Ga0068855_100042729 Ga0068855_1000427294 205
68 3300005564 Ga0070664_100007448 Ga0070664_1000074487 205
69 3300005577 Ga0068857_100017147 Ga0068857_1000171478 205
70 3300006852 Ga0075433_10187271 Ga0075433_101872712 205
71 3300025912 Ga0207707_10010053 Ga0207707_100100532 205
72 3300025917 Ga0207660_10045850 Ga0207660_100458503 205
73 3300025920 Ga0207649_10021324 Ga0207649_100213243 205
74 3300025921 Ga0207652_10006605 Ga0207652_100066053 205
75 3300026041 Ga0207639_10091125 Ga0207639_100911254 205
76 3300026116 Ga0207674_10000054 Ga0207674_1000005483 205
77 3300031090 Ga0265760_10113544 Ga0265760_101135441 205
78 3300050512 nmdc:mga0n895_55764_c1 nmdc:mga0n895_55764_c1_1927_2547 205
79 3300050515 nmdc:mga0a205_283868_c1 nmdc:mga0a205_283868_c1_807_1427 205
80 3300059426 Ga0590077_008750 Ga0590077_008750_855_1487 205
81 3300005331 Ga0070670_100714301 Ga0070670_1007143011 206
82 3300005354 Ga0070675_100790941 Ga0070675_1007909411 206
83 3300005365 Ga0070688_100167982 Ga0070688_1001679822 206
84 3300005459 Ga0068867_100332601 Ga0068867_1003326011 206
85 3300005466 Ga0070685_10158350 Ga0070685_101583503 206
86 3300005545 Ga0070695_100004154 Ga0070695_1000041543 206
87 3300005617 Ga0068859_100060808 Ga0068859_1000608083 206
88 3300005618 Ga0068864_100135919 Ga0068864_1001359193 206
89 3300006931 Ga0097620_100060808 Ga0097620_1000608084 206
90 3300009177 Ga0105248_10016729 Ga0105248_100167298 206
91 3300009553 Ga0105249_10594837 Ga0105249_105948372 206
92 3300013307 Ga0157372_10074128 Ga0157372_100741282 206
93 3300013307 Ga0157372_10604012 Ga0157372_106040122 206
94 3300014325 Ga0163163_10113445 Ga0163163_101134453 206
95 3300025925 Ga0207650_10217534 Ga0207650_102175342 206
96 3300025941 Ga0207711_10028793 Ga0207711_100287935 206
97 3300025972 Ga0207668_10601331 Ga0207668_106013311 206
98 3300026088 Ga0207641_10047474 Ga0207641_100474745 206
99 3300031731 Ga0307405_10036576 Ga0307405_100365762 206
100 3300031824 Ga0307413_10001823 Ga0307413_100018233 206
101 3300031852 Ga0307410_10001494 Ga0307410_100014943 206
102 3300031903 Ga0307407_10008628 Ga0307407_100086282 206
103 3300031911 Ga0307412_10261452 Ga0307412_102614522 206
104 3300031911 Ga0307412_10375793 Ga0307412_103757932 206
105 3300031995 Ga0307409_100001367 Ga0307409_1000013678 206
106 3300032002 Ga0307416_100034361 Ga0307416_1000343613 206
107 3300032004 Ga0307414_10031552 Ga0307414_100315525 206
108 3300032126 Ga0307415_100017288 Ga0307415_1000172884 206
109 3300038996 Ga0242420_000919 Ga0242420_000919_2381_3037 206
110 3300005471 Ga0070698_100007337 Ga0070698_10000733710 207
111 3300006871 Ga0075434_100235001 Ga0075434_1002350013 207
112 3300009094 Ga0111539_10275515 Ga0111539_102755153 207
113 3300013297 Ga0157378_10041378 Ga0157378_100413782 207
114 3300017792 Ga0163161_10833335 Ga0163161_108333352 207
115 3300035207 Ga0373942_0065425 Ga0373942_0065425_302_934 207
116 3300046454 Ga0495592_0306900 Ga0495592_0306900_254_883 207
117 3300046516 Ga0495628_0076124 Ga0495628_0076124_177_806 207
118 3300046678 Ga0495599_0104986 Ga0495599_0104986_880_1509 207
119 3300050512 nmdc:mga0n895_776741_c1 nmdc:mga0n895_776741_c1_286_918 207
120 3300005295 Ga0065707_10101518 Ga0065707_101015182 208
121 3300005353 Ga0070669_100229958 Ga0070669_1002299582 208
122 3300005440 Ga0070705_100319767 Ga0070705_1003197672 208
123 3300005468 Ga0070707_100015435 Ga0070707_1000154353 208
124 3300005471 Ga0070698_100002938 Ga0070698_10000293810 208
125 3300005471 Ga0070698_100880694 Ga0070698_1008806941 208
126 3300005518 Ga0070699_100079331 Ga0070699_1000793314 208
127 3300005518 Ga0070699_100510894 Ga0070699_1005108942 208
128 3300005545 Ga0070695_100070872 Ga0070695_1000708722 208
129 3300005549 Ga0070704_100029605 Ga0070704_1000296052 208
130 3300005617 Ga0068859_100125255 Ga0068859_1001252553 208
131 3300005617 Ga0068859_100363724 Ga0068859_1003637243 208
132 3300005618 Ga0068864_100052683 Ga0068864_1000526835 208
133 3300006173 Ga0070716_100000009 Ga0070716_100000009135 208
134 3300006852 Ga0075433_10014857 Ga0075433_100148577 208
135 3300006931 Ga0097620_100024441 Ga0097620_1000244414 208
136 3300006931 Ga0097620_100125252 Ga0097620_1001252523 208
137 3300006931 Ga0097620_100363704 Ga0097620_1003637042 208
138 3300009094 Ga0111539_10005527 Ga0111539_1000552715 208
139 3300009147 Ga0114129_10248333 Ga0114129_102483333 208
140 3300009174 Ga0105241_10066160 Ga0105241_100661602 208
141 3300009174 Ga0105241_10170697 Ga0105241_101706972 208
142 3300011119 Ga0105246_10266412 Ga0105246_102664122 208
143 3300013100 Ga0157373_10038219 Ga0157373_100382193 208
144 3300013100 Ga0157373_10085921 Ga0157373_100859214 208
145 3300013297 Ga0157378_10003980 Ga0157378_100039808 208
146 3300014325 Ga0163163_10136875 Ga0163163_101368753 208
147 3300014326 Ga0157380_10372307 Ga0157380_103723073 208
148 3300025911 Ga0207654_10011943 Ga0207654_100119432 208
149 3300025922 Ga0207646_10007518 Ga0207646_100075186 208
150 3300025939 Ga0207665_10000001 Ga0207665_100000015 208
151 3300025942 Ga0207689_10093790 Ga0207689_100937904 208
152 3300026035 Ga0207703_10603895 Ga0207703_106038952 208
153 3300026035 Ga0207703_10702024 Ga0207703_107020242 208
154 3300026095 Ga0207676_10052858 Ga0207676_100528584 208
155 3300026095 Ga0207676_10311076 Ga0207676_103110761 208
156 3300026116 Ga0207674_10869749 Ga0207674_108697491 208
157 3300027907 Ga0207428_10141254 Ga0207428_101412542 208
158 3300028380 Ga0268265_10709196 Ga0268265_107091962 208
159 3300028381 Ga0268264_10399751 Ga0268264_103997512 208
160 3300032002 Ga0307416_100497345 Ga0307416_1004973452 208
161 3300035121 Ga0373960_0130037 Ga0373960_0130037_64_693 208
162 3300048915 Ga0496112_0383810 Ga0496112_0383810_280_930 208
163 3300049519 Ga0501296_004197 Ga0501296_004197_177_812 208
164 3300049521 Ga0501298_012094 Ga0501298_012094_551_1186 208
165 3300049664 Ga0501224_034348 Ga0501224_034348_45_680 208
166 3300049665 Ga0501227_077816 Ga0501227_077816_13_648 208
167 3300049668 Ga0501233_029744 Ga0501233_029744_24_659 208
168 3300049670 Ga0501236_043827 Ga0501236_043827_97_732 208
169 3300049686 Ga0501257_027869 Ga0501257_027869_25_660 208
170 3300050511 nmdc:mga08y16_40359_c1 nmdc:mga08y16_40359_c1_1416_2102 208
171 3300050515 nmdc:mga0a205_120597_c1 nmdc:mga0a205_120597_c1_27_656 208
172 3300050515 nmdc:mga0a205_35265_c1 nmdc:mga0a205_35265_c1_1391_2020 208
173 3300037471 Ga0395905_0341769 Ga0395905_0341769_494_1132 209
174 3300039447 Ga0436361_0345110 Ga0436361_0345110_378_1025 209
175 3300005406 Ga0070703_10002161 Ga0070703_100021614 210
176 3300005440 Ga0070705_100005738 Ga0070705_1000057385 210
177 3300005471 Ga0070698_100009797 Ga0070698_1000097974 210
178 3300005546 Ga0070696_100057408 Ga0070696_1000574083 210
179 3300009147 Ga0114129_10166173 Ga0114129_101661734 210
180 3300021361 Ga0213872_10035741 Ga0213872_100357413 210
181 3300025885 Ga0207653_10010375 Ga0207653_100103753 210
182 3300031548 Ga0307408_100299298 Ga0307408_1002992982 210
183 3300032002 Ga0307416_100089763 Ga0307416_1000897634 210
184 3300039447 Ga0436361_0586031 Ga0436361_0586031_2717_3361 210
185 3300050507 nmdc:mga05p37_257961_c1 nmdc:mga05p37_257961_c1_1206_1850 210
186 3300050515 nmdc:mga0a205_158987_c1 nmdc:mga0a205_158987_c1_788_1444 210
187 3300050515 nmdc:mga0a205_35118_c1 nmdc:mga0a205_35118_c1_3553_4197 210
188 3300005344 Ga0070661_100363053 Ga0070661_1003630532 211
189 3300005444 Ga0070694_100007600 Ga0070694_1000076002 211
190 3300005545 Ga0070695_100907115 Ga0070695_1009071151 211
191 3300031901 Ga0307406_10326510 Ga0307406_103265102 211
192 3300031995 Ga0307409_100020369 Ga0307409_1000203694 211
193 3300032126 Ga0307415_100030313 Ga0307415_1000303133 211
194 3300032005 Ga0307411_10010663 Ga0307411_100106636 212
195 3300053139 Ga0500568_0006749 Ga0500568_0006749_1807_2472 212
196 3300005329 Ga0070683_100097905 Ga0070683_1000979053 214
197 3300005334 Ga0068869_100412293 Ga0068869_1004122932 214
198 3300005338 Ga0068868_100231784 Ga0068868_1002317842 214
199 3300005343 Ga0070687_100058714 Ga0070687_1000587142 214
200 3300005345 Ga0070692_10449579 Ga0070692_104495791 214
201 3300005353 Ga0070669_100348676 Ga0070669_1003486761 214
202 3300005438 Ga0070701_10063560 Ga0070701_100635601 214
203 3300005456 Ga0070678_100063321 Ga0070678_1000633212 214
204 3300005535 Ga0070684_100530929 Ga0070684_1005309291 214
205 3300005547 Ga0070693_100543551 Ga0070693_1005435511 214
206 3300005614 Ga0068856_100113111 Ga0068856_1001131113 214
207 3300005616 Ga0068852_100346700 Ga0068852_1003467001 214
208 3300005618 Ga0068864_100188936 Ga0068864_1001889362 214
209 3300005841 Ga0068863_100041083 Ga0068863_1000410833 214
210 3300005842 Ga0068858_100040731 Ga0068858_1000407312 214
211 3300005843 Ga0068860_101111814 Ga0068860_1011118141 214
212 3300009148 Ga0105243_10117159 Ga0105243_101171592 214
213 3300009177 Ga0105248_10066395 Ga0105248_100663954 214
214 3300009551 Ga0105238_10266904 Ga0105238_102669042 214
215 3300010375 Ga0105239_10308357 Ga0105239_103083573 214
216 3300013296 Ga0157374_10054930 Ga0157374_100549303 214
217 3300013297 Ga0157378_10275017 Ga0157378_102750172 214
218 3300014325 Ga0163163_10063945 Ga0163163_100639453 214
219 3300014325 Ga0163163_10199451 Ga0163163_101994512 214
220 3300025918 Ga0207662_10005106 Ga0207662_100051064 214
221 3300025938 Ga0207704_10527870 Ga0207704_105278701 214
222 3300025941 Ga0207711_10574728 Ga0207711_105747281 214
223 3300025945 Ga0207679_10216314 Ga0207679_102163142 214
224 3300025981 Ga0207640_10667164 Ga0207640_106671641 214
225 3300026035 Ga0207703_10148698 Ga0207703_101486982 214
226 3300026088 Ga0207641_10388939 Ga0207641_103889391 214
227 3300026121 Ga0207683_10322140 Ga0207683_103221401 214
228 3300026142 Ga0207698_10242141 Ga0207698_102421411 214
229 3300026142 Ga0207698_10778627 Ga0207698_107786272 214
230 3300037068 Ga0373925_0186467 Ga0373925_0186467_607_1302 214
231 3300045051 Ga0451576_0489807 Ga0451576_0489807_574_1260 214
232 3300046473 Ga0495582_0117744 Ga0495582_0117744_61_756 214
233 3300046475 Ga0495639_0061829 Ga0495639_0061829_520_1215 214
234 3300046663 Ga0495635_0031340 Ga0495635_0031340_2121_2816 214
235 3300046684 Ga0495669_0005658 Ga0495669_0005658_3079_3765 214
236 3300048907 Ga0496104_0402041 Ga0496104_0402041_509_1195 214
237 3300048909 Ga0496106_0190452 Ga0496106_0190452_231_917 214
238 3300048916 Ga0496113_0169045 Ga0496113_0169045_21_707 214
239 3300048918 Ga0496115_0256617 Ga0496115_0256617_83_769 214
240 3300050511 nmdc:mga08y16_90550_c1 nmdc:mga08y16_90550_c1_24_680 214
241 3300053085 Ga0495619_0015915 Ga0495619_0015915_1797_2492 214
242 3300005293 Ga0065715_10069084 Ga0065715_100690841 215
243 3300005295 Ga0065707_10114841 Ga0065707_101148412 215
244 3300005336 Ga0070680_100001080 Ga0070680_10000108020 215
245 3300005345 Ga0070692_10123472 Ga0070692_101234722 215
246 3300005457 Ga0070662_100686582 Ga0070662_1006865821 215
247 3300005530 Ga0070679_100000502 Ga0070679_1000005028 215
248 3300005546 Ga0070696_100218746 Ga0070696_1002187461 215
249 3300005547 Ga0070693_100184103 Ga0070693_1001841031 215
250 3300005547 Ga0070693_100357867 Ga0070693_1003578672 215
251 3300006852 Ga0075433_10083601 Ga0075433_100836013 215
252 3300006871 Ga0075434_100379309 Ga0075434_1003793091 215
253 3300007076 Ga0075435_100351438 Ga0075435_1003514381 215
254 3300009147 Ga0114129_10313694 Ga0114129_103136941 215
255 3300013297 Ga0157378_10818178 Ga0157378_108181781 215
256 3300013306 Ga0163162_10506209 Ga0163162_105062091 215
257 3300025912 Ga0207707_10000004 Ga0207707_10000004108 215
258 3300025917 Ga0207660_10001262 Ga0207660_100012622 215
259 3300025921 Ga0207652_10000941 Ga0207652_100009417 215
260 3300025942 Ga0207689_10100091 Ga0207689_101000912 215
261 3300025949 Ga0207667_11006444 Ga0207667_110064442 215
262 3300038443 Ga0395901_0291719 Ga0395901_0291719_548_1267 215
263 3300048910 Ga0496107_0233332 Ga0496107_0233332_102_806 215
264 3300050507 nmdc:mga05p37_27057_c1 nmdc:mga05p37_27057_c1_2544_3263 215
265 3300050512 nmdc:mga0n895_58317_c1 nmdc:mga0n895_58317_c1_97_753 215
266 3300050513 nmdc:mga0rr50_206055_c1 nmdc:mga0rr50_206055_c1_807_1484 215
267 3300050515 nmdc:mga0a205_389229_c1 nmdc:mga0a205_389229_c1_444_1163 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

27

217

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m6r-assembly1.cif.gz_D structural and biochemical basis for the inhibition of cell death by apip, a methionine salvage enzyme 0.912 18 212
2irp-assembly1.cif.gz_A crystal structure of the l-fuculose-1-phosphate aldolase (aq_1979) from aquifex aeolicus vf5 0.8906 12 211
7x78-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase 0.8806 12 212
1e4c-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant s71q 0.8797 10 212
1e46-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant e73s 0.8771 10 212
ID Description Score Start End Superfamily
af_Q9HE08_16_228_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9257 11 214 3.40.225.10
af_I1KDU3_22_246_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9253 13 213 3.40.225.10
af_P47095_12_237_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9082 15 211 3.40.225.10
af_Q54NY7_4_228_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8946 18 213 3.40.225.10
2irpB00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8935 12 211 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A1Q7MKD5-F1-model_v4 Methylthioribulose 1-phosphate dehydratase (EC 4.2.1.109) 0.9916 10 212 GO:0005737
GO:0016810
GO:0016829
GO:0019509
GO:0046872
AF-A0A2V9AHD3-F1-model_v4 Methylthioribulose-1-phosphate dehydratase (MTRu-1-P dehydratase) (EC 4.2.1.109) 0.9869 12 213 GO:0005737
GO:0008270
GO:0019509
GO:0046570
AF-A0A2V8NF28-F1-model_v4 Methylthioribulose-1-phosphate dehydratase (MTRu-1-P dehydratase) (EC 4.2.1.109) 0.9859 10 214 GO:0005737
GO:0008270
GO:0019509
GO:0046570
AF-A0A218ZRQ4-F1-model_v4 Methylthioribulose-1-phosphate dehydratase 0.9837 10 209 GO:0005737
GO:0008738
GO:0019509
GO:0046570
GO:0046872
AF-A0A7J3TEW5-F1-model_v4 Methylthioribulose 1-phosphate dehydratase (EC 4.2.1.109) 0.983 12 211 GO:0005737
GO:0008738
GO:0019509
GO:0046570
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map