F374674

General Info

Members Datasets Scaffolds Average Seq Length
267 181 267 130

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_101999511|Ga0097621_1019995111
Length 142
Sequence MMTAKQAKREAKQLFRLCLVGRKLDEQRTRMVVERILQSKPRGYLSLLGFFLKLVKFDYFQRTAEIECAVPVSPALQARVQAGIENLYGQGITSLFVLNPALIGGMRIKVGSDVYDGSIRSRLATLAKSFGIASTNGQYASA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
116 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
117 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
118 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
119 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
120 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
121 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.37
Nodule 0
Rhizoplane 2.62
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10187271 3300005290 Bacteria 1164
2 Ga0065707_10304389 3300005295 Unclassified 997
3 Ga0065707_10506502 3300005295 Bacteria 753
4 Ga0070690_100707433 3300005330 Unclassified 774
5 Ga0070670_100056361 3300005331 Bacteria 3373
6 Ga0070670_100288391 3300005331 Bacteria 1434
7 Ga0070670_100765963 3300005331 Bacteria 870
8 Ga0070680_100659813 3300005336 Unclassified 899
9 Ga0068868_100286762 3300005338 Bacteria 1395
10 Ga0070689_100365173 3300005340 Unclassified 1214
11 Ga0070691_10195543 3300005341 Bacteria 1060
12 Ga0070687_100400079 3300005343 Unclassified 900
13 Ga0070668_100077938 3300005347 Bacteria 2591
14 Ga0070669_100340216 3300005353 Bacteria 1216
15 Ga0070675_100446262 3300005354 Bacteria 1160
16 Ga0070675_102033776 3300005354 Unclassified 530
17 Ga0070671_100032287 3300005355 Bacteria 4329
18 Ga0070674_100931110 3300005356 Bacteria 759
19 Ga0070674_102199242 3300005356 Bacteria 504
20 Ga0070673_100097707 3300005364 Bacteria 2412
21 Ga0070659_101263612 3300005366 Unclassified 654
22 Ga0070667_100234351 3300005367 Bacteria 1637
23 Ga0070667_100606153 3300005367 Bacteria 1009
24 Ga0070705_100451645 3300005440 Unclassified 964
25 Ga0070694_100217352 3300005444 Bacteria 1432
26 Ga0070708_100185202 3300005445 Bacteria 1947
27 Ga0070663_100360969 3300005455 Bacteria 1178
28 Ga0070678_100095364 3300005456 Bacteria 2292
29 Ga0070662_100737269 3300005457 Bacteria 835
30 Ga0070681_10055727 3300005458 Bacteria 3935
31 Ga0070681_10709036 3300005458 Unclassified 922
32 Ga0070707_100255322 3300005468 Bacteria 1706
33 Ga0070698_100254047 3300005471 Bacteria 1690
34 Ga0070684_101169357 3300005535 Bacteria 723
35 Ga0070697_100347731 3300005536 Bacteria 1280
36 Ga0070672_101406088 3300005543 Bacteria 624
37 Ga0070672_101674032 3300005543 Bacteria 571
38 Ga0070686_100509521 3300005544 Unclassified 935
39 Ga0070695_100037663 3300005545 Bacteria 3050
40 Ga0070664_100016288 3300005564 Bacteria 6094
41 Ga0070664_100879279 3300005564 Bacteria 840
42 Ga0070702_100270351 3300005615 Bacteria 1162
43 Ga0070702_101255892 3300005615 Unclassified 599
44 Ga0068852_100816780 3300005616 Bacteria 947
45 Ga0068859_100653707 3300005617 Bacteria 1143
46 Ga0068864_100061049 3300005618 Bacteria 3265
47 Ga0068864_100502335 3300005618 Bacteria 1167
48 Ga0068864_100514578 3300005618 Bacteria 1153
49 Ga0068864_100757249 3300005618 Bacteria 952
50 Ga0068861_101048511 3300005719 Unclassified 781
51 Ga0068851_10285419 3300005834 Bacteria 945
52 Ga0068863_101432643 3300005841 Bacteria 699
53 Ga0068860_100237335 3300005843 Bacteria 1773
54 Ga0068862_100103576 3300005844 Bacteria 2492
55 Ga0068862_101835183 3300005844 Unclassified 616
56 Ga0075365_10080138 3300006038 Bacteria 2210
57 Ga0075364_10007403 3300006051 Bacteria 6516
58 Ga0070712_100132640 3300006175 Unclassified 1890
59 Ga0075362_10057671 3300006177 Bacteria 1750
60 Ga0075366_10035253 3300006195 Bacteria 2949
61 Ga0097621_101999511 3300006237 Unclassified 554
62 Ga0075370_10561929 3300006353 Bacteria 690
63 Ga0068871_100289833 3300006358 Bacteria 1434
64 Ga0068871_101464257 3300006358 Unclassified 645
65 Ga0075428_100071672 3300006844 Bacteria 3787
66 Ga0075428_100678712 3300006844 Bacteria 1098
67 Ga0075428_102588190 3300006844 Unclassified 518
68 Ga0075430_100066793 3300006846 Bacteria 3020
69 Ga0075431_100104702 3300006847 Bacteria 2920
70 Ga0075431_100169839 3300006847 Bacteria 2241
71 Ga0075434_100313780 3300006871 Bacteria 1588
72 Ga0075434_100963784 3300006871 Bacteria 867
73 Ga0075429_100026250 3300006880 Bacteria 5056
74 Ga0075436_100510635 3300006914 Unclassified 880
75 Ga0097620_100445571 3300006931 Bacteria 1391
76 Ga0097620_100653699 3300006931 Bacteria 1143
77 Ga0099795_10057916 3300007788 Bacteria 1430
78 Ga0105240_10030143 3300009093 Bacteria 7056
79 Ga0111539_10022629 3300009094 Bacteria 7721
80 Ga0111539_10030287 3300009094 Bacteria 6579
81 Ga0111539_10112160 3300009094 Bacteria 3199
82 Ga0111539_10136941 3300009094 Bacteria 2867
83 Ga0111539_10166694 3300009094 Bacteria 2575
84 Ga0114129_10036518 3300009147 Bacteria 6937
85 Ga0114129_10080124 3300009147 Bacteria 4539
86 Ga0114129_10314095 3300009147 Bacteria 2085
87 Ga0114129_10532550 3300009147 Unclassified 1530
88 Ga0114129_11024078 3300009147 Bacteria 1038
89 Ga0105243_11960326 3300009148 Unclassified 619
90 Ga0105248_10052387 3300009177 Bacteria 4579
91 Ga0105248_10079036 3300009177 Bacteria 3697
92 Ga0105248_10143500 3300009177 Bacteria 2694
93 Ga0105238_11199446 3300009551 Bacteria 783
94 Ga0105249_10269216 3300009553 Unclassified 1696
95 Ga0105249_10417024 3300009553 Bacteria 1376
96 Ga0157370_10023921 3300013104 Bacteria 6058
97 Ga0157374_10821860 3300013296 Unclassified 945
98 Ga0157378_11238342 3300013297 Unclassified 786
99 Ga0157378_12760549 3300013297 Unclassified 544
100 Ga0163162_10020855 3300013306 Bacteria 6443
101 Ga0163162_11999816 3300013306 Unclassified 664
102 Ga0163163_10000017 3300014325 Bacteria 208781
103 Ga0163163_10095451 3300014325 Bacteria 2993
104 Ga0163163_10633603 3300014325 Unclassified 1132
105 Ga0157380_10364536 3300014326 Unclassified 1357
106 Ga0157380_12666646 3300014326 Unclassified 566
107 Ga0157377_10173182 3300014745 Unclassified 1351
108 Ga0157376_10112768 3300014969 Bacteria 2396
109 Ga0157376_10312858 3300014969 Bacteria 1490
110 Ga0157376_11136740 3300014969 Bacteria 808
111 Ga0163161_10062723 3300017792 Bacteria 2708
112 Ga0163161_10885905 3300017792 Unclassified 755
113 Ga0207682_10137116 3300025893 Bacteria 1096
114 Ga0207688_10043908 3300025901 Bacteria 2490
115 Ga0207684_10380670 3300025910 Bacteria 1214
116 Ga0207707_10357100 3300025912 Bacteria 1258
117 Ga0207707_11617871 3300025912 Bacteria 510
118 Ga0207695_10089158 3300025913 Bacteria 3102
119 Ga0207646_10183074 3300025922 Bacteria 1892
120 Ga0207681_10282056 3300025923 Bacteria 1308
121 Ga0207650_10696049 3300025925 Bacteria 858
122 Ga0207644_10157544 3300025931 Bacteria 1762
123 Ga0207706_10307980 3300025933 Bacteria 1379
124 Ga0207706_10528537 3300025933 Unclassified 1017
125 Ga0207686_11167772 3300025934 Bacteria 629
126 Ga0207670_10520492 3300025936 Unclassified 968
127 Ga0207669_10241559 3300025937 Bacteria 1339
128 Ga0207669_10588847 3300025937 Bacteria 902
129 Ga0207691_10691895 3300025940 Unclassified 860
130 Ga0207711_10047397 3300025941 Bacteria 3674
131 Ga0207711_10095310 3300025941 Bacteria 2624
132 Ga0207711_10172902 3300025941 Bacteria 1961
133 Ga0207679_10017972 3300025945 Bacteria 4726
134 Ga0207679_10344659 3300025945 Bacteria 1297
135 Ga0207668_10114493 3300025972 Bacteria 2030
136 Ga0207640_10272685 3300025981 Bacteria 1324
137 Ga0207658_10086806 3300025986 Bacteria 2414
138 Ga0207658_10535928 3300025986 Unclassified 1046
139 Ga0207678_10014217 3300026067 Bacteria 6997
140 Ga0207678_11020494 3300026067 Unclassified 732
141 Ga0207641_10165008 3300026088 Bacteria 2016
142 Ga0207641_12209563 3300026088 Bacteria 550
143 Ga0207676_10159574 3300026095 Bacteria 1952
144 Ga0207676_10252913 3300026095 Bacteria 1587
145 Ga0207675_100667266 3300026118 Bacteria 1047
146 Ga0207675_100960693 3300026118 Unclassified 872
147 Ga0207675_101201453 3300026118 Bacteria 778
148 Ga0207683_10024543 3300026121 Bacteria 5194
149 Ga0207428_10083233 3300027907 Bacteria 2496
150 Ga0207428_10261090 3300027907 Unclassified 1290
151 Ga0268264_10240398 3300028381 Bacteria 1677
152 Ga0265334_10003452 3300028573 Bacteria 7188
153 Ga0265338_10106331 3300028800 Bacteria 2272
154 Ga0265338_10143833 3300028800 Bacteria 1864
155 Ga0265320_10197798 3300031240 Unclassified 898
156 Ga0307408_100818586 3300031548 Unclassified 846
157 Ga0307405_10303963 3300031731 Bacteria 1211
158 Ga0307413_11056930 3300031824 Unclassified 699
159 Ga0307410_10391981 3300031852 Unclassified 1120
160 Ga0307406_10040084 3300031901 Bacteria 2910
161 Ga0307406_11256902 3300031901 Bacteria 645
162 Ga0307407_10788155 3300031903 Unclassified 722
163 Ga0307412_10030546 3300031911 Bacteria 3394
164 Ga0307412_10494550 3300031911 Bacteria 1017
165 Ga0307412_11986905 3300031911 Bacteria 538
166 Ga0307416_100003959 3300032002 Bacteria 8823
167 Ga0307416_100190400 3300032002 Bacteria 1934
168 Ga0307416_103107788 3300032002 Bacteria 555
169 Ga0307416_103257327 3300032002 Unclassified 543
170 Ga0307414_10451099 3300032004 Bacteria 1128
171 Ga0307411_10455384 3300032005 Bacteria 1071
172 Ga0373939_0364896 3300035114 Bacteria 591
173 Ga0373955_0183051 3300035172 Unclassified 1244
174 Ga0439453_0115404 3300041408 Unclassified 611
175 Ga0439450_005554 3300042008 Bacteria 2225
176 Ga0450914_013318 3300042118 Bacteria 836
177 Ga0450920_005703 3300042122 Bacteria 2220
178 Ga0450923_036329 3300042125 Bacteria 1022
179 Ga0450910_009736 3300042147 Bacteria 1361
180 Ga0450908_000419 3300042184 Bacteria 8188
181 Ga0439434_0303583 3300042435 Unclassified 552
182 Ga0439435_0014321 3300042436 Bacteria 1958
183 Ga0439435_0021820 3300042436 Bacteria 1666
184 Ga0439435_0137107 3300042436 Unclassified 777
185 Ga0439464_0003381 3300042439 Bacteria 4022
186 Ga0450918_004470 3300042531 Bacteria 2544
187 Ga0451577_0101814 3300042876 Bacteria 2566
188 Ga0451577_0137188 3300042876 Bacteria 2197
189 Ga0451577_0155979 3300042876 Bacteria 2055
190 Ga0453683_1205641 3300044673 Unclassified 507
191 Ga0453684_0187818 3300044712 Bacteria 2420
192 Ga0453684_0662656 3300044712 Bacteria 1138
193 Ga0451576_0298981 3300045051 Bacteria 1683
194 Ga0451576_0361688 3300045051 Bacteria 1520
195 Ga0451576_0551885 3300045051 Bacteria 1210
196 Ga0495592_0139605 3300046454 Bacteria 1687
197 Ga0495584_0031761 3300046491 Bacteria 2672
198 Ga0495663_0020344 3300046525 Bacteria 1904
199 Ga0495642_0048276 3300046528 Bacteria 1745
200 Ga0495609_0157872 3300046538 Bacteria 963
201 Ga0495621_0072573 3300046539 Bacteria 1271
202 Ga0495659_0050668 3300046664 Unclassified 1510
203 Ga0495600_0101431 3300046809 Bacteria 1876
204 Ga0495581_0699573 3300047315 Bacteria 584
205 Ga0495636_0179832 3300047318 Unclassified 959
206 Ga0495676_0335543 3300047321 Bacteria 1013
207 Ga0495677_0023989 3300047445 Bacteria 2213
208 Ga0495685_030570 3300047447 Bacteria 1852
209 Ga0496104_1436193 3300048907 Unclassified 593
210 Ga0496108_0252829 3300048911 Bacteria 1533
211 Ga0496109_1107900 3300048912 Bacteria 729
212 Ga0496111_0165908 3300048914 Bacteria 1640
213 Ga0496112_1111444 3300048915 Bacteria 708
214 Ga0496113_0590386 3300048916 Bacteria 890
215 Ga0496114_0658214 3300048917 Bacteria 921
216 Ga0501031_0387514 3300049568 Bacteria 904
217 Ga0501033_0150946 3300049570 Bacteria 1676
218 Ga0501034_0000245 3300049571 Bacteria 100221
219 Ga0501034_0731082 3300049571 Bacteria 886
220 Ga0501036_0098896 3300049572 Bacteria 2467
221 Ga0501038_0566511 3300049574 Bacteria 862
222 Ga0501040_0041509 3300049576 Bacteria 3134
223 Ga0501040_0156059 3300049576 Bacteria 1612
224 Ga0501041_0206976 3300049577 Bacteria 1230
225 Ga0501043_0943230 3300049579 Bacteria 617
226 Ga0501070_0248074 3300049586 Bacteria 1457
227 Ga0501071_0003362 3300049587 Bacteria 10001
228 Ga0501071_0434340 3300049587 Bacteria 1004
229 Ga0501072_0012934 3300049588 Bacteria 6385
230 Ga0501073_0405198 3300049589 Bacteria 942
231 Ga0501074_0717549 3300049590 Bacteria 705
232 Ga0501075_0278496 3300049591 Bacteria 1275
233 Ga0501075_1555390 3300049591 Bacteria 500
234 Ga0501076_0244675 3300049592 Bacteria 1467
235 Ga0501077_0268330 3300049593 Bacteria 1085
236 Ga0501077_0456011 3300049593 Bacteria 819
237 Ga0501077_0905325 3300049593 Bacteria 567
238 Ga0501079_0046370 3300049741 Bacteria 3354
239 Ga0501079_0135954 3300049741 Bacteria 1914
240 Ga0501080_0088163 3300049742 Bacteria 2883
241 Ga0501080_0218790 3300049742 Bacteria 1743
242 Ga0501045_0250480 3300049824 Bacteria 1318
243 nmdc:mga0yw44_65326_c1 3300050492 Bacteria 2242
244 nmdc:mga0k408_11017_c1 3300050493 Bacteria 4909
245 nmdc:mga0k408_11708_c2 3300050493 Bacteria 3559
246 nmdc:mga05p37_16793_c1 3300050507 Bacteria 8825
247 nmdc:mga05p37_30197_c1 3300050507 Bacteria 6612
248 nmdc:mga09592_10871_c1 3300050508 Bacteria 7407
249 nmdc:mga09592_177954_c1 3300050508 Bacteria 1840
250 nmdc:mga0qj67_1924_c1 3300050509 Bacteria 14743
251 nmdc:mga0qj67_49858_c1 3300050509 Bacteria 3309
252 nmdc:mga06r32_32495_c1 3300050510 Bacteria 4911
253 nmdc:mga06r32_40398_c1 3300050510 Bacteria 4428
254 nmdc:mga06r32_47698_c1 3300050510 Bacteria 4093
255 nmdc:mga08y16_120598_c1 3300050511 Bacteria 2729
256 nmdc:mga08y16_320494_c1 3300050511 Bacteria 1596
257 nmdc:mga08y16_4826_c1 3300050511 Bacteria 14066
258 nmdc:mga08y16_66876_c1 3300050511 Bacteria 3750
259 nmdc:mga08y16_906129_c1 3300050511 Unclassified 867
260 nmdc:mga0rr50_77256_c1 3300050513 Bacteria 2558
261 nmdc:mga0a205_633293_c1 3300050515 Bacteria 921
262 nmdc:mga0a205_75903_c1 3300050515 Bacteria 3247
263 nmdc:mga0sz30_59490_c1 3300050516 Bacteria 1630
264 Ga0495619_0173733 3300053085 Bacteria 1490
265 Ga0501084_0076379 3300054114 Bacteria 2808
266 Ga0501084_0416342 3300054114 Unclassified 1136
267 Ga0501082_0217082 3300060353 Bacteria 1664

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0150946 Ga0501033_0150946_1323_1646 107
2 3300025893 Ga0207682_10137116 Ga0207682_101371162 111
3 3300005336 Ga0070680_100659813 Ga0070680_1006598132 117
4 3300006871 Ga0075434_100963784 Ga0075434_1009637841 117
5 3300049586 Ga0501070_0248074 Ga0501070_0248074_405_797 119
6 3300049589 Ga0501073_0405198 Ga0501073_0405198_19_411 119
7 3300049593 Ga0501077_0905325 Ga0501077_0905325_19_411 119
8 3300049741 Ga0501079_0046370 Ga0501079_0046370_1966_2358 119
9 3300049742 Ga0501080_0088163 Ga0501080_0088163_2100_2492 119
10 3300049568 Ga0501031_0387514 Ga0501031_0387514_61_435 124
11 3300049572 Ga0501036_0098896 Ga0501036_0098896_1743_2117 124
12 3300049574 Ga0501038_0566511 Ga0501038_0566511_242_616 124
13 3300049576 Ga0501040_0041509 Ga0501040_0041509_2375_2749 124
14 3300049577 Ga0501041_0206976 Ga0501041_0206976_135_509 124
15 3300049579 Ga0501043_0943230 Ga0501043_0943230_91_465 124
16 3300049587 Ga0501071_0003362 Ga0501071_0003362_7250_7624 124
17 3300049588 Ga0501072_0012934 Ga0501072_0012934_3847_4221 124
18 3300049591 Ga0501075_1555390 Ga0501075_1555390_13_387 124
19 3300049592 Ga0501076_0244675 Ga0501076_0244675_453_827 124
20 3300049593 Ga0501077_0456011 Ga0501077_0456011_177_551 124
21 3300049741 Ga0501079_0135954 Ga0501079_0135954_960_1334 124
22 3300049742 Ga0501080_0218790 Ga0501080_0218790_193_567 124
23 3300049824 Ga0501045_0250480 Ga0501045_0250480_98_472 124
24 3300054114 Ga0501084_0076379 Ga0501084_0076379_843_1217 124
25 3300060353 Ga0501082_0217082 Ga0501082_0217082_841_1215 124
26 3300005354 Ga0070675_100446262 Ga0070675_1004462622 129
27 3300005543 Ga0070672_101674032 Ga0070672_1016740321 129
28 3300013297 Ga0157378_11238342 Ga0157378_112383422 129
29 3300025940 Ga0207691_10691895 Ga0207691_106918952 129
30 3300042435 Ga0439434_0303583 Ga0439434_0303583_114_503 129
31 3300005290 Ga0065712_10187271 Ga0065712_101872712 130
32 3300005295 Ga0065707_10304389 Ga0065707_103043892 130
33 3300005295 Ga0065707_10506502 Ga0065707_105065021 130
34 3300005330 Ga0070690_100707433 Ga0070690_1007074332 130
35 3300005331 Ga0070670_100056361 Ga0070670_1000563615 130
36 3300005331 Ga0070670_100288391 Ga0070670_1002883912 130
37 3300005331 Ga0070670_100765963 Ga0070670_1007659631 130
38 3300005338 Ga0068868_100286762 Ga0068868_1002867622 130
39 3300005340 Ga0070689_100365173 Ga0070689_1003651732 130
40 3300005341 Ga0070691_10195543 Ga0070691_101955432 130
41 3300005343 Ga0070687_100400079 Ga0070687_1004000792 130
42 3300005347 Ga0070668_100077938 Ga0070668_1000779385 130
43 3300005353 Ga0070669_100340216 Ga0070669_1003402162 130
44 3300005354 Ga0070675_102033776 Ga0070675_1020337761 130
45 3300005355 Ga0070671_100032287 Ga0070671_1000322874 130
46 3300005356 Ga0070674_100931110 Ga0070674_1009311102 130
47 3300005356 Ga0070674_102199242 Ga0070674_1021992421 130
48 3300005364 Ga0070673_100097707 Ga0070673_1000977074 130
49 3300005366 Ga0070659_101263612 Ga0070659_1012636122 130
50 3300005367 Ga0070667_100234351 Ga0070667_1002343512 130
51 3300005367 Ga0070667_100606153 Ga0070667_1006061531 130
52 3300005440 Ga0070705_100451645 Ga0070705_1004516452 130
53 3300005444 Ga0070694_100217352 Ga0070694_1002173522 130
54 3300005445 Ga0070708_100185202 Ga0070708_1001852024 130
55 3300005455 Ga0070663_100360969 Ga0070663_1003609692 130
56 3300005456 Ga0070678_100095364 Ga0070678_1000953641 130
57 3300005457 Ga0070662_100737269 Ga0070662_1007372692 130
58 3300005458 Ga0070681_10055727 Ga0070681_100557274 130
59 3300005458 Ga0070681_10709036 Ga0070681_107090362 130
60 3300005468 Ga0070707_100255322 Ga0070707_1002553222 130
61 3300005471 Ga0070698_100254047 Ga0070698_1002540474 130
62 3300005535 Ga0070684_101169357 Ga0070684_1011693571 130
63 3300005536 Ga0070697_100347731 Ga0070697_1003477312 130
64 3300005543 Ga0070672_101406088 Ga0070672_1014060881 130
65 3300005544 Ga0070686_100509521 Ga0070686_1005095212 130
66 3300005545 Ga0070695_100037663 Ga0070695_1000376634 130
67 3300005564 Ga0070664_100016288 Ga0070664_1000162886 130
68 3300005564 Ga0070664_100879279 Ga0070664_1008792791 130
69 3300005615 Ga0070702_100270351 Ga0070702_1002703512 130
70 3300005615 Ga0070702_101255892 Ga0070702_1012558922 130
71 3300005616 Ga0068852_100816780 Ga0068852_1008167802 130
72 3300005617 Ga0068859_100653707 Ga0068859_1006537072 130
73 3300005618 Ga0068864_100061049 Ga0068864_1000610491 130
74 3300005618 Ga0068864_100502335 Ga0068864_1005023353 130
75 3300005618 Ga0068864_100514578 Ga0068864_1005145782 130
76 3300005618 Ga0068864_100757249 Ga0068864_1007572492 130
77 3300005719 Ga0068861_101048511 Ga0068861_1010485112 130
78 3300005834 Ga0068851_10285419 Ga0068851_102854192 130
79 3300005841 Ga0068863_101432643 Ga0068863_1014326431 130
80 3300005843 Ga0068860_100237335 Ga0068860_1002373352 130
81 3300005844 Ga0068862_100103576 Ga0068862_1001035762 130
82 3300005844 Ga0068862_101835183 Ga0068862_1018351832 130
83 3300006038 Ga0075365_10080138 Ga0075365_100801384 130
84 3300006051 Ga0075364_10007403 Ga0075364_100074034 130
85 3300006175 Ga0070712_100132640 Ga0070712_1001326404 130
86 3300006177 Ga0075362_10057671 Ga0075362_100576712 130
87 3300006195 Ga0075366_10035253 Ga0075366_100352535 130
88 3300006237 Ga0097621_101999511 Ga0097621_1019995111 130
89 3300006353 Ga0075370_10561929 Ga0075370_105619292 130
90 3300006358 Ga0068871_100289833 Ga0068871_1002898332 130
91 3300006358 Ga0068871_101464257 Ga0068871_1014642572 130
92 3300006844 Ga0075428_100071672 Ga0075428_1000716721 130
93 3300006844 Ga0075428_100678712 Ga0075428_1006787121 130
94 3300006844 Ga0075428_102588190 Ga0075428_1025881901 130
95 3300006846 Ga0075430_100066793 Ga0075430_1000667932 130
96 3300006847 Ga0075431_100104702 Ga0075431_1001047022 130
97 3300006847 Ga0075431_100169839 Ga0075431_1001698392 130
98 3300006871 Ga0075434_100313780 Ga0075434_1003137802 130
99 3300006880 Ga0075429_100026250 Ga0075429_1000262502 130
100 3300006914 Ga0075436_100510635 Ga0075436_1005106352 130
101 3300006931 Ga0097620_100445571 Ga0097620_1004455712 130
102 3300006931 Ga0097620_100653699 Ga0097620_1006536992 130
103 3300007788 Ga0099795_10057916 Ga0099795_100579162 130
104 3300009093 Ga0105240_10030143 Ga0105240_100301436 130
105 3300009094 Ga0111539_10022629 Ga0111539_100226292 130
106 3300009094 Ga0111539_10030287 Ga0111539_100302874 130
107 3300009094 Ga0111539_10112160 Ga0111539_101121602 130
108 3300009094 Ga0111539_10136941 Ga0111539_101369414 130
109 3300009094 Ga0111539_10166694 Ga0111539_101666942 130
110 3300009147 Ga0114129_10036518 Ga0114129_100365184 130
111 3300009147 Ga0114129_10080124 Ga0114129_100801242 130
112 3300009147 Ga0114129_10314095 Ga0114129_103140952 130
113 3300009147 Ga0114129_10532550 Ga0114129_105325502 130
114 3300009147 Ga0114129_11024078 Ga0114129_110240782 130
115 3300009148 Ga0105243_11960326 Ga0105243_119603262 130
116 3300009177 Ga0105248_10052387 Ga0105248_100523872 130
117 3300009177 Ga0105248_10079036 Ga0105248_100790364 130
118 3300009177 Ga0105248_10143500 Ga0105248_101435002 130
119 3300009551 Ga0105238_11199446 Ga0105238_111994462 130
120 3300009553 Ga0105249_10269216 Ga0105249_102692162 130
121 3300009553 Ga0105249_10417024 Ga0105249_104170241 130
122 3300013104 Ga0157370_10023921 Ga0157370_100239214 130
123 3300013296 Ga0157374_10821860 Ga0157374_108218602 130
124 3300013297 Ga0157378_12760549 Ga0157378_127605491 130
125 3300013306 Ga0163162_10020855 Ga0163162_100208552 130
126 3300013306 Ga0163162_11999816 Ga0163162_119998161 130
127 3300014325 Ga0163163_10000017 Ga0163163_1000001784 130
128 3300014325 Ga0163163_10095451 Ga0163163_100954512 130
129 3300014325 Ga0163163_10633603 Ga0163163_106336032 130
130 3300014326 Ga0157380_10364536 Ga0157380_103645362 130
131 3300014326 Ga0157380_12666646 Ga0157380_126666461 130
132 3300014745 Ga0157377_10173182 Ga0157377_101731823 130
133 3300014969 Ga0157376_10112768 Ga0157376_101127682 130
134 3300014969 Ga0157376_10312858 Ga0157376_103128583 130
135 3300014969 Ga0157376_11136740 Ga0157376_111367402 130
136 3300017792 Ga0163161_10062723 Ga0163161_100627231 130
137 3300017792 Ga0163161_10885905 Ga0163161_108859052 130
138 3300025901 Ga0207688_10043908 Ga0207688_100439085 130
139 3300025910 Ga0207684_10380670 Ga0207684_103806702 130
140 3300025912 Ga0207707_10357100 Ga0207707_103571002 130
141 3300025912 Ga0207707_11617871 Ga0207707_116178712 130
142 3300025913 Ga0207695_10089158 Ga0207695_100891582 130
143 3300025922 Ga0207646_10183074 Ga0207646_101830742 130
144 3300025923 Ga0207681_10282056 Ga0207681_102820561 130
145 3300025925 Ga0207650_10696049 Ga0207650_106960492 130
146 3300025931 Ga0207644_10157544 Ga0207644_101575442 130
147 3300025933 Ga0207706_10307980 Ga0207706_103079801 130
148 3300025933 Ga0207706_10528537 Ga0207706_105285372 130
149 3300025934 Ga0207686_11167772 Ga0207686_111677721 130
150 3300025936 Ga0207670_10520492 Ga0207670_105204921 130
151 3300025937 Ga0207669_10241559 Ga0207669_102415591 130
152 3300025937 Ga0207669_10588847 Ga0207669_105888472 130
153 3300025941 Ga0207711_10047397 Ga0207711_100473972 130
154 3300025941 Ga0207711_10095310 Ga0207711_100953104 130
155 3300025941 Ga0207711_10172902 Ga0207711_101729022 130
156 3300025945 Ga0207679_10017972 Ga0207679_100179723 130
157 3300025945 Ga0207679_10344659 Ga0207679_103446592 130
158 3300025972 Ga0207668_10114493 Ga0207668_101144934 130
159 3300025981 Ga0207640_10272685 Ga0207640_102726852 130
160 3300025986 Ga0207658_10086806 Ga0207658_100868062 130
161 3300025986 Ga0207658_10535928 Ga0207658_105359282 130
162 3300026067 Ga0207678_10014217 Ga0207678_100142172 130
163 3300026067 Ga0207678_11020494 Ga0207678_110204941 130
164 3300026088 Ga0207641_10165008 Ga0207641_101650084 130
165 3300026088 Ga0207641_12209563 Ga0207641_122095631 130
166 3300026095 Ga0207676_10159574 Ga0207676_101595742 130
167 3300026095 Ga0207676_10252913 Ga0207676_102529132 130
168 3300026118 Ga0207675_100667266 Ga0207675_1006672662 130
169 3300026118 Ga0207675_100960693 Ga0207675_1009606931 130
170 3300026118 Ga0207675_101201453 Ga0207675_1012014532 130
171 3300026121 Ga0207683_10024543 Ga0207683_100245432 130
172 3300027907 Ga0207428_10083233 Ga0207428_100832333 130
173 3300027907 Ga0207428_10261090 Ga0207428_102610902 130
174 3300028381 Ga0268264_10240398 Ga0268264_102403981 130
175 3300028573 Ga0265334_10003452 Ga0265334_100034527 130
176 3300028800 Ga0265338_10106331 Ga0265338_101063314 130
177 3300028800 Ga0265338_10143833 Ga0265338_101438332 130
178 3300031240 Ga0265320_10197798 Ga0265320_101977981 130
179 3300031548 Ga0307408_100818586 Ga0307408_1008185862 130
180 3300031731 Ga0307405_10303963 Ga0307405_103039632 130
181 3300031824 Ga0307413_11056930 Ga0307413_110569301 130
182 3300031852 Ga0307410_10391981 Ga0307410_103919812 130
183 3300031901 Ga0307406_10040084 Ga0307406_100400843 130
184 3300031901 Ga0307406_11256902 Ga0307406_112569021 130
185 3300031903 Ga0307407_10788155 Ga0307407_107881552 130
186 3300031911 Ga0307412_10030546 Ga0307412_100305465 130
187 3300031911 Ga0307412_10494550 Ga0307412_104945501 130
188 3300031911 Ga0307412_11986905 Ga0307412_119869051 130
189 3300032002 Ga0307416_100003959 Ga0307416_1000039598 130
190 3300032002 Ga0307416_100190400 Ga0307416_1001904001 130
191 3300032002 Ga0307416_103107788 Ga0307416_1031077881 130
192 3300032002 Ga0307416_103257327 Ga0307416_1032573271 130
193 3300032004 Ga0307414_10451099 Ga0307414_104510991 130
194 3300032005 Ga0307411_10455384 Ga0307411_104553842 130
195 3300035114 Ga0373939_0364896 Ga0373939_0364896_135_527 130
196 3300035172 Ga0373955_0183051 Ga0373955_0183051_76_468 130
197 3300041408 Ga0439453_0115404 Ga0439453_0115404_145_537 130
198 3300042008 Ga0439450_005554 Ga0439450_005554_1704_2096 130
199 3300042118 Ga0450914_013318 Ga0450914_013318_45_437 130
200 3300042122 Ga0450920_005703 Ga0450920_005703_1577_1969 130
201 3300042125 Ga0450923_036329 Ga0450923_036329_464_856 130
202 3300042147 Ga0450910_009736 Ga0450910_009736_582_974 130
203 3300042184 Ga0450908_000419 Ga0450908_000419_6575_6967 130
204 3300042436 Ga0439435_0014321 Ga0439435_0014321_22_414 130
205 3300042436 Ga0439435_0021820 Ga0439435_0021820_719_1111 130
206 3300042436 Ga0439435_0137107 Ga0439435_0137107_366_758 130
207 3300042439 Ga0439464_0003381 Ga0439464_0003381_3229_3621 130
208 3300042531 Ga0450918_004470 Ga0450918_004470_248_640 130
209 3300042876 Ga0451577_0101814 Ga0451577_0101814_1909_2307 130
210 3300042876 Ga0451577_0137188 Ga0451577_0137188_1638_2036 130
211 3300042876 Ga0451577_0155979 Ga0451577_0155979_1143_1535 130
212 3300044673 Ga0453683_1205641 Ga0453683_1205641_101_493 130
213 3300044712 Ga0453684_0187818 Ga0453684_0187818_1572_1970 130
214 3300044712 Ga0453684_0662656 Ga0453684_0662656_21_419 130
215 3300045051 Ga0451576_0298981 Ga0451576_0298981_440_832 130
216 3300045051 Ga0451576_0361688 Ga0451576_0361688_722_1120 130
217 3300045051 Ga0451576_0551885 Ga0451576_0551885_387_779 130
218 3300046454 Ga0495592_0139605 Ga0495592_0139605_1091_1483 130
219 3300046491 Ga0495584_0031761 Ga0495584_0031761_1591_1983 130
220 3300046525 Ga0495663_0020344 Ga0495663_0020344_954_1346 130
221 3300046528 Ga0495642_0048276 Ga0495642_0048276_412_804 130
222 3300046538 Ga0495609_0157872 Ga0495609_0157872_344_736 130
223 3300046539 Ga0495621_0072573 Ga0495621_0072573_183_575 130
224 3300046664 Ga0495659_0050668 Ga0495659_0050668_166_558 130
225 3300046809 Ga0495600_0101431 Ga0495600_0101431_1174_1566 130
226 3300047315 Ga0495581_0699573 Ga0495581_0699573_22_414 130
227 3300047318 Ga0495636_0179832 Ga0495636_0179832_307_699 130
228 3300047321 Ga0495676_0335543 Ga0495676_0335543_90_482 130
229 3300047445 Ga0495677_0023989 Ga0495677_0023989_121_513 130
230 3300047447 Ga0495685_030570 Ga0495685_030570_604_996 130
231 3300048907 Ga0496104_1436193 Ga0496104_1436193_175_567 130
232 3300048911 Ga0496108_0252829 Ga0496108_0252829_159_551 130
233 3300048912 Ga0496109_1107900 Ga0496109_1107900_58_450 130
234 3300048914 Ga0496111_0165908 Ga0496111_0165908_1081_1473 130
235 3300048915 Ga0496112_1111444 Ga0496112_1111444_17_409 130
236 3300048916 Ga0496113_0590386 Ga0496113_0590386_145_537 130
237 3300048917 Ga0496114_0658214 Ga0496114_0658214_457_849 130
238 3300049571 Ga0501034_0000245 Ga0501034_0000245_70151_70543 130
239 3300049571 Ga0501034_0731082 Ga0501034_0731082_436_828 130
240 3300049576 Ga0501040_0156059 Ga0501040_0156059_238_630 130
241 3300049587 Ga0501071_0434340 Ga0501071_0434340_449_841 130
242 3300049590 Ga0501074_0717549 Ga0501074_0717549_105_497 130
243 3300049591 Ga0501075_0278496 Ga0501075_0278496_396_788 130
244 3300049593 Ga0501077_0268330 Ga0501077_0268330_270_662 130
245 3300050492 nmdc:mga0yw44_65326_c1 nmdc:mga0yw44_65326_c1_1210_1602 130
246 3300050493 nmdc:mga0k408_11017_c1 nmdc:mga0k408_11017_c1_2741_3133 130
247 3300050493 nmdc:mga0k408_11708_c2 nmdc:mga0k408_11708_c2_1081_1473 130
248 3300050507 nmdc:mga05p37_16793_c1 nmdc:mga05p37_16793_c1_4075_4467 130
249 3300050507 nmdc:mga05p37_30197_c1 nmdc:mga05p37_30197_c1_3108_3503 130
250 3300050508 nmdc:mga09592_10871_c1 nmdc:mga09592_10871_c1_891_1283 130
251 3300050508 nmdc:mga09592_177954_c1 nmdc:mga09592_177954_c1_326_718 130
252 3300050509 nmdc:mga0qj67_1924_c1 nmdc:mga0qj67_1924_c1_1121_1513 130
253 3300050509 nmdc:mga0qj67_49858_c1 nmdc:mga0qj67_49858_c1_706_1098 130
254 3300050510 nmdc:mga06r32_32495_c1 nmdc:mga06r32_32495_c1_2042_2434 130
255 3300050510 nmdc:mga06r32_40398_c1 nmdc:mga06r32_40398_c1_3518_3991 130
256 3300050510 nmdc:mga06r32_47698_c1 nmdc:mga06r32_47698_c1_2034_2426 130
257 3300050511 nmdc:mga08y16_120598_c1 nmdc:mga08y16_120598_c1_282_674 130
258 3300050511 nmdc:mga08y16_320494_c1 nmdc:mga08y16_320494_c1_1151_1543 130
259 3300050511 nmdc:mga08y16_4826_c1 nmdc:mga08y16_4826_c1_12885_13277 130
260 3300050511 nmdc:mga08y16_66876_c1 nmdc:mga08y16_66876_c1_687_1079 130
261 3300050511 nmdc:mga08y16_906129_c1 nmdc:mga08y16_906129_c1_78_470 130
262 3300050513 nmdc:mga0rr50_77256_c1 nmdc:mga0rr50_77256_c1_1345_1746 130
263 3300050515 nmdc:mga0a205_633293_c1 nmdc:mga0a205_633293_c1_472_864 130
264 3300050515 nmdc:mga0a205_75903_c1 nmdc:mga0a205_75903_c1_1966_2358 130
265 3300050516 nmdc:mga0sz30_59490_c1 nmdc:mga0sz30_59490_c1_43_435 130
266 3300053085 Ga0495619_0173733 Ga0495619_0173733_1044_1436 130
267 3300054114 Ga0501084_0416342 Ga0501084_0416342_428_820 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

1

130

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v68-assembly2.cif.gz_D crystal structure of cell division protein ftsz from mycobacterium tuberculosis bounded via the t9 loop 0.7238 63 108
1w59-assembly2.cif.gz_B ftsz dimer, empty (m. jannaschii) 0.7071 63 108
2q1x-assembly1.cif.gz_B crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with citrate. 0.6802 63 108
6ym9-assembly1.cif.gz_B mycobacterium tuberculosis ftsz in complex with gtp-gamma-s 0.6771 63 108
1rlu-assembly1.cif.gz_B mycobacterium tuberculosis ftsz in complex with gtp-gamma-s 0.6751 63 108
ID Description Score Start End Superfamily
af_P91443_1670_1773_1.25.40.530 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain 0.8309 25 56 1.25.40.530
af_P0ABA4_107_177_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8206 63 128 3.30.2320.30
af_Q9V3Z6_1681_1852_1.25.40.530 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain 0.8178 23 56 1.25.40.530
af_D3ZL50_1_115_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7667 25 55 1.25.40.10
af_Q2FWE7_104_179_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.7653 62 129 3.30.2320.30
ID Description Score Start End GO Terms
AF-A0A381WYX0-F1-model_v4 Uncharacterized protein 0.8984 1 104 GO:0016020
GO:0046933
AF-A0A381WYX0-F1-model_v4 Uncharacterized protein 0.8904 1 104 GO:0016020
GO:0046933
AF-A0A3D3XNS8-F1-model_v4 H(+)-transporting ATPase 0.889 6 129 GO:0016020
GO:0046933
AF-A0A1V6DI24-F1-model_v4 deleted 0.8876 6 130
AF-A0A7V7VN67-F1-model_v4 F0F1 ATP synthase subunit delta 0.8857 1 128 GO:0016020
GO:0046933

Feature Viewer

pLDDT pTM Quality
90.38 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map