F374674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 181 | 267 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_101999511|Ga0097621_1019995111 |
| Length | 142 |
| Sequence | MMTAKQAKREAKQLFRLCLVGRKLDEQRTRMVVERILQSKPRGYLSLLGFFLKLVKFDYFQRTAEIECAVPVSPALQARVQAGIENLYGQGITSLFVLNPALIGGMRIKVGSDVYDGSIRSRLATLAKSFGIASTNGQYASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 116 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 117 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 118 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 119 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 120 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 121 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 122 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 123 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 124 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 125 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 126 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 127 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 170 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.37 |
| Nodule | 0 |
| Rhizoplane | 2.62 |
| Rhizosphere | 94.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10187271 | 3300005290 | Bacteria | 1164 |
| 2 | Ga0065707_10304389 | 3300005295 | Unclassified | 997 |
| 3 | Ga0065707_10506502 | 3300005295 | Bacteria | 753 |
| 4 | Ga0070690_100707433 | 3300005330 | Unclassified | 774 |
| 5 | Ga0070670_100056361 | 3300005331 | Bacteria | 3373 |
| 6 | Ga0070670_100288391 | 3300005331 | Bacteria | 1434 |
| 7 | Ga0070670_100765963 | 3300005331 | Bacteria | 870 |
| 8 | Ga0070680_100659813 | 3300005336 | Unclassified | 899 |
| 9 | Ga0068868_100286762 | 3300005338 | Bacteria | 1395 |
| 10 | Ga0070689_100365173 | 3300005340 | Unclassified | 1214 |
| 11 | Ga0070691_10195543 | 3300005341 | Bacteria | 1060 |
| 12 | Ga0070687_100400079 | 3300005343 | Unclassified | 900 |
| 13 | Ga0070668_100077938 | 3300005347 | Bacteria | 2591 |
| 14 | Ga0070669_100340216 | 3300005353 | Bacteria | 1216 |
| 15 | Ga0070675_100446262 | 3300005354 | Bacteria | 1160 |
| 16 | Ga0070675_102033776 | 3300005354 | Unclassified | 530 |
| 17 | Ga0070671_100032287 | 3300005355 | Bacteria | 4329 |
| 18 | Ga0070674_100931110 | 3300005356 | Bacteria | 759 |
| 19 | Ga0070674_102199242 | 3300005356 | Bacteria | 504 |
| 20 | Ga0070673_100097707 | 3300005364 | Bacteria | 2412 |
| 21 | Ga0070659_101263612 | 3300005366 | Unclassified | 654 |
| 22 | Ga0070667_100234351 | 3300005367 | Bacteria | 1637 |
| 23 | Ga0070667_100606153 | 3300005367 | Bacteria | 1009 |
| 24 | Ga0070705_100451645 | 3300005440 | Unclassified | 964 |
| 25 | Ga0070694_100217352 | 3300005444 | Bacteria | 1432 |
| 26 | Ga0070708_100185202 | 3300005445 | Bacteria | 1947 |
| 27 | Ga0070663_100360969 | 3300005455 | Bacteria | 1178 |
| 28 | Ga0070678_100095364 | 3300005456 | Bacteria | 2292 |
| 29 | Ga0070662_100737269 | 3300005457 | Bacteria | 835 |
| 30 | Ga0070681_10055727 | 3300005458 | Bacteria | 3935 |
| 31 | Ga0070681_10709036 | 3300005458 | Unclassified | 922 |
| 32 | Ga0070707_100255322 | 3300005468 | Bacteria | 1706 |
| 33 | Ga0070698_100254047 | 3300005471 | Bacteria | 1690 |
| 34 | Ga0070684_101169357 | 3300005535 | Bacteria | 723 |
| 35 | Ga0070697_100347731 | 3300005536 | Bacteria | 1280 |
| 36 | Ga0070672_101406088 | 3300005543 | Bacteria | 624 |
| 37 | Ga0070672_101674032 | 3300005543 | Bacteria | 571 |
| 38 | Ga0070686_100509521 | 3300005544 | Unclassified | 935 |
| 39 | Ga0070695_100037663 | 3300005545 | Bacteria | 3050 |
| 40 | Ga0070664_100016288 | 3300005564 | Bacteria | 6094 |
| 41 | Ga0070664_100879279 | 3300005564 | Bacteria | 840 |
| 42 | Ga0070702_100270351 | 3300005615 | Bacteria | 1162 |
| 43 | Ga0070702_101255892 | 3300005615 | Unclassified | 599 |
| 44 | Ga0068852_100816780 | 3300005616 | Bacteria | 947 |
| 45 | Ga0068859_100653707 | 3300005617 | Bacteria | 1143 |
| 46 | Ga0068864_100061049 | 3300005618 | Bacteria | 3265 |
| 47 | Ga0068864_100502335 | 3300005618 | Bacteria | 1167 |
| 48 | Ga0068864_100514578 | 3300005618 | Bacteria | 1153 |
| 49 | Ga0068864_100757249 | 3300005618 | Bacteria | 952 |
| 50 | Ga0068861_101048511 | 3300005719 | Unclassified | 781 |
| 51 | Ga0068851_10285419 | 3300005834 | Bacteria | 945 |
| 52 | Ga0068863_101432643 | 3300005841 | Bacteria | 699 |
| 53 | Ga0068860_100237335 | 3300005843 | Bacteria | 1773 |
| 54 | Ga0068862_100103576 | 3300005844 | Bacteria | 2492 |
| 55 | Ga0068862_101835183 | 3300005844 | Unclassified | 616 |
| 56 | Ga0075365_10080138 | 3300006038 | Bacteria | 2210 |
| 57 | Ga0075364_10007403 | 3300006051 | Bacteria | 6516 |
| 58 | Ga0070712_100132640 | 3300006175 | Unclassified | 1890 |
| 59 | Ga0075362_10057671 | 3300006177 | Bacteria | 1750 |
| 60 | Ga0075366_10035253 | 3300006195 | Bacteria | 2949 |
| 61 | Ga0097621_101999511 | 3300006237 | Unclassified | 554 |
| 62 | Ga0075370_10561929 | 3300006353 | Bacteria | 690 |
| 63 | Ga0068871_100289833 | 3300006358 | Bacteria | 1434 |
| 64 | Ga0068871_101464257 | 3300006358 | Unclassified | 645 |
| 65 | Ga0075428_100071672 | 3300006844 | Bacteria | 3787 |
| 66 | Ga0075428_100678712 | 3300006844 | Bacteria | 1098 |
| 67 | Ga0075428_102588190 | 3300006844 | Unclassified | 518 |
| 68 | Ga0075430_100066793 | 3300006846 | Bacteria | 3020 |
| 69 | Ga0075431_100104702 | 3300006847 | Bacteria | 2920 |
| 70 | Ga0075431_100169839 | 3300006847 | Bacteria | 2241 |
| 71 | Ga0075434_100313780 | 3300006871 | Bacteria | 1588 |
| 72 | Ga0075434_100963784 | 3300006871 | Bacteria | 867 |
| 73 | Ga0075429_100026250 | 3300006880 | Bacteria | 5056 |
| 74 | Ga0075436_100510635 | 3300006914 | Unclassified | 880 |
| 75 | Ga0097620_100445571 | 3300006931 | Bacteria | 1391 |
| 76 | Ga0097620_100653699 | 3300006931 | Bacteria | 1143 |
| 77 | Ga0099795_10057916 | 3300007788 | Bacteria | 1430 |
| 78 | Ga0105240_10030143 | 3300009093 | Bacteria | 7056 |
| 79 | Ga0111539_10022629 | 3300009094 | Bacteria | 7721 |
| 80 | Ga0111539_10030287 | 3300009094 | Bacteria | 6579 |
| 81 | Ga0111539_10112160 | 3300009094 | Bacteria | 3199 |
| 82 | Ga0111539_10136941 | 3300009094 | Bacteria | 2867 |
| 83 | Ga0111539_10166694 | 3300009094 | Bacteria | 2575 |
| 84 | Ga0114129_10036518 | 3300009147 | Bacteria | 6937 |
| 85 | Ga0114129_10080124 | 3300009147 | Bacteria | 4539 |
| 86 | Ga0114129_10314095 | 3300009147 | Bacteria | 2085 |
| 87 | Ga0114129_10532550 | 3300009147 | Unclassified | 1530 |
| 88 | Ga0114129_11024078 | 3300009147 | Bacteria | 1038 |
| 89 | Ga0105243_11960326 | 3300009148 | Unclassified | 619 |
| 90 | Ga0105248_10052387 | 3300009177 | Bacteria | 4579 |
| 91 | Ga0105248_10079036 | 3300009177 | Bacteria | 3697 |
| 92 | Ga0105248_10143500 | 3300009177 | Bacteria | 2694 |
| 93 | Ga0105238_11199446 | 3300009551 | Bacteria | 783 |
| 94 | Ga0105249_10269216 | 3300009553 | Unclassified | 1696 |
| 95 | Ga0105249_10417024 | 3300009553 | Bacteria | 1376 |
| 96 | Ga0157370_10023921 | 3300013104 | Bacteria | 6058 |
| 97 | Ga0157374_10821860 | 3300013296 | Unclassified | 945 |
| 98 | Ga0157378_11238342 | 3300013297 | Unclassified | 786 |
| 99 | Ga0157378_12760549 | 3300013297 | Unclassified | 544 |
| 100 | Ga0163162_10020855 | 3300013306 | Bacteria | 6443 |
| 101 | Ga0163162_11999816 | 3300013306 | Unclassified | 664 |
| 102 | Ga0163163_10000017 | 3300014325 | Bacteria | 208781 |
| 103 | Ga0163163_10095451 | 3300014325 | Bacteria | 2993 |
| 104 | Ga0163163_10633603 | 3300014325 | Unclassified | 1132 |
| 105 | Ga0157380_10364536 | 3300014326 | Unclassified | 1357 |
| 106 | Ga0157380_12666646 | 3300014326 | Unclassified | 566 |
| 107 | Ga0157377_10173182 | 3300014745 | Unclassified | 1351 |
| 108 | Ga0157376_10112768 | 3300014969 | Bacteria | 2396 |
| 109 | Ga0157376_10312858 | 3300014969 | Bacteria | 1490 |
| 110 | Ga0157376_11136740 | 3300014969 | Bacteria | 808 |
| 111 | Ga0163161_10062723 | 3300017792 | Bacteria | 2708 |
| 112 | Ga0163161_10885905 | 3300017792 | Unclassified | 755 |
| 113 | Ga0207682_10137116 | 3300025893 | Bacteria | 1096 |
| 114 | Ga0207688_10043908 | 3300025901 | Bacteria | 2490 |
| 115 | Ga0207684_10380670 | 3300025910 | Bacteria | 1214 |
| 116 | Ga0207707_10357100 | 3300025912 | Bacteria | 1258 |
| 117 | Ga0207707_11617871 | 3300025912 | Bacteria | 510 |
| 118 | Ga0207695_10089158 | 3300025913 | Bacteria | 3102 |
| 119 | Ga0207646_10183074 | 3300025922 | Bacteria | 1892 |
| 120 | Ga0207681_10282056 | 3300025923 | Bacteria | 1308 |
| 121 | Ga0207650_10696049 | 3300025925 | Bacteria | 858 |
| 122 | Ga0207644_10157544 | 3300025931 | Bacteria | 1762 |
| 123 | Ga0207706_10307980 | 3300025933 | Bacteria | 1379 |
| 124 | Ga0207706_10528537 | 3300025933 | Unclassified | 1017 |
| 125 | Ga0207686_11167772 | 3300025934 | Bacteria | 629 |
| 126 | Ga0207670_10520492 | 3300025936 | Unclassified | 968 |
| 127 | Ga0207669_10241559 | 3300025937 | Bacteria | 1339 |
| 128 | Ga0207669_10588847 | 3300025937 | Bacteria | 902 |
| 129 | Ga0207691_10691895 | 3300025940 | Unclassified | 860 |
| 130 | Ga0207711_10047397 | 3300025941 | Bacteria | 3674 |
| 131 | Ga0207711_10095310 | 3300025941 | Bacteria | 2624 |
| 132 | Ga0207711_10172902 | 3300025941 | Bacteria | 1961 |
| 133 | Ga0207679_10017972 | 3300025945 | Bacteria | 4726 |
| 134 | Ga0207679_10344659 | 3300025945 | Bacteria | 1297 |
| 135 | Ga0207668_10114493 | 3300025972 | Bacteria | 2030 |
| 136 | Ga0207640_10272685 | 3300025981 | Bacteria | 1324 |
| 137 | Ga0207658_10086806 | 3300025986 | Bacteria | 2414 |
| 138 | Ga0207658_10535928 | 3300025986 | Unclassified | 1046 |
| 139 | Ga0207678_10014217 | 3300026067 | Bacteria | 6997 |
| 140 | Ga0207678_11020494 | 3300026067 | Unclassified | 732 |
| 141 | Ga0207641_10165008 | 3300026088 | Bacteria | 2016 |
| 142 | Ga0207641_12209563 | 3300026088 | Bacteria | 550 |
| 143 | Ga0207676_10159574 | 3300026095 | Bacteria | 1952 |
| 144 | Ga0207676_10252913 | 3300026095 | Bacteria | 1587 |
| 145 | Ga0207675_100667266 | 3300026118 | Bacteria | 1047 |
| 146 | Ga0207675_100960693 | 3300026118 | Unclassified | 872 |
| 147 | Ga0207675_101201453 | 3300026118 | Bacteria | 778 |
| 148 | Ga0207683_10024543 | 3300026121 | Bacteria | 5194 |
| 149 | Ga0207428_10083233 | 3300027907 | Bacteria | 2496 |
| 150 | Ga0207428_10261090 | 3300027907 | Unclassified | 1290 |
| 151 | Ga0268264_10240398 | 3300028381 | Bacteria | 1677 |
| 152 | Ga0265334_10003452 | 3300028573 | Bacteria | 7188 |
| 153 | Ga0265338_10106331 | 3300028800 | Bacteria | 2272 |
| 154 | Ga0265338_10143833 | 3300028800 | Bacteria | 1864 |
| 155 | Ga0265320_10197798 | 3300031240 | Unclassified | 898 |
| 156 | Ga0307408_100818586 | 3300031548 | Unclassified | 846 |
| 157 | Ga0307405_10303963 | 3300031731 | Bacteria | 1211 |
| 158 | Ga0307413_11056930 | 3300031824 | Unclassified | 699 |
| 159 | Ga0307410_10391981 | 3300031852 | Unclassified | 1120 |
| 160 | Ga0307406_10040084 | 3300031901 | Bacteria | 2910 |
| 161 | Ga0307406_11256902 | 3300031901 | Bacteria | 645 |
| 162 | Ga0307407_10788155 | 3300031903 | Unclassified | 722 |
| 163 | Ga0307412_10030546 | 3300031911 | Bacteria | 3394 |
| 164 | Ga0307412_10494550 | 3300031911 | Bacteria | 1017 |
| 165 | Ga0307412_11986905 | 3300031911 | Bacteria | 538 |
| 166 | Ga0307416_100003959 | 3300032002 | Bacteria | 8823 |
| 167 | Ga0307416_100190400 | 3300032002 | Bacteria | 1934 |
| 168 | Ga0307416_103107788 | 3300032002 | Bacteria | 555 |
| 169 | Ga0307416_103257327 | 3300032002 | Unclassified | 543 |
| 170 | Ga0307414_10451099 | 3300032004 | Bacteria | 1128 |
| 171 | Ga0307411_10455384 | 3300032005 | Bacteria | 1071 |
| 172 | Ga0373939_0364896 | 3300035114 | Bacteria | 591 |
| 173 | Ga0373955_0183051 | 3300035172 | Unclassified | 1244 |
| 174 | Ga0439453_0115404 | 3300041408 | Unclassified | 611 |
| 175 | Ga0439450_005554 | 3300042008 | Bacteria | 2225 |
| 176 | Ga0450914_013318 | 3300042118 | Bacteria | 836 |
| 177 | Ga0450920_005703 | 3300042122 | Bacteria | 2220 |
| 178 | Ga0450923_036329 | 3300042125 | Bacteria | 1022 |
| 179 | Ga0450910_009736 | 3300042147 | Bacteria | 1361 |
| 180 | Ga0450908_000419 | 3300042184 | Bacteria | 8188 |
| 181 | Ga0439434_0303583 | 3300042435 | Unclassified | 552 |
| 182 | Ga0439435_0014321 | 3300042436 | Bacteria | 1958 |
| 183 | Ga0439435_0021820 | 3300042436 | Bacteria | 1666 |
| 184 | Ga0439435_0137107 | 3300042436 | Unclassified | 777 |
| 185 | Ga0439464_0003381 | 3300042439 | Bacteria | 4022 |
| 186 | Ga0450918_004470 | 3300042531 | Bacteria | 2544 |
| 187 | Ga0451577_0101814 | 3300042876 | Bacteria | 2566 |
| 188 | Ga0451577_0137188 | 3300042876 | Bacteria | 2197 |
| 189 | Ga0451577_0155979 | 3300042876 | Bacteria | 2055 |
| 190 | Ga0453683_1205641 | 3300044673 | Unclassified | 507 |
| 191 | Ga0453684_0187818 | 3300044712 | Bacteria | 2420 |
| 192 | Ga0453684_0662656 | 3300044712 | Bacteria | 1138 |
| 193 | Ga0451576_0298981 | 3300045051 | Bacteria | 1683 |
| 194 | Ga0451576_0361688 | 3300045051 | Bacteria | 1520 |
| 195 | Ga0451576_0551885 | 3300045051 | Bacteria | 1210 |
| 196 | Ga0495592_0139605 | 3300046454 | Bacteria | 1687 |
| 197 | Ga0495584_0031761 | 3300046491 | Bacteria | 2672 |
| 198 | Ga0495663_0020344 | 3300046525 | Bacteria | 1904 |
| 199 | Ga0495642_0048276 | 3300046528 | Bacteria | 1745 |
| 200 | Ga0495609_0157872 | 3300046538 | Bacteria | 963 |
| 201 | Ga0495621_0072573 | 3300046539 | Bacteria | 1271 |
| 202 | Ga0495659_0050668 | 3300046664 | Unclassified | 1510 |
| 203 | Ga0495600_0101431 | 3300046809 | Bacteria | 1876 |
| 204 | Ga0495581_0699573 | 3300047315 | Bacteria | 584 |
| 205 | Ga0495636_0179832 | 3300047318 | Unclassified | 959 |
| 206 | Ga0495676_0335543 | 3300047321 | Bacteria | 1013 |
| 207 | Ga0495677_0023989 | 3300047445 | Bacteria | 2213 |
| 208 | Ga0495685_030570 | 3300047447 | Bacteria | 1852 |
| 209 | Ga0496104_1436193 | 3300048907 | Unclassified | 593 |
| 210 | Ga0496108_0252829 | 3300048911 | Bacteria | 1533 |
| 211 | Ga0496109_1107900 | 3300048912 | Bacteria | 729 |
| 212 | Ga0496111_0165908 | 3300048914 | Bacteria | 1640 |
| 213 | Ga0496112_1111444 | 3300048915 | Bacteria | 708 |
| 214 | Ga0496113_0590386 | 3300048916 | Bacteria | 890 |
| 215 | Ga0496114_0658214 | 3300048917 | Bacteria | 921 |
| 216 | Ga0501031_0387514 | 3300049568 | Bacteria | 904 |
| 217 | Ga0501033_0150946 | 3300049570 | Bacteria | 1676 |
| 218 | Ga0501034_0000245 | 3300049571 | Bacteria | 100221 |
| 219 | Ga0501034_0731082 | 3300049571 | Bacteria | 886 |
| 220 | Ga0501036_0098896 | 3300049572 | Bacteria | 2467 |
| 221 | Ga0501038_0566511 | 3300049574 | Bacteria | 862 |
| 222 | Ga0501040_0041509 | 3300049576 | Bacteria | 3134 |
| 223 | Ga0501040_0156059 | 3300049576 | Bacteria | 1612 |
| 224 | Ga0501041_0206976 | 3300049577 | Bacteria | 1230 |
| 225 | Ga0501043_0943230 | 3300049579 | Bacteria | 617 |
| 226 | Ga0501070_0248074 | 3300049586 | Bacteria | 1457 |
| 227 | Ga0501071_0003362 | 3300049587 | Bacteria | 10001 |
| 228 | Ga0501071_0434340 | 3300049587 | Bacteria | 1004 |
| 229 | Ga0501072_0012934 | 3300049588 | Bacteria | 6385 |
| 230 | Ga0501073_0405198 | 3300049589 | Bacteria | 942 |
| 231 | Ga0501074_0717549 | 3300049590 | Bacteria | 705 |
| 232 | Ga0501075_0278496 | 3300049591 | Bacteria | 1275 |
| 233 | Ga0501075_1555390 | 3300049591 | Bacteria | 500 |
| 234 | Ga0501076_0244675 | 3300049592 | Bacteria | 1467 |
| 235 | Ga0501077_0268330 | 3300049593 | Bacteria | 1085 |
| 236 | Ga0501077_0456011 | 3300049593 | Bacteria | 819 |
| 237 | Ga0501077_0905325 | 3300049593 | Bacteria | 567 |
| 238 | Ga0501079_0046370 | 3300049741 | Bacteria | 3354 |
| 239 | Ga0501079_0135954 | 3300049741 | Bacteria | 1914 |
| 240 | Ga0501080_0088163 | 3300049742 | Bacteria | 2883 |
| 241 | Ga0501080_0218790 | 3300049742 | Bacteria | 1743 |
| 242 | Ga0501045_0250480 | 3300049824 | Bacteria | 1318 |
| 243 | nmdc:mga0yw44_65326_c1 | 3300050492 | Bacteria | 2242 |
| 244 | nmdc:mga0k408_11017_c1 | 3300050493 | Bacteria | 4909 |
| 245 | nmdc:mga0k408_11708_c2 | 3300050493 | Bacteria | 3559 |
| 246 | nmdc:mga05p37_16793_c1 | 3300050507 | Bacteria | 8825 |
| 247 | nmdc:mga05p37_30197_c1 | 3300050507 | Bacteria | 6612 |
| 248 | nmdc:mga09592_10871_c1 | 3300050508 | Bacteria | 7407 |
| 249 | nmdc:mga09592_177954_c1 | 3300050508 | Bacteria | 1840 |
| 250 | nmdc:mga0qj67_1924_c1 | 3300050509 | Bacteria | 14743 |
| 251 | nmdc:mga0qj67_49858_c1 | 3300050509 | Bacteria | 3309 |
| 252 | nmdc:mga06r32_32495_c1 | 3300050510 | Bacteria | 4911 |
| 253 | nmdc:mga06r32_40398_c1 | 3300050510 | Bacteria | 4428 |
| 254 | nmdc:mga06r32_47698_c1 | 3300050510 | Bacteria | 4093 |
| 255 | nmdc:mga08y16_120598_c1 | 3300050511 | Bacteria | 2729 |
| 256 | nmdc:mga08y16_320494_c1 | 3300050511 | Bacteria | 1596 |
| 257 | nmdc:mga08y16_4826_c1 | 3300050511 | Bacteria | 14066 |
| 258 | nmdc:mga08y16_66876_c1 | 3300050511 | Bacteria | 3750 |
| 259 | nmdc:mga08y16_906129_c1 | 3300050511 | Unclassified | 867 |
| 260 | nmdc:mga0rr50_77256_c1 | 3300050513 | Bacteria | 2558 |
| 261 | nmdc:mga0a205_633293_c1 | 3300050515 | Bacteria | 921 |
| 262 | nmdc:mga0a205_75903_c1 | 3300050515 | Bacteria | 3247 |
| 263 | nmdc:mga0sz30_59490_c1 | 3300050516 | Bacteria | 1630 |
| 264 | Ga0495619_0173733 | 3300053085 | Bacteria | 1490 |
| 265 | Ga0501084_0076379 | 3300054114 | Bacteria | 2808 |
| 266 | Ga0501084_0416342 | 3300054114 | Unclassified | 1136 |
| 267 | Ga0501082_0217082 | 3300060353 | Bacteria | 1664 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0150946 | Ga0501033_0150946_1323_1646 | 107 |
| 2 | 3300025893 | Ga0207682_10137116 | Ga0207682_101371162 | 111 |
| 3 | 3300005336 | Ga0070680_100659813 | Ga0070680_1006598132 | 117 |
| 4 | 3300006871 | Ga0075434_100963784 | Ga0075434_1009637841 | 117 |
| 5 | 3300049586 | Ga0501070_0248074 | Ga0501070_0248074_405_797 | 119 |
| 6 | 3300049589 | Ga0501073_0405198 | Ga0501073_0405198_19_411 | 119 |
| 7 | 3300049593 | Ga0501077_0905325 | Ga0501077_0905325_19_411 | 119 |
| 8 | 3300049741 | Ga0501079_0046370 | Ga0501079_0046370_1966_2358 | 119 |
| 9 | 3300049742 | Ga0501080_0088163 | Ga0501080_0088163_2100_2492 | 119 |
| 10 | 3300049568 | Ga0501031_0387514 | Ga0501031_0387514_61_435 | 124 |
| 11 | 3300049572 | Ga0501036_0098896 | Ga0501036_0098896_1743_2117 | 124 |
| 12 | 3300049574 | Ga0501038_0566511 | Ga0501038_0566511_242_616 | 124 |
| 13 | 3300049576 | Ga0501040_0041509 | Ga0501040_0041509_2375_2749 | 124 |
| 14 | 3300049577 | Ga0501041_0206976 | Ga0501041_0206976_135_509 | 124 |
| 15 | 3300049579 | Ga0501043_0943230 | Ga0501043_0943230_91_465 | 124 |
| 16 | 3300049587 | Ga0501071_0003362 | Ga0501071_0003362_7250_7624 | 124 |
| 17 | 3300049588 | Ga0501072_0012934 | Ga0501072_0012934_3847_4221 | 124 |
| 18 | 3300049591 | Ga0501075_1555390 | Ga0501075_1555390_13_387 | 124 |
| 19 | 3300049592 | Ga0501076_0244675 | Ga0501076_0244675_453_827 | 124 |
| 20 | 3300049593 | Ga0501077_0456011 | Ga0501077_0456011_177_551 | 124 |
| 21 | 3300049741 | Ga0501079_0135954 | Ga0501079_0135954_960_1334 | 124 |
| 22 | 3300049742 | Ga0501080_0218790 | Ga0501080_0218790_193_567 | 124 |
| 23 | 3300049824 | Ga0501045_0250480 | Ga0501045_0250480_98_472 | 124 |
| 24 | 3300054114 | Ga0501084_0076379 | Ga0501084_0076379_843_1217 | 124 |
| 25 | 3300060353 | Ga0501082_0217082 | Ga0501082_0217082_841_1215 | 124 |
| 26 | 3300005354 | Ga0070675_100446262 | Ga0070675_1004462622 | 129 |
| 27 | 3300005543 | Ga0070672_101674032 | Ga0070672_1016740321 | 129 |
| 28 | 3300013297 | Ga0157378_11238342 | Ga0157378_112383422 | 129 |
| 29 | 3300025940 | Ga0207691_10691895 | Ga0207691_106918952 | 129 |
| 30 | 3300042435 | Ga0439434_0303583 | Ga0439434_0303583_114_503 | 129 |
| 31 | 3300005290 | Ga0065712_10187271 | Ga0065712_101872712 | 130 |
| 32 | 3300005295 | Ga0065707_10304389 | Ga0065707_103043892 | 130 |
| 33 | 3300005295 | Ga0065707_10506502 | Ga0065707_105065021 | 130 |
| 34 | 3300005330 | Ga0070690_100707433 | Ga0070690_1007074332 | 130 |
| 35 | 3300005331 | Ga0070670_100056361 | Ga0070670_1000563615 | 130 |
| 36 | 3300005331 | Ga0070670_100288391 | Ga0070670_1002883912 | 130 |
| 37 | 3300005331 | Ga0070670_100765963 | Ga0070670_1007659631 | 130 |
| 38 | 3300005338 | Ga0068868_100286762 | Ga0068868_1002867622 | 130 |
| 39 | 3300005340 | Ga0070689_100365173 | Ga0070689_1003651732 | 130 |
| 40 | 3300005341 | Ga0070691_10195543 | Ga0070691_101955432 | 130 |
| 41 | 3300005343 | Ga0070687_100400079 | Ga0070687_1004000792 | 130 |
| 42 | 3300005347 | Ga0070668_100077938 | Ga0070668_1000779385 | 130 |
| 43 | 3300005353 | Ga0070669_100340216 | Ga0070669_1003402162 | 130 |
| 44 | 3300005354 | Ga0070675_102033776 | Ga0070675_1020337761 | 130 |
| 45 | 3300005355 | Ga0070671_100032287 | Ga0070671_1000322874 | 130 |
| 46 | 3300005356 | Ga0070674_100931110 | Ga0070674_1009311102 | 130 |
| 47 | 3300005356 | Ga0070674_102199242 | Ga0070674_1021992421 | 130 |
| 48 | 3300005364 | Ga0070673_100097707 | Ga0070673_1000977074 | 130 |
| 49 | 3300005366 | Ga0070659_101263612 | Ga0070659_1012636122 | 130 |
| 50 | 3300005367 | Ga0070667_100234351 | Ga0070667_1002343512 | 130 |
| 51 | 3300005367 | Ga0070667_100606153 | Ga0070667_1006061531 | 130 |
| 52 | 3300005440 | Ga0070705_100451645 | Ga0070705_1004516452 | 130 |
| 53 | 3300005444 | Ga0070694_100217352 | Ga0070694_1002173522 | 130 |
| 54 | 3300005445 | Ga0070708_100185202 | Ga0070708_1001852024 | 130 |
| 55 | 3300005455 | Ga0070663_100360969 | Ga0070663_1003609692 | 130 |
| 56 | 3300005456 | Ga0070678_100095364 | Ga0070678_1000953641 | 130 |
| 57 | 3300005457 | Ga0070662_100737269 | Ga0070662_1007372692 | 130 |
| 58 | 3300005458 | Ga0070681_10055727 | Ga0070681_100557274 | 130 |
| 59 | 3300005458 | Ga0070681_10709036 | Ga0070681_107090362 | 130 |
| 60 | 3300005468 | Ga0070707_100255322 | Ga0070707_1002553222 | 130 |
| 61 | 3300005471 | Ga0070698_100254047 | Ga0070698_1002540474 | 130 |
| 62 | 3300005535 | Ga0070684_101169357 | Ga0070684_1011693571 | 130 |
| 63 | 3300005536 | Ga0070697_100347731 | Ga0070697_1003477312 | 130 |
| 64 | 3300005543 | Ga0070672_101406088 | Ga0070672_1014060881 | 130 |
| 65 | 3300005544 | Ga0070686_100509521 | Ga0070686_1005095212 | 130 |
| 66 | 3300005545 | Ga0070695_100037663 | Ga0070695_1000376634 | 130 |
| 67 | 3300005564 | Ga0070664_100016288 | Ga0070664_1000162886 | 130 |
| 68 | 3300005564 | Ga0070664_100879279 | Ga0070664_1008792791 | 130 |
| 69 | 3300005615 | Ga0070702_100270351 | Ga0070702_1002703512 | 130 |
| 70 | 3300005615 | Ga0070702_101255892 | Ga0070702_1012558922 | 130 |
| 71 | 3300005616 | Ga0068852_100816780 | Ga0068852_1008167802 | 130 |
| 72 | 3300005617 | Ga0068859_100653707 | Ga0068859_1006537072 | 130 |
| 73 | 3300005618 | Ga0068864_100061049 | Ga0068864_1000610491 | 130 |
| 74 | 3300005618 | Ga0068864_100502335 | Ga0068864_1005023353 | 130 |
| 75 | 3300005618 | Ga0068864_100514578 | Ga0068864_1005145782 | 130 |
| 76 | 3300005618 | Ga0068864_100757249 | Ga0068864_1007572492 | 130 |
| 77 | 3300005719 | Ga0068861_101048511 | Ga0068861_1010485112 | 130 |
| 78 | 3300005834 | Ga0068851_10285419 | Ga0068851_102854192 | 130 |
| 79 | 3300005841 | Ga0068863_101432643 | Ga0068863_1014326431 | 130 |
| 80 | 3300005843 | Ga0068860_100237335 | Ga0068860_1002373352 | 130 |
| 81 | 3300005844 | Ga0068862_100103576 | Ga0068862_1001035762 | 130 |
| 82 | 3300005844 | Ga0068862_101835183 | Ga0068862_1018351832 | 130 |
| 83 | 3300006038 | Ga0075365_10080138 | Ga0075365_100801384 | 130 |
| 84 | 3300006051 | Ga0075364_10007403 | Ga0075364_100074034 | 130 |
| 85 | 3300006175 | Ga0070712_100132640 | Ga0070712_1001326404 | 130 |
| 86 | 3300006177 | Ga0075362_10057671 | Ga0075362_100576712 | 130 |
| 87 | 3300006195 | Ga0075366_10035253 | Ga0075366_100352535 | 130 |
| 88 | 3300006237 | Ga0097621_101999511 | Ga0097621_1019995111 | 130 |
| 89 | 3300006353 | Ga0075370_10561929 | Ga0075370_105619292 | 130 |
| 90 | 3300006358 | Ga0068871_100289833 | Ga0068871_1002898332 | 130 |
| 91 | 3300006358 | Ga0068871_101464257 | Ga0068871_1014642572 | 130 |
| 92 | 3300006844 | Ga0075428_100071672 | Ga0075428_1000716721 | 130 |
| 93 | 3300006844 | Ga0075428_100678712 | Ga0075428_1006787121 | 130 |
| 94 | 3300006844 | Ga0075428_102588190 | Ga0075428_1025881901 | 130 |
| 95 | 3300006846 | Ga0075430_100066793 | Ga0075430_1000667932 | 130 |
| 96 | 3300006847 | Ga0075431_100104702 | Ga0075431_1001047022 | 130 |
| 97 | 3300006847 | Ga0075431_100169839 | Ga0075431_1001698392 | 130 |
| 98 | 3300006871 | Ga0075434_100313780 | Ga0075434_1003137802 | 130 |
| 99 | 3300006880 | Ga0075429_100026250 | Ga0075429_1000262502 | 130 |
| 100 | 3300006914 | Ga0075436_100510635 | Ga0075436_1005106352 | 130 |
| 101 | 3300006931 | Ga0097620_100445571 | Ga0097620_1004455712 | 130 |
| 102 | 3300006931 | Ga0097620_100653699 | Ga0097620_1006536992 | 130 |
| 103 | 3300007788 | Ga0099795_10057916 | Ga0099795_100579162 | 130 |
| 104 | 3300009093 | Ga0105240_10030143 | Ga0105240_100301436 | 130 |
| 105 | 3300009094 | Ga0111539_10022629 | Ga0111539_100226292 | 130 |
| 106 | 3300009094 | Ga0111539_10030287 | Ga0111539_100302874 | 130 |
| 107 | 3300009094 | Ga0111539_10112160 | Ga0111539_101121602 | 130 |
| 108 | 3300009094 | Ga0111539_10136941 | Ga0111539_101369414 | 130 |
| 109 | 3300009094 | Ga0111539_10166694 | Ga0111539_101666942 | 130 |
| 110 | 3300009147 | Ga0114129_10036518 | Ga0114129_100365184 | 130 |
| 111 | 3300009147 | Ga0114129_10080124 | Ga0114129_100801242 | 130 |
| 112 | 3300009147 | Ga0114129_10314095 | Ga0114129_103140952 | 130 |
| 113 | 3300009147 | Ga0114129_10532550 | Ga0114129_105325502 | 130 |
| 114 | 3300009147 | Ga0114129_11024078 | Ga0114129_110240782 | 130 |
| 115 | 3300009148 | Ga0105243_11960326 | Ga0105243_119603262 | 130 |
| 116 | 3300009177 | Ga0105248_10052387 | Ga0105248_100523872 | 130 |
| 117 | 3300009177 | Ga0105248_10079036 | Ga0105248_100790364 | 130 |
| 118 | 3300009177 | Ga0105248_10143500 | Ga0105248_101435002 | 130 |
| 119 | 3300009551 | Ga0105238_11199446 | Ga0105238_111994462 | 130 |
| 120 | 3300009553 | Ga0105249_10269216 | Ga0105249_102692162 | 130 |
| 121 | 3300009553 | Ga0105249_10417024 | Ga0105249_104170241 | 130 |
| 122 | 3300013104 | Ga0157370_10023921 | Ga0157370_100239214 | 130 |
| 123 | 3300013296 | Ga0157374_10821860 | Ga0157374_108218602 | 130 |
| 124 | 3300013297 | Ga0157378_12760549 | Ga0157378_127605491 | 130 |
| 125 | 3300013306 | Ga0163162_10020855 | Ga0163162_100208552 | 130 |
| 126 | 3300013306 | Ga0163162_11999816 | Ga0163162_119998161 | 130 |
| 127 | 3300014325 | Ga0163163_10000017 | Ga0163163_1000001784 | 130 |
| 128 | 3300014325 | Ga0163163_10095451 | Ga0163163_100954512 | 130 |
| 129 | 3300014325 | Ga0163163_10633603 | Ga0163163_106336032 | 130 |
| 130 | 3300014326 | Ga0157380_10364536 | Ga0157380_103645362 | 130 |
| 131 | 3300014326 | Ga0157380_12666646 | Ga0157380_126666461 | 130 |
| 132 | 3300014745 | Ga0157377_10173182 | Ga0157377_101731823 | 130 |
| 133 | 3300014969 | Ga0157376_10112768 | Ga0157376_101127682 | 130 |
| 134 | 3300014969 | Ga0157376_10312858 | Ga0157376_103128583 | 130 |
| 135 | 3300014969 | Ga0157376_11136740 | Ga0157376_111367402 | 130 |
| 136 | 3300017792 | Ga0163161_10062723 | Ga0163161_100627231 | 130 |
| 137 | 3300017792 | Ga0163161_10885905 | Ga0163161_108859052 | 130 |
| 138 | 3300025901 | Ga0207688_10043908 | Ga0207688_100439085 | 130 |
| 139 | 3300025910 | Ga0207684_10380670 | Ga0207684_103806702 | 130 |
| 140 | 3300025912 | Ga0207707_10357100 | Ga0207707_103571002 | 130 |
| 141 | 3300025912 | Ga0207707_11617871 | Ga0207707_116178712 | 130 |
| 142 | 3300025913 | Ga0207695_10089158 | Ga0207695_100891582 | 130 |
| 143 | 3300025922 | Ga0207646_10183074 | Ga0207646_101830742 | 130 |
| 144 | 3300025923 | Ga0207681_10282056 | Ga0207681_102820561 | 130 |
| 145 | 3300025925 | Ga0207650_10696049 | Ga0207650_106960492 | 130 |
| 146 | 3300025931 | Ga0207644_10157544 | Ga0207644_101575442 | 130 |
| 147 | 3300025933 | Ga0207706_10307980 | Ga0207706_103079801 | 130 |
| 148 | 3300025933 | Ga0207706_10528537 | Ga0207706_105285372 | 130 |
| 149 | 3300025934 | Ga0207686_11167772 | Ga0207686_111677721 | 130 |
| 150 | 3300025936 | Ga0207670_10520492 | Ga0207670_105204921 | 130 |
| 151 | 3300025937 | Ga0207669_10241559 | Ga0207669_102415591 | 130 |
| 152 | 3300025937 | Ga0207669_10588847 | Ga0207669_105888472 | 130 |
| 153 | 3300025941 | Ga0207711_10047397 | Ga0207711_100473972 | 130 |
| 154 | 3300025941 | Ga0207711_10095310 | Ga0207711_100953104 | 130 |
| 155 | 3300025941 | Ga0207711_10172902 | Ga0207711_101729022 | 130 |
| 156 | 3300025945 | Ga0207679_10017972 | Ga0207679_100179723 | 130 |
| 157 | 3300025945 | Ga0207679_10344659 | Ga0207679_103446592 | 130 |
| 158 | 3300025972 | Ga0207668_10114493 | Ga0207668_101144934 | 130 |
| 159 | 3300025981 | Ga0207640_10272685 | Ga0207640_102726852 | 130 |
| 160 | 3300025986 | Ga0207658_10086806 | Ga0207658_100868062 | 130 |
| 161 | 3300025986 | Ga0207658_10535928 | Ga0207658_105359282 | 130 |
| 162 | 3300026067 | Ga0207678_10014217 | Ga0207678_100142172 | 130 |
| 163 | 3300026067 | Ga0207678_11020494 | Ga0207678_110204941 | 130 |
| 164 | 3300026088 | Ga0207641_10165008 | Ga0207641_101650084 | 130 |
| 165 | 3300026088 | Ga0207641_12209563 | Ga0207641_122095631 | 130 |
| 166 | 3300026095 | Ga0207676_10159574 | Ga0207676_101595742 | 130 |
| 167 | 3300026095 | Ga0207676_10252913 | Ga0207676_102529132 | 130 |
| 168 | 3300026118 | Ga0207675_100667266 | Ga0207675_1006672662 | 130 |
| 169 | 3300026118 | Ga0207675_100960693 | Ga0207675_1009606931 | 130 |
| 170 | 3300026118 | Ga0207675_101201453 | Ga0207675_1012014532 | 130 |
| 171 | 3300026121 | Ga0207683_10024543 | Ga0207683_100245432 | 130 |
| 172 | 3300027907 | Ga0207428_10083233 | Ga0207428_100832333 | 130 |
| 173 | 3300027907 | Ga0207428_10261090 | Ga0207428_102610902 | 130 |
| 174 | 3300028381 | Ga0268264_10240398 | Ga0268264_102403981 | 130 |
| 175 | 3300028573 | Ga0265334_10003452 | Ga0265334_100034527 | 130 |
| 176 | 3300028800 | Ga0265338_10106331 | Ga0265338_101063314 | 130 |
| 177 | 3300028800 | Ga0265338_10143833 | Ga0265338_101438332 | 130 |
| 178 | 3300031240 | Ga0265320_10197798 | Ga0265320_101977981 | 130 |
| 179 | 3300031548 | Ga0307408_100818586 | Ga0307408_1008185862 | 130 |
| 180 | 3300031731 | Ga0307405_10303963 | Ga0307405_103039632 | 130 |
| 181 | 3300031824 | Ga0307413_11056930 | Ga0307413_110569301 | 130 |
| 182 | 3300031852 | Ga0307410_10391981 | Ga0307410_103919812 | 130 |
| 183 | 3300031901 | Ga0307406_10040084 | Ga0307406_100400843 | 130 |
| 184 | 3300031901 | Ga0307406_11256902 | Ga0307406_112569021 | 130 |
| 185 | 3300031903 | Ga0307407_10788155 | Ga0307407_107881552 | 130 |
| 186 | 3300031911 | Ga0307412_10030546 | Ga0307412_100305465 | 130 |
| 187 | 3300031911 | Ga0307412_10494550 | Ga0307412_104945501 | 130 |
| 188 | 3300031911 | Ga0307412_11986905 | Ga0307412_119869051 | 130 |
| 189 | 3300032002 | Ga0307416_100003959 | Ga0307416_1000039598 | 130 |
| 190 | 3300032002 | Ga0307416_100190400 | Ga0307416_1001904001 | 130 |
| 191 | 3300032002 | Ga0307416_103107788 | Ga0307416_1031077881 | 130 |
| 192 | 3300032002 | Ga0307416_103257327 | Ga0307416_1032573271 | 130 |
| 193 | 3300032004 | Ga0307414_10451099 | Ga0307414_104510991 | 130 |
| 194 | 3300032005 | Ga0307411_10455384 | Ga0307411_104553842 | 130 |
| 195 | 3300035114 | Ga0373939_0364896 | Ga0373939_0364896_135_527 | 130 |
| 196 | 3300035172 | Ga0373955_0183051 | Ga0373955_0183051_76_468 | 130 |
| 197 | 3300041408 | Ga0439453_0115404 | Ga0439453_0115404_145_537 | 130 |
| 198 | 3300042008 | Ga0439450_005554 | Ga0439450_005554_1704_2096 | 130 |
| 199 | 3300042118 | Ga0450914_013318 | Ga0450914_013318_45_437 | 130 |
| 200 | 3300042122 | Ga0450920_005703 | Ga0450920_005703_1577_1969 | 130 |
| 201 | 3300042125 | Ga0450923_036329 | Ga0450923_036329_464_856 | 130 |
| 202 | 3300042147 | Ga0450910_009736 | Ga0450910_009736_582_974 | 130 |
| 203 | 3300042184 | Ga0450908_000419 | Ga0450908_000419_6575_6967 | 130 |
| 204 | 3300042436 | Ga0439435_0014321 | Ga0439435_0014321_22_414 | 130 |
| 205 | 3300042436 | Ga0439435_0021820 | Ga0439435_0021820_719_1111 | 130 |
| 206 | 3300042436 | Ga0439435_0137107 | Ga0439435_0137107_366_758 | 130 |
| 207 | 3300042439 | Ga0439464_0003381 | Ga0439464_0003381_3229_3621 | 130 |
| 208 | 3300042531 | Ga0450918_004470 | Ga0450918_004470_248_640 | 130 |
| 209 | 3300042876 | Ga0451577_0101814 | Ga0451577_0101814_1909_2307 | 130 |
| 210 | 3300042876 | Ga0451577_0137188 | Ga0451577_0137188_1638_2036 | 130 |
| 211 | 3300042876 | Ga0451577_0155979 | Ga0451577_0155979_1143_1535 | 130 |
| 212 | 3300044673 | Ga0453683_1205641 | Ga0453683_1205641_101_493 | 130 |
| 213 | 3300044712 | Ga0453684_0187818 | Ga0453684_0187818_1572_1970 | 130 |
| 214 | 3300044712 | Ga0453684_0662656 | Ga0453684_0662656_21_419 | 130 |
| 215 | 3300045051 | Ga0451576_0298981 | Ga0451576_0298981_440_832 | 130 |
| 216 | 3300045051 | Ga0451576_0361688 | Ga0451576_0361688_722_1120 | 130 |
| 217 | 3300045051 | Ga0451576_0551885 | Ga0451576_0551885_387_779 | 130 |
| 218 | 3300046454 | Ga0495592_0139605 | Ga0495592_0139605_1091_1483 | 130 |
| 219 | 3300046491 | Ga0495584_0031761 | Ga0495584_0031761_1591_1983 | 130 |
| 220 | 3300046525 | Ga0495663_0020344 | Ga0495663_0020344_954_1346 | 130 |
| 221 | 3300046528 | Ga0495642_0048276 | Ga0495642_0048276_412_804 | 130 |
| 222 | 3300046538 | Ga0495609_0157872 | Ga0495609_0157872_344_736 | 130 |
| 223 | 3300046539 | Ga0495621_0072573 | Ga0495621_0072573_183_575 | 130 |
| 224 | 3300046664 | Ga0495659_0050668 | Ga0495659_0050668_166_558 | 130 |
| 225 | 3300046809 | Ga0495600_0101431 | Ga0495600_0101431_1174_1566 | 130 |
| 226 | 3300047315 | Ga0495581_0699573 | Ga0495581_0699573_22_414 | 130 |
| 227 | 3300047318 | Ga0495636_0179832 | Ga0495636_0179832_307_699 | 130 |
| 228 | 3300047321 | Ga0495676_0335543 | Ga0495676_0335543_90_482 | 130 |
| 229 | 3300047445 | Ga0495677_0023989 | Ga0495677_0023989_121_513 | 130 |
| 230 | 3300047447 | Ga0495685_030570 | Ga0495685_030570_604_996 | 130 |
| 231 | 3300048907 | Ga0496104_1436193 | Ga0496104_1436193_175_567 | 130 |
| 232 | 3300048911 | Ga0496108_0252829 | Ga0496108_0252829_159_551 | 130 |
| 233 | 3300048912 | Ga0496109_1107900 | Ga0496109_1107900_58_450 | 130 |
| 234 | 3300048914 | Ga0496111_0165908 | Ga0496111_0165908_1081_1473 | 130 |
| 235 | 3300048915 | Ga0496112_1111444 | Ga0496112_1111444_17_409 | 130 |
| 236 | 3300048916 | Ga0496113_0590386 | Ga0496113_0590386_145_537 | 130 |
| 237 | 3300048917 | Ga0496114_0658214 | Ga0496114_0658214_457_849 | 130 |
| 238 | 3300049571 | Ga0501034_0000245 | Ga0501034_0000245_70151_70543 | 130 |
| 239 | 3300049571 | Ga0501034_0731082 | Ga0501034_0731082_436_828 | 130 |
| 240 | 3300049576 | Ga0501040_0156059 | Ga0501040_0156059_238_630 | 130 |
| 241 | 3300049587 | Ga0501071_0434340 | Ga0501071_0434340_449_841 | 130 |
| 242 | 3300049590 | Ga0501074_0717549 | Ga0501074_0717549_105_497 | 130 |
| 243 | 3300049591 | Ga0501075_0278496 | Ga0501075_0278496_396_788 | 130 |
| 244 | 3300049593 | Ga0501077_0268330 | Ga0501077_0268330_270_662 | 130 |
| 245 | 3300050492 | nmdc:mga0yw44_65326_c1 | nmdc:mga0yw44_65326_c1_1210_1602 | 130 |
| 246 | 3300050493 | nmdc:mga0k408_11017_c1 | nmdc:mga0k408_11017_c1_2741_3133 | 130 |
| 247 | 3300050493 | nmdc:mga0k408_11708_c2 | nmdc:mga0k408_11708_c2_1081_1473 | 130 |
| 248 | 3300050507 | nmdc:mga05p37_16793_c1 | nmdc:mga05p37_16793_c1_4075_4467 | 130 |
| 249 | 3300050507 | nmdc:mga05p37_30197_c1 | nmdc:mga05p37_30197_c1_3108_3503 | 130 |
| 250 | 3300050508 | nmdc:mga09592_10871_c1 | nmdc:mga09592_10871_c1_891_1283 | 130 |
| 251 | 3300050508 | nmdc:mga09592_177954_c1 | nmdc:mga09592_177954_c1_326_718 | 130 |
| 252 | 3300050509 | nmdc:mga0qj67_1924_c1 | nmdc:mga0qj67_1924_c1_1121_1513 | 130 |
| 253 | 3300050509 | nmdc:mga0qj67_49858_c1 | nmdc:mga0qj67_49858_c1_706_1098 | 130 |
| 254 | 3300050510 | nmdc:mga06r32_32495_c1 | nmdc:mga06r32_32495_c1_2042_2434 | 130 |
| 255 | 3300050510 | nmdc:mga06r32_40398_c1 | nmdc:mga06r32_40398_c1_3518_3991 | 130 |
| 256 | 3300050510 | nmdc:mga06r32_47698_c1 | nmdc:mga06r32_47698_c1_2034_2426 | 130 |
| 257 | 3300050511 | nmdc:mga08y16_120598_c1 | nmdc:mga08y16_120598_c1_282_674 | 130 |
| 258 | 3300050511 | nmdc:mga08y16_320494_c1 | nmdc:mga08y16_320494_c1_1151_1543 | 130 |
| 259 | 3300050511 | nmdc:mga08y16_4826_c1 | nmdc:mga08y16_4826_c1_12885_13277 | 130 |
| 260 | 3300050511 | nmdc:mga08y16_66876_c1 | nmdc:mga08y16_66876_c1_687_1079 | 130 |
| 261 | 3300050511 | nmdc:mga08y16_906129_c1 | nmdc:mga08y16_906129_c1_78_470 | 130 |
| 262 | 3300050513 | nmdc:mga0rr50_77256_c1 | nmdc:mga0rr50_77256_c1_1345_1746 | 130 |
| 263 | 3300050515 | nmdc:mga0a205_633293_c1 | nmdc:mga0a205_633293_c1_472_864 | 130 |
| 264 | 3300050515 | nmdc:mga0a205_75903_c1 | nmdc:mga0a205_75903_c1_1966_2358 | 130 |
| 265 | 3300050516 | nmdc:mga0sz30_59490_c1 | nmdc:mga0sz30_59490_c1_43_435 | 130 |
| 266 | 3300053085 | Ga0495619_0173733 | Ga0495619_0173733_1044_1436 | 130 |
| 267 | 3300054114 | Ga0501084_0416342 | Ga0501084_0416342_428_820 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v68-assembly2.cif.gz_D | crystal structure of cell division protein ftsz from mycobacterium tuberculosis bounded via the t9 loop | 0.7238 | 63 | 108 |
| 1w59-assembly2.cif.gz_B | ftsz dimer, empty (m. jannaschii) | 0.7071 | 63 | 108 |
| 2q1x-assembly1.cif.gz_B | crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with citrate. | 0.6802 | 63 | 108 |
| 6ym9-assembly1.cif.gz_B | mycobacterium tuberculosis ftsz in complex with gtp-gamma-s | 0.6771 | 63 | 108 |
| 1rlu-assembly1.cif.gz_B | mycobacterium tuberculosis ftsz in complex with gtp-gamma-s | 0.6751 | 63 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P91443_1670_1773_1.25.40.530 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain | 0.8309 | 25 | 56 | 1.25.40.530 |
| af_P0ABA4_107_177_3.30.2320.30 | Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal | 0.8206 | 63 | 128 | 3.30.2320.30 |
| af_Q9V3Z6_1681_1852_1.25.40.530 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain | 0.8178 | 23 | 56 | 1.25.40.530 |
| af_D3ZL50_1_115_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.7667 | 25 | 55 | 1.25.40.10 |
| af_Q2FWE7_104_179_3.30.2320.30 | Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal | 0.7653 | 62 | 129 | 3.30.2320.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381WYX0-F1-model_v4 | Uncharacterized protein | 0.8984 | 1 | 104 |
GO:0016020
GO:0046933 |
| AF-A0A381WYX0-F1-model_v4 | Uncharacterized protein | 0.8904 | 1 | 104 |
GO:0016020
GO:0046933 |
| AF-A0A3D3XNS8-F1-model_v4 | H(+)-transporting ATPase | 0.889 | 6 | 129 |
GO:0016020
GO:0046933 |
| AF-A0A1V6DI24-F1-model_v4 | deleted | 0.8876 | 6 | 130 |
|
| AF-A0A7V7VN67-F1-model_v4 | F0F1 ATP synthase subunit delta | 0.8857 | 1 | 128 |
GO:0016020
GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar