F374730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 161 | 267 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10313694|Ga0114129_103136941 |
| Length | 239 |
| Sequence | LPQLILNGLHMSSTPSQIASNFAQTAASLSAIAKAFHARGWLLGTSGNLSAVVSRDPLRLAMSPSGIDKGELTAAQVLLVDEQAQVLSDHRGKPSDETLLHLRIVNDRHAGAVLHTHSVWNTILSDLYAADGGINIEGYEMLKGLTGIRTHEHSEWLPIIENSQDMTALASSIGETLLNNSQAHGLLLRRHGLYSWGTNLHEAKRHIEILEFLLETIGRTLELKGLGLGAQASSPAGND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 76 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 124 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 141 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 142 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 147 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 148 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 149 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 150 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 151 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 152 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 153 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 161 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 2.25 |
| Rhizosphere | 97.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10069084 | 3300005293 | Bacteria | 806 |
| 2 | Ga0065707_10101518 | 3300005295 | Bacteria | 2860 |
| 3 | Ga0065707_10114841 | 3300005295 | Unclassified | 2285 |
| 4 | Ga0070683_100097905 | 3300005329 | Bacteria | 2760 |
| 5 | Ga0070670_100714301 | 3300005331 | Bacteria | 902 |
| 6 | Ga0068869_100049981 | 3300005334 | Unclassified | 3030 |
| 7 | Ga0068869_100412293 | 3300005334 | Bacteria | 1113 |
| 8 | Ga0070680_100001080 | 3300005336 | Bacteria | 19582 |
| 9 | Ga0068868_100231784 | 3300005338 | Bacteria | 1549 |
| 10 | Ga0070689_100016955 | 3300005340 | Bacteria | 5341 |
| 11 | Ga0070687_100058714 | 3300005343 | Bacteria | 2022 |
| 12 | Ga0070661_100063919 | 3300005344 | Bacteria | 2704 |
| 13 | Ga0070661_100363053 | 3300005344 | Unclassified | 1138 |
| 14 | Ga0070692_10123472 | 3300005345 | Unclassified | 1447 |
| 15 | Ga0070692_10449579 | 3300005345 | Unclassified | 824 |
| 16 | Ga0070669_100229958 | 3300005353 | Unclassified | 1469 |
| 17 | Ga0070669_100348676 | 3300005353 | Bacteria | 1201 |
| 18 | Ga0070675_100790941 | 3300005354 | Bacteria | 867 |
| 19 | Ga0070675_100937779 | 3300005354 | Bacteria | 794 |
| 20 | Ga0070688_100167982 | 3300005365 | Bacteria | 1512 |
| 21 | Ga0070667_100010496 | 3300005367 | Bacteria | 7650 |
| 22 | Ga0070703_10002161 | 3300005406 | Bacteria | 5718 |
| 23 | Ga0070701_10063560 | 3300005438 | Bacteria | 1953 |
| 24 | Ga0070705_100005738 | 3300005440 | Bacteria | 6063 |
| 25 | Ga0070705_100319767 | 3300005440 | Bacteria | 1120 |
| 26 | Ga0070694_100007600 | 3300005444 | Bacteria | 6614 |
| 27 | Ga0070694_100134836 | 3300005444 | Bacteria | 1788 |
| 28 | Ga0070694_100423675 | 3300005444 | Bacteria | 1046 |
| 29 | Ga0070678_100063321 | 3300005456 | Bacteria | 2736 |
| 30 | Ga0070662_100686582 | 3300005457 | Unclassified | 865 |
| 31 | Ga0070681_10006535 | 3300005458 | Bacteria | 11350 |
| 32 | Ga0068867_100332601 | 3300005459 | Bacteria | 1262 |
| 33 | Ga0070685_10158350 | 3300005466 | Bacteria | 1441 |
| 34 | Ga0070707_100015435 | 3300005468 | Bacteria | 7167 |
| 35 | Ga0070698_100002938 | 3300005471 | Bacteria | 18748 |
| 36 | Ga0070698_100007337 | 3300005471 | Bacteria | 11935 |
| 37 | Ga0070698_100009797 | 3300005471 | Bacteria | 10243 |
| 38 | Ga0070698_100880694 | 3300005471 | Bacteria | 841 |
| 39 | Ga0070699_100079331 | 3300005518 | Bacteria | 2860 |
| 40 | Ga0070699_100510894 | 3300005518 | Unclassified | 1092 |
| 41 | Ga0070679_100000502 | 3300005530 | Bacteria | 33348 |
| 42 | Ga0070679_100016465 | 3300005530 | Bacteria | 7133 |
| 43 | Ga0070684_100530929 | 3300005535 | Unclassified | 1091 |
| 44 | Ga0068853_100057577 | 3300005539 | Unclassified | 3354 |
| 45 | Ga0070695_100004154 | 3300005545 | Bacteria | 8465 |
| 46 | Ga0070695_100070872 | 3300005545 | Unclassified | 2281 |
| 47 | Ga0070695_100907115 | 3300005545 | Unclassified | 712 |
| 48 | Ga0070696_100057408 | 3300005546 | Bacteria | 2717 |
| 49 | Ga0070696_100218746 | 3300005546 | Bacteria | 1428 |
| 50 | Ga0070693_100184103 | 3300005547 | Unclassified | 1347 |
| 51 | Ga0070693_100357867 | 3300005547 | Bacteria | 1001 |
| 52 | Ga0070693_100543551 | 3300005547 | Unclassified | 830 |
| 53 | Ga0070704_100029605 | 3300005549 | Bacteria | 3658 |
| 54 | Ga0070704_100185666 | 3300005549 | Bacteria | 1667 |
| 55 | Ga0068855_100042729 | 3300005563 | Bacteria | 5371 |
| 56 | Ga0070664_100007448 | 3300005564 | Bacteria | 8838 |
| 57 | Ga0068857_100017147 | 3300005577 | Bacteria | 6344 |
| 58 | Ga0068854_100563544 | 3300005578 | Bacteria | 968 |
| 59 | Ga0068856_100113111 | 3300005614 | Bacteria | 2713 |
| 60 | Ga0068852_100346700 | 3300005616 | Bacteria | 1449 |
| 61 | Ga0068859_100060808 | 3300005617 | Bacteria | 3806 |
| 62 | Ga0068859_100125255 | 3300005617 | Bacteria | 2638 |
| 63 | Ga0068859_100363724 | 3300005617 | Bacteria | 1542 |
| 64 | Ga0068859_100541232 | 3300005617 | Bacteria | 1259 |
| 65 | Ga0068859_100891136 | 3300005617 | Bacteria | 975 |
| 66 | Ga0068864_100017378 | 3300005618 | Bacteria | 5997 |
| 67 | Ga0068864_100052683 | 3300005618 | Bacteria | 3508 |
| 68 | Ga0068864_100092821 | 3300005618 | Bacteria | 2665 |
| 69 | Ga0068864_100135919 | 3300005618 | Bacteria | 2213 |
| 70 | Ga0068864_100188936 | 3300005618 | Bacteria | 1887 |
| 71 | Ga0068864_100236898 | 3300005618 | Bacteria | 1690 |
| 72 | Ga0068863_100041083 | 3300005841 | Bacteria | 4396 |
| 73 | Ga0068863_100094594 | 3300005841 | Bacteria | 2836 |
| 74 | Ga0068858_100040731 | 3300005842 | Unclassified | 4309 |
| 75 | Ga0068858_100087993 | 3300005842 | Unclassified | 2889 |
| 76 | Ga0068860_100041485 | 3300005843 | Bacteria | 4395 |
| 77 | Ga0068860_100460754 | 3300005843 | Bacteria | 1265 |
| 78 | Ga0068860_101111814 | 3300005843 | Bacteria | 810 |
| 79 | Ga0068862_100193813 | 3300005844 | Bacteria | 1830 |
| 80 | Ga0068862_100387159 | 3300005844 | Bacteria | 1305 |
| 81 | Ga0070716_100000009 | 3300006173 | Bacteria | 173295 |
| 82 | Ga0097621_100174639 | 3300006237 | Bacteria | 1854 |
| 83 | Ga0068871_100118906 | 3300006358 | Unclassified | 2230 |
| 84 | Ga0075433_10014857 | 3300006852 | Bacteria | 6372 |
| 85 | Ga0075433_10083601 | 3300006852 | Unclassified | 2818 |
| 86 | Ga0075433_10187271 | 3300006852 | Bacteria | 1841 |
| 87 | Ga0075434_100235001 | 3300006871 | Bacteria | 1853 |
| 88 | Ga0075434_100379309 | 3300006871 | Unclassified | 1435 |
| 89 | Ga0068865_100333243 | 3300006881 | Bacteria | 1224 |
| 90 | Ga0075436_100172944 | 3300006914 | Bacteria | 1525 |
| 91 | Ga0097620_100024441 | 3300006931 | Bacteria | 6061 |
| 92 | Ga0097620_100060808 | 3300006931 | Bacteria | 3806 |
| 93 | Ga0097620_100125252 | 3300006931 | Bacteria | 2638 |
| 94 | Ga0097620_100363704 | 3300006931 | Bacteria | 1542 |
| 95 | Ga0097620_100541243 | 3300006931 | Bacteria | 1259 |
| 96 | Ga0097620_100891108 | 3300006931 | Bacteria | 975 |
| 97 | Ga0075435_100036855 | 3300007076 | Bacteria | 3890 |
| 98 | Ga0075435_100351438 | 3300007076 | Bacteria | 1263 |
| 99 | Ga0111539_10005527 | 3300009094 | Bacteria | 16347 |
| 100 | Ga0111539_10275515 | 3300009094 | Unclassified | 1958 |
| 101 | Ga0111539_10328490 | 3300009094 | Bacteria | 1780 |
| 102 | Ga0114129_10166173 | 3300009147 | Bacteria | 3011 |
| 103 | Ga0114129_10248333 | 3300009147 | Bacteria | 2389 |
| 104 | Ga0114129_10313694 | 3300009147 | Unclassified | 2087 |
| 105 | Ga0105243_10117159 | 3300009148 | Bacteria | 2239 |
| 106 | Ga0105241_10066160 | 3300009174 | Bacteria | 2794 |
| 107 | Ga0105241_10170697 | 3300009174 | Bacteria | 1796 |
| 108 | Ga0105242_10026020 | 3300009176 | Bacteria | 4634 |
| 109 | Ga0105248_10016729 | 3300009177 | Bacteria | 8075 |
| 110 | Ga0105248_10066395 | 3300009177 | Bacteria | 4051 |
| 111 | Ga0105238_10266904 | 3300009551 | Bacteria | 1692 |
| 112 | Ga0105249_10113477 | 3300009553 | Bacteria | 2564 |
| 113 | Ga0105249_10594837 | 3300009553 | Bacteria | 1160 |
| 114 | Ga0105239_10308357 | 3300010375 | Bacteria | 1784 |
| 115 | Ga0105246_10266412 | 3300011119 | Bacteria | 1367 |
| 116 | Ga0157373_10038219 | 3300013100 | Bacteria | 3441 |
| 117 | Ga0157373_10085921 | 3300013100 | Bacteria | 2217 |
| 118 | Ga0157374_10054930 | 3300013296 | Unclassified | 3716 |
| 119 | Ga0157378_10003980 | 3300013297 | Bacteria | 13058 |
| 120 | Ga0157378_10041378 | 3300013297 | Bacteria | 4087 |
| 121 | Ga0157378_10275017 | 3300013297 | Bacteria | 1621 |
| 122 | Ga0157378_10818178 | 3300013297 | Unclassified | 958 |
| 123 | Ga0163162_10085125 | 3300013306 | Bacteria | 3238 |
| 124 | Ga0163162_10506209 | 3300013306 | Unclassified | 1338 |
| 125 | Ga0157372_10074128 | 3300013307 | Bacteria | 3837 |
| 126 | Ga0157372_10604012 | 3300013307 | Bacteria | 1279 |
| 127 | Ga0163163_10063945 | 3300014325 | Bacteria | 3650 |
| 128 | Ga0163163_10113445 | 3300014325 | Bacteria | 2740 |
| 129 | Ga0163163_10136875 | 3300014325 | Bacteria | 2490 |
| 130 | Ga0163163_10199451 | 3300014325 | Bacteria | 2049 |
| 131 | Ga0157380_10372307 | 3300014326 | Bacteria | 1345 |
| 132 | Ga0157376_10428268 | 3300014969 | Bacteria | 1285 |
| 133 | Ga0163161_10082770 | 3300017792 | Bacteria | 2365 |
| 134 | Ga0163161_10833335 | 3300017792 | Bacteria | 777 |
| 135 | Ga0213872_10035741 | 3300021361 | Bacteria | 2271 |
| 136 | Ga0207653_10010375 | 3300025885 | Bacteria | 2905 |
| 137 | Ga0207643_10101451 | 3300025908 | Bacteria | 1688 |
| 138 | Ga0207654_10011943 | 3300025911 | Bacteria | 4440 |
| 139 | Ga0207707_10000004 | 3300025912 | Bacteria | 391281 |
| 140 | Ga0207707_10010053 | 3300025912 | Bacteria | 8207 |
| 141 | Ga0207660_10001262 | 3300025917 | Bacteria | 16979 |
| 142 | Ga0207660_10045850 | 3300025917 | Unclassified | 3082 |
| 143 | Ga0207660_10732592 | 3300025917 | Bacteria | 807 |
| 144 | Ga0207662_10005106 | 3300025918 | Bacteria | 6964 |
| 145 | Ga0207649_10021324 | 3300025920 | Bacteria | 3728 |
| 146 | Ga0207652_10000941 | 3300025921 | Bacteria | 27359 |
| 147 | Ga0207652_10006605 | 3300025921 | Bacteria | 9348 |
| 148 | Ga0207646_10007518 | 3300025922 | Bacteria | 11055 |
| 149 | Ga0207650_10217534 | 3300025925 | Bacteria | 1536 |
| 150 | Ga0207686_10207017 | 3300025934 | Unclassified | 1408 |
| 151 | Ga0207709_10249848 | 3300025935 | Bacteria | 1295 |
| 152 | Ga0207670_10001000 | 3300025936 | Bacteria | 14947 |
| 153 | Ga0207704_10527870 | 3300025938 | Bacteria | 956 |
| 154 | Ga0207665_10000001 | 3300025939 | Bacteria | 279842 |
| 155 | Ga0207711_10028793 | 3300025941 | Bacteria | 4678 |
| 156 | Ga0207711_10124365 | 3300025941 | Bacteria | 2306 |
| 157 | Ga0207711_10574728 | 3300025941 | Unclassified | 1051 |
| 158 | Ga0207689_10093790 | 3300025942 | Bacteria | 2466 |
| 159 | Ga0207689_10100091 | 3300025942 | Bacteria | 2382 |
| 160 | Ga0207689_10174472 | 3300025942 | Unclassified | 1772 |
| 161 | Ga0207679_10216314 | 3300025945 | Bacteria | 1610 |
| 162 | Ga0207667_11006444 | 3300025949 | Bacteria | 820 |
| 163 | Ga0207712_10362684 | 3300025961 | Bacteria | 1208 |
| 164 | Ga0207668_10601331 | 3300025972 | Bacteria | 958 |
| 165 | Ga0207640_10667164 | 3300025981 | Bacteria | 888 |
| 166 | Ga0207658_10093579 | 3300025986 | Unclassified | 2337 |
| 167 | Ga0207703_10148698 | 3300026035 | Bacteria | 2040 |
| 168 | Ga0207703_10603895 | 3300026035 | Bacteria | 1038 |
| 169 | Ga0207703_10702024 | 3300026035 | Bacteria | 962 |
| 170 | Ga0207639_10091125 | 3300026041 | Bacteria | 2440 |
| 171 | Ga0207641_10047474 | 3300026088 | Bacteria | 3621 |
| 172 | Ga0207641_10171235 | 3300026088 | Unclassified | 1982 |
| 173 | Ga0207641_10388939 | 3300026088 | Unclassified | 1337 |
| 174 | Ga0207648_10062791 | 3300026089 | Unclassified | 3238 |
| 175 | Ga0207676_10005029 | 3300026095 | Bacteria | 9360 |
| 176 | Ga0207676_10052858 | 3300026095 | Bacteria | 3177 |
| 177 | Ga0207676_10311076 | 3300026095 | Unclassified | 1442 |
| 178 | Ga0207676_10479892 | 3300026095 | Bacteria | 1177 |
| 179 | Ga0207674_10000054 | 3300026116 | Bacteria | 114198 |
| 180 | Ga0207674_10869749 | 3300026116 | Unclassified | 869 |
| 181 | Ga0207683_10322140 | 3300026121 | Bacteria | 1416 |
| 182 | Ga0207698_10242141 | 3300026142 | Bacteria | 1645 |
| 183 | Ga0207698_10778627 | 3300026142 | Bacteria | 957 |
| 184 | Ga0207428_10141254 | 3300027907 | Unclassified | 1838 |
| 185 | Ga0268265_10011995 | 3300028380 | Bacteria | 5865 |
| 186 | Ga0268265_10709196 | 3300028380 | Bacteria | 973 |
| 187 | Ga0268264_10080882 | 3300028381 | Unclassified | 2775 |
| 188 | Ga0268264_10399751 | 3300028381 | Bacteria | 1320 |
| 189 | Ga0268264_10602923 | 3300028381 | Bacteria | 1082 |
| 190 | Ga0265760_10113544 | 3300031090 | Unclassified | 865 |
| 191 | Ga0307408_100063031 | 3300031548 | Bacteria | 2711 |
| 192 | Ga0307408_100299298 | 3300031548 | Bacteria | 1347 |
| 193 | Ga0307405_10036576 | 3300031731 | Bacteria | 2943 |
| 194 | Ga0307413_10001823 | 3300031824 | Bacteria | 8370 |
| 195 | Ga0307410_10000199 | 3300031852 | Bacteria | 22521 |
| 196 | Ga0307410_10001494 | 3300031852 | Bacteria | 10606 |
| 197 | Ga0307406_10054480 | 3300031901 | Bacteria | 2553 |
| 198 | Ga0307406_10326510 | 3300031901 | Unclassified | 1189 |
| 199 | Ga0307407_10008628 | 3300031903 | Bacteria | 4693 |
| 200 | Ga0307407_10053186 | 3300031903 | Bacteria | 2329 |
| 201 | Ga0307412_10261452 | 3300031911 | Bacteria | 1349 |
| 202 | Ga0307412_10375793 | 3300031911 | Unclassified | 1149 |
| 203 | Ga0307409_100001157 | 3300031995 | Bacteria | 12567 |
| 204 | Ga0307409_100001367 | 3300031995 | Bacteria | 11903 |
| 205 | Ga0307409_100020369 | 3300031995 | Bacteria | 4518 |
| 206 | Ga0307409_100576876 | 3300031995 | Bacteria | 1108 |
| 207 | Ga0307416_100001886 | 3300032002 | Bacteria | 11701 |
| 208 | Ga0307416_100034361 | 3300032002 | Bacteria | 3858 |
| 209 | Ga0307416_100089763 | 3300032002 | Bacteria | 2633 |
| 210 | Ga0307416_100497345 | 3300032002 | Unclassified | 1283 |
| 211 | Ga0307414_10031552 | 3300032004 | Bacteria | 3478 |
| 212 | Ga0307411_10010663 | 3300032005 | Bacteria | 4913 |
| 213 | Ga0307411_10563803 | 3300032005 | Bacteria | 974 |
| 214 | Ga0307415_100011451 | 3300032126 | Bacteria | 5077 |
| 215 | Ga0307415_100017288 | 3300032126 | Bacteria | 4322 |
| 216 | Ga0307415_100030313 | 3300032126 | Unclassified | 3470 |
| 217 | Ga0373960_0130037 | 3300035121 | Unclassified | 844 |
| 218 | Ga0373942_0065425 | 3300035207 | Bacteria | 1050 |
| 219 | Ga0373925_0186467 | 3300037068 | Bacteria | 1645 |
| 220 | Ga0395905_0202489 | 3300037471 | Bacteria | 1861 |
| 221 | Ga0395905_0341769 | 3300037471 | Unclassified | 1388 |
| 222 | Ga0395901_0291719 | 3300038443 | Bacteria | 1693 |
| 223 | Ga0242420_000919 | 3300038996 | Bacteria | 3677 |
| 224 | Ga0436361_0345110 | 3300039447 | Bacteria | 2746 |
| 225 | Ga0436361_0586031 | 3300039447 | Bacteria | 14421 |
| 226 | Ga0453683_0731595 | 3300044673 | Unclassified | 649 |
| 227 | Ga0451576_0489807 | 3300045051 | Bacteria | 1292 |
| 228 | Ga0495592_0306900 | 3300046454 | Bacteria | 1030 |
| 229 | Ga0495582_0117744 | 3300046473 | Bacteria | 1495 |
| 230 | Ga0495639_0061829 | 3300046475 | Bacteria | 1717 |
| 231 | Ga0495628_0076124 | 3300046516 | Unclassified | 2612 |
| 232 | Ga0495635_0031340 | 3300046663 | Bacteria | 3692 |
| 233 | Ga0495599_0104986 | 3300046678 | Bacteria | 1760 |
| 234 | Ga0495658_0040220 | 3300046683 | Unclassified | 2599 |
| 235 | Ga0495669_0005658 | 3300046684 | Bacteria | 5215 |
| 236 | Ga0496104_0402041 | 3300048907 | Bacteria | 1282 |
| 237 | Ga0496106_0190452 | 3300048909 | Unclassified | 1631 |
| 238 | Ga0496107_0233332 | 3300048910 | Unclassified | 1369 |
| 239 | Ga0496112_0383810 | 3300048915 | Unclassified | 1346 |
| 240 | Ga0496113_0169045 | 3300048916 | Bacteria | 1731 |
| 241 | Ga0496115_0256617 | 3300048918 | Bacteria | 1438 |
| 242 | Ga0501296_004197 | 3300049519 | Unclassified | 1562 |
| 243 | Ga0501298_012094 | 3300049521 | Unclassified | 1508 |
| 244 | Ga0501224_034348 | 3300049664 | Unclassified | 761 |
| 245 | Ga0501227_077816 | 3300049665 | Unclassified | 867 |
| 246 | Ga0501233_029744 | 3300049668 | Unclassified | 1227 |
| 247 | Ga0501236_043827 | 3300049670 | Unclassified | 748 |
| 248 | Ga0501239_033165 | 3300049672 | Unclassified | 686 |
| 249 | Ga0501257_027869 | 3300049686 | Unclassified | 1353 |
| 250 | nmdc:mga05p37_257961_c1 | 3300050507 | Unclassified | 2088 |
| 251 | nmdc:mga05p37_27057_c1 | 3300050507 | Bacteria | 6980 |
| 252 | nmdc:mga08y16_40359_c1 | 3300050511 | Bacteria | 4893 |
| 253 | nmdc:mga08y16_90550_c1 | 3300050511 | Bacteria | 3189 |
| 254 | nmdc:mga0n895_55764_c1 | 3300050512 | Bacteria | 3890 |
| 255 | nmdc:mga0n895_58317_c1 | 3300050512 | Unclassified | 3806 |
| 256 | nmdc:mga0n895_776741_c1 | 3300050512 | Bacteria | 950 |
| 257 | nmdc:mga0rr50_206055_c1 | 3300050513 | Bacteria | 1618 |
| 258 | nmdc:mga0rr50_60804_c1 | 3300050513 | Bacteria | 2843 |
| 259 | nmdc:mga0a205_120597_c1 | 3300050515 | Bacteria | 2522 |
| 260 | nmdc:mga0a205_158987_c1 | 3300050515 | Bacteria | 2157 |
| 261 | nmdc:mga0a205_283868_c1 | 3300050515 | Bacteria | 1531 |
| 262 | nmdc:mga0a205_35118_c1 | 3300050515 | Bacteria | 4814 |
| 263 | nmdc:mga0a205_35265_c1 | 3300050515 | Bacteria | 4803 |
| 264 | nmdc:mga0a205_389229_c1 | 3300050515 | Bacteria | 1259 |
| 265 | Ga0495619_0015915 | 3300053085 | Bacteria | 4763 |
| 266 | Ga0500568_0006749 | 3300053139 | Bacteria | 5734 |
| 267 | Ga0590077_008750 | 3300059426 | Bacteria | 2073 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100063031 | Ga0307408_1000630313 | 181 |
| 2 | 3300031852 | Ga0307410_10000199 | Ga0307410_1000019912 | 181 |
| 3 | 3300031901 | Ga0307406_10054480 | Ga0307406_100544802 | 181 |
| 4 | 3300031903 | Ga0307407_10053186 | Ga0307407_100531863 | 181 |
| 5 | 3300031995 | Ga0307409_100001157 | Ga0307409_1000011579 | 181 |
| 6 | 3300032002 | Ga0307416_100001886 | Ga0307416_1000018866 | 181 |
| 7 | 3300049672 | Ga0501239_033165 | Ga0501239_033165_20_640 | 181 |
| 8 | 3300046683 | Ga0495658_0040220 | Ga0495658_0040220_16_618 | 182 |
| 9 | 3300005354 | Ga0070675_100937779 | Ga0070675_1009377791 | 195 |
| 10 | 3300009094 | Ga0111539_10328490 | Ga0111539_103284903 | 195 |
| 11 | 3300005334 | Ga0068869_100049981 | Ga0068869_1000499814 | 196 |
| 12 | 3300005367 | Ga0070667_100010496 | Ga0070667_1000104967 | 196 |
| 13 | 3300005617 | Ga0068859_100891136 | Ga0068859_1008911361 | 196 |
| 14 | 3300005618 | Ga0068864_100092821 | Ga0068864_1000928215 | 196 |
| 15 | 3300005842 | Ga0068858_100087993 | Ga0068858_1000879935 | 196 |
| 16 | 3300005843 | Ga0068860_100041485 | Ga0068860_1000414852 | 196 |
| 17 | 3300006237 | Ga0097621_100174639 | Ga0097621_1001746393 | 196 |
| 18 | 3300006358 | Ga0068871_100118906 | Ga0068871_1001189063 | 196 |
| 19 | 3300006914 | Ga0075436_100172944 | Ga0075436_1001729442 | 196 |
| 20 | 3300006931 | Ga0097620_100891108 | Ga0097620_1008911082 | 196 |
| 21 | 3300009176 | Ga0105242_10026020 | Ga0105242_100260203 | 196 |
| 22 | 3300009553 | Ga0105249_10113477 | Ga0105249_101134772 | 196 |
| 23 | 3300013306 | Ga0163162_10085125 | Ga0163162_100851254 | 196 |
| 24 | 3300014969 | Ga0157376_10428268 | Ga0157376_104282682 | 196 |
| 25 | 3300025934 | Ga0207686_10207017 | Ga0207686_102070173 | 196 |
| 26 | 3300025942 | Ga0207689_10174472 | Ga0207689_101744721 | 196 |
| 27 | 3300025961 | Ga0207712_10362684 | Ga0207712_103626842 | 196 |
| 28 | 3300025986 | Ga0207658_10093579 | Ga0207658_100935792 | 196 |
| 29 | 3300026088 | Ga0207641_10171235 | Ga0207641_101712353 | 196 |
| 30 | 3300026089 | Ga0207648_10062791 | Ga0207648_100627914 | 196 |
| 31 | 3300028381 | Ga0268264_10080882 | Ga0268264_100808823 | 196 |
| 32 | 3300044673 | Ga0453683_0731595 | Ga0453683_0731595_30_638 | 196 |
| 33 | 3300005578 | Ga0068854_100563544 | Ga0068854_1005635441 | 197 |
| 34 | 3300017792 | Ga0163161_10082770 | Ga0163161_100827703 | 197 |
| 35 | 3300005444 | Ga0070694_100423675 | Ga0070694_1004236752 | 201 |
| 36 | 3300005617 | Ga0068859_100541232 | Ga0068859_1005412322 | 201 |
| 37 | 3300006931 | Ga0097620_100541243 | Ga0097620_1005412432 | 201 |
| 38 | 3300005618 | Ga0068864_100236898 | Ga0068864_1002368983 | 202 |
| 39 | 3300026095 | Ga0207676_10479892 | Ga0207676_104798921 | 202 |
| 40 | 3300005340 | Ga0070689_100016955 | Ga0070689_1000169554 | 203 |
| 41 | 3300005618 | Ga0068864_100017378 | Ga0068864_1000173787 | 203 |
| 42 | 3300005841 | Ga0068863_100094594 | Ga0068863_1000945943 | 203 |
| 43 | 3300005843 | Ga0068860_100460754 | Ga0068860_1004607541 | 203 |
| 44 | 3300005844 | Ga0068862_100193813 | Ga0068862_1001938132 | 203 |
| 45 | 3300007076 | Ga0075435_100036855 | Ga0075435_1000368553 | 203 |
| 46 | 3300025936 | Ga0207670_10001000 | Ga0207670_1000100012 | 203 |
| 47 | 3300025941 | Ga0207711_10124365 | Ga0207711_101243653 | 203 |
| 48 | 3300026095 | Ga0207676_10005029 | Ga0207676_100050299 | 203 |
| 49 | 3300028380 | Ga0268265_10011995 | Ga0268265_100119955 | 203 |
| 50 | 3300028381 | Ga0268264_10602923 | Ga0268264_106029231 | 203 |
| 51 | 3300050513 | nmdc:mga0rr50_60804_c1 | nmdc:mga0rr50_60804_c1_1374_2078 | 203 |
| 52 | 3300005444 | Ga0070694_100134836 | Ga0070694_1001348363 | 204 |
| 53 | 3300005549 | Ga0070704_100185666 | Ga0070704_1001856662 | 204 |
| 54 | 3300005844 | Ga0068862_100387159 | Ga0068862_1003871592 | 204 |
| 55 | 3300006881 | Ga0068865_100333243 | Ga0068865_1003332432 | 204 |
| 56 | 3300025908 | Ga0207643_10101451 | Ga0207643_101014512 | 204 |
| 57 | 3300025917 | Ga0207660_10732592 | Ga0207660_107325921 | 204 |
| 58 | 3300025935 | Ga0207709_10249848 | Ga0207709_102498482 | 204 |
| 59 | 3300031995 | Ga0307409_100576876 | Ga0307409_1005768762 | 204 |
| 60 | 3300032005 | Ga0307411_10563803 | Ga0307411_105638031 | 204 |
| 61 | 3300032126 | Ga0307415_100011451 | Ga0307415_1000114512 | 204 |
| 62 | 3300037471 | Ga0395905_0202489 | Ga0395905_0202489_228_875 | 204 |
| 63 | 3300005344 | Ga0070661_100063919 | Ga0070661_1000639192 | 205 |
| 64 | 3300005458 | Ga0070681_10006535 | Ga0070681_100065358 | 205 |
| 65 | 3300005530 | Ga0070679_100016465 | Ga0070679_1000164658 | 205 |
| 66 | 3300005539 | Ga0068853_100057577 | Ga0068853_1000575775 | 205 |
| 67 | 3300005563 | Ga0068855_100042729 | Ga0068855_1000427294 | 205 |
| 68 | 3300005564 | Ga0070664_100007448 | Ga0070664_1000074487 | 205 |
| 69 | 3300005577 | Ga0068857_100017147 | Ga0068857_1000171478 | 205 |
| 70 | 3300006852 | Ga0075433_10187271 | Ga0075433_101872712 | 205 |
| 71 | 3300025912 | Ga0207707_10010053 | Ga0207707_100100532 | 205 |
| 72 | 3300025917 | Ga0207660_10045850 | Ga0207660_100458503 | 205 |
| 73 | 3300025920 | Ga0207649_10021324 | Ga0207649_100213243 | 205 |
| 74 | 3300025921 | Ga0207652_10006605 | Ga0207652_100066053 | 205 |
| 75 | 3300026041 | Ga0207639_10091125 | Ga0207639_100911254 | 205 |
| 76 | 3300026116 | Ga0207674_10000054 | Ga0207674_1000005483 | 205 |
| 77 | 3300031090 | Ga0265760_10113544 | Ga0265760_101135441 | 205 |
| 78 | 3300050512 | nmdc:mga0n895_55764_c1 | nmdc:mga0n895_55764_c1_1927_2547 | 205 |
| 79 | 3300050515 | nmdc:mga0a205_283868_c1 | nmdc:mga0a205_283868_c1_807_1427 | 205 |
| 80 | 3300059426 | Ga0590077_008750 | Ga0590077_008750_855_1487 | 205 |
| 81 | 3300005331 | Ga0070670_100714301 | Ga0070670_1007143011 | 206 |
| 82 | 3300005354 | Ga0070675_100790941 | Ga0070675_1007909411 | 206 |
| 83 | 3300005365 | Ga0070688_100167982 | Ga0070688_1001679822 | 206 |
| 84 | 3300005459 | Ga0068867_100332601 | Ga0068867_1003326011 | 206 |
| 85 | 3300005466 | Ga0070685_10158350 | Ga0070685_101583503 | 206 |
| 86 | 3300005545 | Ga0070695_100004154 | Ga0070695_1000041543 | 206 |
| 87 | 3300005617 | Ga0068859_100060808 | Ga0068859_1000608083 | 206 |
| 88 | 3300005618 | Ga0068864_100135919 | Ga0068864_1001359193 | 206 |
| 89 | 3300006931 | Ga0097620_100060808 | Ga0097620_1000608084 | 206 |
| 90 | 3300009177 | Ga0105248_10016729 | Ga0105248_100167298 | 206 |
| 91 | 3300009553 | Ga0105249_10594837 | Ga0105249_105948372 | 206 |
| 92 | 3300013307 | Ga0157372_10074128 | Ga0157372_100741282 | 206 |
| 93 | 3300013307 | Ga0157372_10604012 | Ga0157372_106040122 | 206 |
| 94 | 3300014325 | Ga0163163_10113445 | Ga0163163_101134453 | 206 |
| 95 | 3300025925 | Ga0207650_10217534 | Ga0207650_102175342 | 206 |
| 96 | 3300025941 | Ga0207711_10028793 | Ga0207711_100287935 | 206 |
| 97 | 3300025972 | Ga0207668_10601331 | Ga0207668_106013311 | 206 |
| 98 | 3300026088 | Ga0207641_10047474 | Ga0207641_100474745 | 206 |
| 99 | 3300031731 | Ga0307405_10036576 | Ga0307405_100365762 | 206 |
| 100 | 3300031824 | Ga0307413_10001823 | Ga0307413_100018233 | 206 |
| 101 | 3300031852 | Ga0307410_10001494 | Ga0307410_100014943 | 206 |
| 102 | 3300031903 | Ga0307407_10008628 | Ga0307407_100086282 | 206 |
| 103 | 3300031911 | Ga0307412_10261452 | Ga0307412_102614522 | 206 |
| 104 | 3300031911 | Ga0307412_10375793 | Ga0307412_103757932 | 206 |
| 105 | 3300031995 | Ga0307409_100001367 | Ga0307409_1000013678 | 206 |
| 106 | 3300032002 | Ga0307416_100034361 | Ga0307416_1000343613 | 206 |
| 107 | 3300032004 | Ga0307414_10031552 | Ga0307414_100315525 | 206 |
| 108 | 3300032126 | Ga0307415_100017288 | Ga0307415_1000172884 | 206 |
| 109 | 3300038996 | Ga0242420_000919 | Ga0242420_000919_2381_3037 | 206 |
| 110 | 3300005471 | Ga0070698_100007337 | Ga0070698_10000733710 | 207 |
| 111 | 3300006871 | Ga0075434_100235001 | Ga0075434_1002350013 | 207 |
| 112 | 3300009094 | Ga0111539_10275515 | Ga0111539_102755153 | 207 |
| 113 | 3300013297 | Ga0157378_10041378 | Ga0157378_100413782 | 207 |
| 114 | 3300017792 | Ga0163161_10833335 | Ga0163161_108333352 | 207 |
| 115 | 3300035207 | Ga0373942_0065425 | Ga0373942_0065425_302_934 | 207 |
| 116 | 3300046454 | Ga0495592_0306900 | Ga0495592_0306900_254_883 | 207 |
| 117 | 3300046516 | Ga0495628_0076124 | Ga0495628_0076124_177_806 | 207 |
| 118 | 3300046678 | Ga0495599_0104986 | Ga0495599_0104986_880_1509 | 207 |
| 119 | 3300050512 | nmdc:mga0n895_776741_c1 | nmdc:mga0n895_776741_c1_286_918 | 207 |
| 120 | 3300005295 | Ga0065707_10101518 | Ga0065707_101015182 | 208 |
| 121 | 3300005353 | Ga0070669_100229958 | Ga0070669_1002299582 | 208 |
| 122 | 3300005440 | Ga0070705_100319767 | Ga0070705_1003197672 | 208 |
| 123 | 3300005468 | Ga0070707_100015435 | Ga0070707_1000154353 | 208 |
| 124 | 3300005471 | Ga0070698_100002938 | Ga0070698_10000293810 | 208 |
| 125 | 3300005471 | Ga0070698_100880694 | Ga0070698_1008806941 | 208 |
| 126 | 3300005518 | Ga0070699_100079331 | Ga0070699_1000793314 | 208 |
| 127 | 3300005518 | Ga0070699_100510894 | Ga0070699_1005108942 | 208 |
| 128 | 3300005545 | Ga0070695_100070872 | Ga0070695_1000708722 | 208 |
| 129 | 3300005549 | Ga0070704_100029605 | Ga0070704_1000296052 | 208 |
| 130 | 3300005617 | Ga0068859_100125255 | Ga0068859_1001252553 | 208 |
| 131 | 3300005617 | Ga0068859_100363724 | Ga0068859_1003637243 | 208 |
| 132 | 3300005618 | Ga0068864_100052683 | Ga0068864_1000526835 | 208 |
| 133 | 3300006173 | Ga0070716_100000009 | Ga0070716_100000009135 | 208 |
| 134 | 3300006852 | Ga0075433_10014857 | Ga0075433_100148577 | 208 |
| 135 | 3300006931 | Ga0097620_100024441 | Ga0097620_1000244414 | 208 |
| 136 | 3300006931 | Ga0097620_100125252 | Ga0097620_1001252523 | 208 |
| 137 | 3300006931 | Ga0097620_100363704 | Ga0097620_1003637042 | 208 |
| 138 | 3300009094 | Ga0111539_10005527 | Ga0111539_1000552715 | 208 |
| 139 | 3300009147 | Ga0114129_10248333 | Ga0114129_102483333 | 208 |
| 140 | 3300009174 | Ga0105241_10066160 | Ga0105241_100661602 | 208 |
| 141 | 3300009174 | Ga0105241_10170697 | Ga0105241_101706972 | 208 |
| 142 | 3300011119 | Ga0105246_10266412 | Ga0105246_102664122 | 208 |
| 143 | 3300013100 | Ga0157373_10038219 | Ga0157373_100382193 | 208 |
| 144 | 3300013100 | Ga0157373_10085921 | Ga0157373_100859214 | 208 |
| 145 | 3300013297 | Ga0157378_10003980 | Ga0157378_100039808 | 208 |
| 146 | 3300014325 | Ga0163163_10136875 | Ga0163163_101368753 | 208 |
| 147 | 3300014326 | Ga0157380_10372307 | Ga0157380_103723073 | 208 |
| 148 | 3300025911 | Ga0207654_10011943 | Ga0207654_100119432 | 208 |
| 149 | 3300025922 | Ga0207646_10007518 | Ga0207646_100075186 | 208 |
| 150 | 3300025939 | Ga0207665_10000001 | Ga0207665_100000015 | 208 |
| 151 | 3300025942 | Ga0207689_10093790 | Ga0207689_100937904 | 208 |
| 152 | 3300026035 | Ga0207703_10603895 | Ga0207703_106038952 | 208 |
| 153 | 3300026035 | Ga0207703_10702024 | Ga0207703_107020242 | 208 |
| 154 | 3300026095 | Ga0207676_10052858 | Ga0207676_100528584 | 208 |
| 155 | 3300026095 | Ga0207676_10311076 | Ga0207676_103110761 | 208 |
| 156 | 3300026116 | Ga0207674_10869749 | Ga0207674_108697491 | 208 |
| 157 | 3300027907 | Ga0207428_10141254 | Ga0207428_101412542 | 208 |
| 158 | 3300028380 | Ga0268265_10709196 | Ga0268265_107091962 | 208 |
| 159 | 3300028381 | Ga0268264_10399751 | Ga0268264_103997512 | 208 |
| 160 | 3300032002 | Ga0307416_100497345 | Ga0307416_1004973452 | 208 |
| 161 | 3300035121 | Ga0373960_0130037 | Ga0373960_0130037_64_693 | 208 |
| 162 | 3300048915 | Ga0496112_0383810 | Ga0496112_0383810_280_930 | 208 |
| 163 | 3300049519 | Ga0501296_004197 | Ga0501296_004197_177_812 | 208 |
| 164 | 3300049521 | Ga0501298_012094 | Ga0501298_012094_551_1186 | 208 |
| 165 | 3300049664 | Ga0501224_034348 | Ga0501224_034348_45_680 | 208 |
| 166 | 3300049665 | Ga0501227_077816 | Ga0501227_077816_13_648 | 208 |
| 167 | 3300049668 | Ga0501233_029744 | Ga0501233_029744_24_659 | 208 |
| 168 | 3300049670 | Ga0501236_043827 | Ga0501236_043827_97_732 | 208 |
| 169 | 3300049686 | Ga0501257_027869 | Ga0501257_027869_25_660 | 208 |
| 170 | 3300050511 | nmdc:mga08y16_40359_c1 | nmdc:mga08y16_40359_c1_1416_2102 | 208 |
| 171 | 3300050515 | nmdc:mga0a205_120597_c1 | nmdc:mga0a205_120597_c1_27_656 | 208 |
| 172 | 3300050515 | nmdc:mga0a205_35265_c1 | nmdc:mga0a205_35265_c1_1391_2020 | 208 |
| 173 | 3300037471 | Ga0395905_0341769 | Ga0395905_0341769_494_1132 | 209 |
| 174 | 3300039447 | Ga0436361_0345110 | Ga0436361_0345110_378_1025 | 209 |
| 175 | 3300005406 | Ga0070703_10002161 | Ga0070703_100021614 | 210 |
| 176 | 3300005440 | Ga0070705_100005738 | Ga0070705_1000057385 | 210 |
| 177 | 3300005471 | Ga0070698_100009797 | Ga0070698_1000097974 | 210 |
| 178 | 3300005546 | Ga0070696_100057408 | Ga0070696_1000574083 | 210 |
| 179 | 3300009147 | Ga0114129_10166173 | Ga0114129_101661734 | 210 |
| 180 | 3300021361 | Ga0213872_10035741 | Ga0213872_100357413 | 210 |
| 181 | 3300025885 | Ga0207653_10010375 | Ga0207653_100103753 | 210 |
| 182 | 3300031548 | Ga0307408_100299298 | Ga0307408_1002992982 | 210 |
| 183 | 3300032002 | Ga0307416_100089763 | Ga0307416_1000897634 | 210 |
| 184 | 3300039447 | Ga0436361_0586031 | Ga0436361_0586031_2717_3361 | 210 |
| 185 | 3300050507 | nmdc:mga05p37_257961_c1 | nmdc:mga05p37_257961_c1_1206_1850 | 210 |
| 186 | 3300050515 | nmdc:mga0a205_158987_c1 | nmdc:mga0a205_158987_c1_788_1444 | 210 |
| 187 | 3300050515 | nmdc:mga0a205_35118_c1 | nmdc:mga0a205_35118_c1_3553_4197 | 210 |
| 188 | 3300005344 | Ga0070661_100363053 | Ga0070661_1003630532 | 211 |
| 189 | 3300005444 | Ga0070694_100007600 | Ga0070694_1000076002 | 211 |
| 190 | 3300005545 | Ga0070695_100907115 | Ga0070695_1009071151 | 211 |
| 191 | 3300031901 | Ga0307406_10326510 | Ga0307406_103265102 | 211 |
| 192 | 3300031995 | Ga0307409_100020369 | Ga0307409_1000203694 | 211 |
| 193 | 3300032126 | Ga0307415_100030313 | Ga0307415_1000303133 | 211 |
| 194 | 3300032005 | Ga0307411_10010663 | Ga0307411_100106636 | 212 |
| 195 | 3300053139 | Ga0500568_0006749 | Ga0500568_0006749_1807_2472 | 212 |
| 196 | 3300005329 | Ga0070683_100097905 | Ga0070683_1000979053 | 214 |
| 197 | 3300005334 | Ga0068869_100412293 | Ga0068869_1004122932 | 214 |
| 198 | 3300005338 | Ga0068868_100231784 | Ga0068868_1002317842 | 214 |
| 199 | 3300005343 | Ga0070687_100058714 | Ga0070687_1000587142 | 214 |
| 200 | 3300005345 | Ga0070692_10449579 | Ga0070692_104495791 | 214 |
| 201 | 3300005353 | Ga0070669_100348676 | Ga0070669_1003486761 | 214 |
| 202 | 3300005438 | Ga0070701_10063560 | Ga0070701_100635601 | 214 |
| 203 | 3300005456 | Ga0070678_100063321 | Ga0070678_1000633212 | 214 |
| 204 | 3300005535 | Ga0070684_100530929 | Ga0070684_1005309291 | 214 |
| 205 | 3300005547 | Ga0070693_100543551 | Ga0070693_1005435511 | 214 |
| 206 | 3300005614 | Ga0068856_100113111 | Ga0068856_1001131113 | 214 |
| 207 | 3300005616 | Ga0068852_100346700 | Ga0068852_1003467001 | 214 |
| 208 | 3300005618 | Ga0068864_100188936 | Ga0068864_1001889362 | 214 |
| 209 | 3300005841 | Ga0068863_100041083 | Ga0068863_1000410833 | 214 |
| 210 | 3300005842 | Ga0068858_100040731 | Ga0068858_1000407312 | 214 |
| 211 | 3300005843 | Ga0068860_101111814 | Ga0068860_1011118141 | 214 |
| 212 | 3300009148 | Ga0105243_10117159 | Ga0105243_101171592 | 214 |
| 213 | 3300009177 | Ga0105248_10066395 | Ga0105248_100663954 | 214 |
| 214 | 3300009551 | Ga0105238_10266904 | Ga0105238_102669042 | 214 |
| 215 | 3300010375 | Ga0105239_10308357 | Ga0105239_103083573 | 214 |
| 216 | 3300013296 | Ga0157374_10054930 | Ga0157374_100549303 | 214 |
| 217 | 3300013297 | Ga0157378_10275017 | Ga0157378_102750172 | 214 |
| 218 | 3300014325 | Ga0163163_10063945 | Ga0163163_100639453 | 214 |
| 219 | 3300014325 | Ga0163163_10199451 | Ga0163163_101994512 | 214 |
| 220 | 3300025918 | Ga0207662_10005106 | Ga0207662_100051064 | 214 |
| 221 | 3300025938 | Ga0207704_10527870 | Ga0207704_105278701 | 214 |
| 222 | 3300025941 | Ga0207711_10574728 | Ga0207711_105747281 | 214 |
| 223 | 3300025945 | Ga0207679_10216314 | Ga0207679_102163142 | 214 |
| 224 | 3300025981 | Ga0207640_10667164 | Ga0207640_106671641 | 214 |
| 225 | 3300026035 | Ga0207703_10148698 | Ga0207703_101486982 | 214 |
| 226 | 3300026088 | Ga0207641_10388939 | Ga0207641_103889391 | 214 |
| 227 | 3300026121 | Ga0207683_10322140 | Ga0207683_103221401 | 214 |
| 228 | 3300026142 | Ga0207698_10242141 | Ga0207698_102421411 | 214 |
| 229 | 3300026142 | Ga0207698_10778627 | Ga0207698_107786272 | 214 |
| 230 | 3300037068 | Ga0373925_0186467 | Ga0373925_0186467_607_1302 | 214 |
| 231 | 3300045051 | Ga0451576_0489807 | Ga0451576_0489807_574_1260 | 214 |
| 232 | 3300046473 | Ga0495582_0117744 | Ga0495582_0117744_61_756 | 214 |
| 233 | 3300046475 | Ga0495639_0061829 | Ga0495639_0061829_520_1215 | 214 |
| 234 | 3300046663 | Ga0495635_0031340 | Ga0495635_0031340_2121_2816 | 214 |
| 235 | 3300046684 | Ga0495669_0005658 | Ga0495669_0005658_3079_3765 | 214 |
| 236 | 3300048907 | Ga0496104_0402041 | Ga0496104_0402041_509_1195 | 214 |
| 237 | 3300048909 | Ga0496106_0190452 | Ga0496106_0190452_231_917 | 214 |
| 238 | 3300048916 | Ga0496113_0169045 | Ga0496113_0169045_21_707 | 214 |
| 239 | 3300048918 | Ga0496115_0256617 | Ga0496115_0256617_83_769 | 214 |
| 240 | 3300050511 | nmdc:mga08y16_90550_c1 | nmdc:mga08y16_90550_c1_24_680 | 214 |
| 241 | 3300053085 | Ga0495619_0015915 | Ga0495619_0015915_1797_2492 | 214 |
| 242 | 3300005293 | Ga0065715_10069084 | Ga0065715_100690841 | 215 |
| 243 | 3300005295 | Ga0065707_10114841 | Ga0065707_101148412 | 215 |
| 244 | 3300005336 | Ga0070680_100001080 | Ga0070680_10000108020 | 215 |
| 245 | 3300005345 | Ga0070692_10123472 | Ga0070692_101234722 | 215 |
| 246 | 3300005457 | Ga0070662_100686582 | Ga0070662_1006865821 | 215 |
| 247 | 3300005530 | Ga0070679_100000502 | Ga0070679_1000005028 | 215 |
| 248 | 3300005546 | Ga0070696_100218746 | Ga0070696_1002187461 | 215 |
| 249 | 3300005547 | Ga0070693_100184103 | Ga0070693_1001841031 | 215 |
| 250 | 3300005547 | Ga0070693_100357867 | Ga0070693_1003578672 | 215 |
| 251 | 3300006852 | Ga0075433_10083601 | Ga0075433_100836013 | 215 |
| 252 | 3300006871 | Ga0075434_100379309 | Ga0075434_1003793091 | 215 |
| 253 | 3300007076 | Ga0075435_100351438 | Ga0075435_1003514381 | 215 |
| 254 | 3300009147 | Ga0114129_10313694 | Ga0114129_103136941 | 215 |
| 255 | 3300013297 | Ga0157378_10818178 | Ga0157378_108181781 | 215 |
| 256 | 3300013306 | Ga0163162_10506209 | Ga0163162_105062091 | 215 |
| 257 | 3300025912 | Ga0207707_10000004 | Ga0207707_10000004108 | 215 |
| 258 | 3300025917 | Ga0207660_10001262 | Ga0207660_100012622 | 215 |
| 259 | 3300025921 | Ga0207652_10000941 | Ga0207652_100009417 | 215 |
| 260 | 3300025942 | Ga0207689_10100091 | Ga0207689_101000912 | 215 |
| 261 | 3300025949 | Ga0207667_11006444 | Ga0207667_110064442 | 215 |
| 262 | 3300038443 | Ga0395901_0291719 | Ga0395901_0291719_548_1267 | 215 |
| 263 | 3300048910 | Ga0496107_0233332 | Ga0496107_0233332_102_806 | 215 |
| 264 | 3300050507 | nmdc:mga05p37_27057_c1 | nmdc:mga05p37_27057_c1_2544_3263 | 215 |
| 265 | 3300050512 | nmdc:mga0n895_58317_c1 | nmdc:mga0n895_58317_c1_97_753 | 215 |
| 266 | 3300050513 | nmdc:mga0rr50_206055_c1 | nmdc:mga0rr50_206055_c1_807_1484 | 215 |
| 267 | 3300050515 | nmdc:mga0a205_389229_c1 | nmdc:mga0a205_389229_c1_444_1163 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4m6r-assembly1.cif.gz_D | structural and biochemical basis for the inhibition of cell death by apip, a methionine salvage enzyme | 0.912 | 18 | 212 |
| 2irp-assembly1.cif.gz_A | crystal structure of the l-fuculose-1-phosphate aldolase (aq_1979) from aquifex aeolicus vf5 | 0.8906 | 12 | 211 |
| 7x78-assembly1.cif.gz_A | l-fuculose 1-phosphate aldolase | 0.8806 | 12 | 212 |
| 1e4c-assembly1.cif.gz_P | l-fuculose 1-phosphate aldolase from escherichia coli mutant s71q | 0.8797 | 10 | 212 |
| 1e46-assembly1.cif.gz_P | l-fuculose 1-phosphate aldolase from escherichia coli mutant e73s | 0.8771 | 10 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9HE08_16_228_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9257 | 11 | 214 | 3.40.225.10 |
| af_I1KDU3_22_246_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9253 | 13 | 213 | 3.40.225.10 |
| af_P47095_12_237_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9082 | 15 | 211 | 3.40.225.10 |
| af_Q54NY7_4_228_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.8946 | 18 | 213 | 3.40.225.10 |
| 2irpB00 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.8935 | 12 | 211 | 3.40.225.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7MKD5-F1-model_v4 | Methylthioribulose 1-phosphate dehydratase (EC 4.2.1.109) | 0.9916 | 10 | 212 |
GO:0005737
GO:0016810 GO:0016829 GO:0019509 GO:0046872 |
| AF-A0A2V9AHD3-F1-model_v4 | Methylthioribulose-1-phosphate dehydratase (MTRu-1-P dehydratase) (EC 4.2.1.109) | 0.9869 | 12 | 213 |
GO:0005737
GO:0008270 GO:0019509 GO:0046570 |
| AF-A0A2V8NF28-F1-model_v4 | Methylthioribulose-1-phosphate dehydratase (MTRu-1-P dehydratase) (EC 4.2.1.109) | 0.9859 | 10 | 214 |
GO:0005737
GO:0008270 GO:0019509 GO:0046570 |
| AF-A0A218ZRQ4-F1-model_v4 | Methylthioribulose-1-phosphate dehydratase | 0.9837 | 10 | 209 |
GO:0005737
GO:0008738 GO:0019509 GO:0046570 GO:0046872 |
| AF-A0A7J3TEW5-F1-model_v4 | Methylthioribulose 1-phosphate dehydratase (EC 4.2.1.109) | 0.983 | 12 | 211 |
GO:0005737
GO:0008738 GO:0019509 GO:0046570 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar