F374642

General Info

Members Datasets Scaffolds Average Seq Length
267 180 534 154

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100736068|Ga0068857_1007360681
Length 178
Sequence MPATIFPGCGRLVPRQPGLRTHRQMPTHAEQKVLPYTPEQLFALVADIERYPEFLPWCVGARIRERRDTVILADLIIGFSMFRERFTSRVTLNRPHRIDVVYTEGPFKYLNNHWIFERVPGGCRIDFFVDFEFKSRILQRVIEMLFHEAVRRMVAAFEDRARQLYGAPDPHPAGKPAE

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 2.25
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0.37
Rhizoplane 1.5
Rhizosphere 86.89
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100736068 3300005577 Bacteria 939
2 Ga0006778J45830_1083460 3300003162 Bacteria 933
3 Ga0007410J51695_1043164 3300003574 Bacteria 1086
4 Ga0070658_10150849 3300005327 Bacteria 1946
5 Ga0070683_101204232 3300005329 Bacteria 728
6 Ga0070666_10767660 3300005335 Bacteria 709
7 Ga0070680_100000601 3300005336 Bacteria 24906
8 Ga0070680_100762695 3300005336 Bacteria 833
9 Ga0070680_100772902 3300005336 Bacteria 827
10 Ga0070682_100738957 3300005337 Bacteria 793
11 Ga0070660_100760343 3300005339 Bacteria 814
12 Ga0070689_100486435 3300005340 Bacteria 1055
13 Ga0070668_100314860 3300005347 Bacteria 1316
14 Ga0070671_100028301 3300005355 Bacteria 4615
15 Ga0070671_100170989 3300005355 Bacteria 1838
16 Ga0070667_100396837 3300005367 Bacteria 1255
17 Ga0070667_101692115 3300005367 Bacteria 595
18 Ga0070714_100898913 3300005435 Bacteria 860
19 Ga0070713_100184942 3300005436 Bacteria 1874
20 Ga0070710_10085657 3300005437 Bacteria 1849
21 Ga0070710_10380144 3300005437 Bacteria 942
22 Ga0070711_100116955 3300005439 Bacteria 1965
23 Ga0070705_100054322 3300005440 Bacteria 2349
24 Ga0070700_100269880 3300005441 Bacteria 1229
25 Ga0070694_100003451 3300005444 Bacteria 9469
26 Ga0070662_100517920 3300005457 Bacteria 996
27 Ga0070681_10014010 3300005458 Bacteria 7979
28 Ga0070681_10023097 3300005458 Bacteria 6254
29 Ga0070681_10099667 3300005458 Bacteria 2851
30 Ga0070681_10125932 3300005458 Bacteria 2495
31 Ga0070681_10818494 3300005458 Bacteria 848
32 Ga0070681_11273160 3300005458 Bacteria 658
33 Ga0070685_10303883 3300005466 Bacteria 1076
34 Ga0070706_100028382 3300005467 Bacteria 5152
35 Ga0070706_100237795 3300005467 Bacteria 1701
36 Ga0070706_100806387 3300005467 Bacteria 869
37 Ga0070707_100048114 3300005468 Bacteria 4084
38 Ga0070698_100274997 3300005471 Bacteria 1616
39 Ga0070698_100558109 3300005471 Bacteria 1085
40 Ga0070699_100213023 3300005518 Bacteria 1720
41 Ga0070699_100343670 3300005518 Bacteria 1343
42 Ga0070699_100759220 3300005518 Bacteria 887
43 Ga0070679_100005677 3300005530 Bacteria 11571
44 Ga0070679_100115178 3300005530 Bacteria 2673
45 Ga0070697_100100323 3300005536 Bacteria 2404
46 Ga0070697_101310707 3300005536 Bacteria 646
47 Ga0068853_101177092 3300005539 Bacteria 740
48 Ga0068853_101763285 3300005539 Bacteria 600
49 Ga0070695_100090580 3300005545 Bacteria 2041
50 Ga0068854_101597801 3300005578 Bacteria 594
51 Ga0068856_100069535 3300005614 Bacteria 3481
52 Ga0068856_100361593 3300005614 Bacteria 1470
53 Ga0068852_101935442 3300005616 Bacteria 612
54 Ga0068859_101265415 3300005617 Unclassified 813
55 Ga0068863_101019301 3300005841 Bacteria 831
56 Ga0081540_1134539 3300005983 Bacteria 1003
57 Ga0070717_10092707 3300006028 Bacteria 2552
58 Ga0070717_10271973 3300006028 Bacteria 1501
59 Ga0070717_10508795 3300006028 Bacteria 1089
60 Ga0070712_100155258 3300006175 Bacteria 1762
61 Ga0075434_100928820 3300006871 Bacteria 885
62 Ga0075434_101361147 3300006871 Unclassified 720
63 Ga0075436_100024729 3300006914 Bacteria 4129
64 Ga0097620_101265366 3300006931 Unclassified 813
65 Ga0075435_100530599 3300007076 Bacteria 1018
66 Ga0099795_10012199 3300007788 Bacteria 2598
67 Ga0105240_10245206 3300009093 Bacteria 2075
68 Ga0105240_11445489 3300009093 Bacteria 722
69 Ga0105247_10629950 3300009101 Bacteria 799
70 Ga0105238_10040462 3300009551 Bacteria 4723
71 Ga0105249_10195460 3300009553 Bacteria 1977
72 Ga0099796_10065267 3300010159 Bacteria 1301
73 Ga0105239_12599369 3300010375 Bacteria 590
74 Ga0105246_11297750 3300011119 Bacteria 674
75 Ga0157370_10005287 3300013104 Bacteria 14505
76 Ga0157370_10085546 3300013104 Bacteria 2963
77 Ga0157369_11036353 3300013105 Bacteria 839
78 Ga0163162_10692470 3300013306 Bacteria 1141
79 Ga0163162_12133801 3300013306 Bacteria 643
80 Ga0157372_10696673 3300013307 Bacteria 1182
81 Ga0157375_10428343 3300013308 Bacteria 1489
82 Ga0182008_10881765 3300014497 Bacteria 525
83 Ga0157379_10056988 3300014968 Bacteria 3492
84 Ga0157379_11044315 3300014968 Bacteria 781
85 Ga0157379_11604780 3300014968 Bacteria 635
86 Ga0157376_10553459 3300014969 Bacteria 1139
87 Ga0182007_10155197 3300015262 Bacteria 780
88 Ga0213873_10013578 3300021358 Bacteria 1790
89 Ga0213874_10105098 3300021377 Bacteria 943
90 Ga0213876_10003524 3300021384 Bacteria 8925
91 Ga0213875_10000803 3300021388 Bacteria 23497
92 Ga0213875_10008213 3300021388 Bacteria 5357
93 Ga0213875_10013153 3300021388 Bacteria 4069
94 Ga0213875_10117584 3300021388 Bacteria 1242
95 Ga0213871_10005092 3300021441 Bacteria 2686
96 Ga0224712_10172918 3300022467 Bacteria 969
97 Ga0207692_10782499 3300025898 Bacteria 623
98 Ga0207680_10454001 3300025903 Bacteria 910
99 Ga0207699_10029778 3300025906 Bacteria 3047
100 Ga0207684_10153434 3300025910 Bacteria 1982
101 Ga0207707_10043099 3300025912 Bacteria 3937
102 Ga0207707_10118648 3300025912 Bacteria 2312
103 Ga0207707_10350149 3300025912 Bacteria 1273
104 Ga0207707_10409819 3300025912 Bacteria 1163
105 Ga0207707_10623077 3300025912 Bacteria 911
106 Ga0207695_10147531 3300025913 Bacteria 2295
107 Ga0207695_10485555 3300025913 Bacteria 1117
108 Ga0207695_10974871 3300025913 Bacteria 727
109 Ga0207671_10436834 3300025914 Bacteria 1042
110 Ga0207693_10282973 3300025915 Bacteria 1299
111 Ga0207663_10264109 3300025916 Bacteria 1272
112 Ga0207660_10021673 3300025917 Bacteria 4323
113 Ga0207660_10699419 3300025917 Bacteria 827
114 Ga0207652_10006182 3300025921 Bacteria 9678
115 Ga0207652_10551232 3300025921 Bacteria 1036
116 Ga0207646_10014240 3300025922 Bacteria 7561
117 Ga0207646_11251427 3300025922 Bacteria 649
118 Ga0207694_10058910 3300025924 Bacteria 2987
119 Ga0207659_10297370 3300025926 Bacteria 1325
120 Ga0207664_10023352 3300025929 Bacteria 4631
121 Ga0207664_10092607 3300025929 Bacteria 2481
122 Ga0207664_10115159 3300025929 Bacteria 2241
123 Ga0207644_10087451 3300025931 Bacteria 2316
124 Ga0207644_11076299 3300025931 Bacteria 675
125 Ga0207690_10096306 3300025932 Bacteria 2104
126 Ga0207706_10347750 3300025933 Bacteria 1289
127 Ga0207665_10101273 3300025939 Bacteria 2011
128 Ga0207689_10910668 3300025942 Bacteria 742
129 Ga0207661_11188930 3300025944 Bacteria 702
130 Ga0207712_10481195 3300025961 Bacteria 1058
131 Ga0207668_10292438 3300025972 Bacteria 1341
132 Ga0207658_10353372 3300025986 Bacteria 1280
133 Ga0207658_10993262 3300025986 Bacteria 766
134 Ga0207658_11049711 3300025986 Bacteria 744
135 Ga0207703_10678900 3300026035 Bacteria 979
136 Ga0207678_12025716 3300026067 Bacteria 501
137 Ga0207708_10800423 3300026075 Bacteria 811
138 Ga0207702_10216497 3300026078 Bacteria 1783
139 Ga0209179_1024998 3300027512 Bacteria 1188
140 Ga0311001_1019492 3300029277 Bacteria 966
141 Ga0265324_10082711 3300029957 Bacteria 1092
142 Ga0265320_10009341 3300031240 Bacteria 5922
143 Ga0265327_10001029 3300031251 Bacteria 39284
144 Ga0265327_10017930 3300031251 Bacteria 4415
145 Ga0265316_10662298 3300031344 Bacteria 737
146 Ga0265313_10003622 3300031595 Bacteria 12408
147 Ga0307508_10623489 3300031616 Bacteria 682
148 Ga0265314_10042823 3300031711 Bacteria 3225
149 Ga0265314_10201498 3300031711 Bacteria 1176
150 Ga0307516_10380023 3300031730 Bacteria 1074
151 Ga0307406_10720927 3300031901 Bacteria 834
152 Ga0307416_100884995 3300032002 Bacteria 992
153 Ga0307416_101451490 3300032002 Unclassified 792
154 Ga0307414_10828253 3300032004 Bacteria 845
155 Ga0307415_101389454 3300032126 Bacteria 668
156 Ga0373938_0136825 3300034957 Bacteria 643
157 Ga0373926_0063144 3300035083 Bacteria 1352
158 Ga0373926_0100619 3300035083 Bacteria 1081
159 Ga0373940_0166152 3300035088 Bacteria 711
160 Ga0373923_0243165 3300035111 Bacteria 841
161 Ga0373932_0124163 3300035112 Bacteria 864
162 Ga0373945_0214003 3300035116 Bacteria 804
163 Ga0373953_0164205 3300035117 Bacteria 955
164 Ga0373954_0149621 3300035118 Bacteria 1140
165 Ga0373943_0029298 3300035170 Bacteria 2601
166 Ga0373943_0036689 3300035170 Bacteria 2349
167 Ga0373955_0079808 3300035172 Unclassified 1847
168 Ga0373931_0019148 3300035691 Bacteria 3413
169 Ga0373935_0162155 3300035692 Bacteria 1525
170 Ga0373927_0076161 3300035695 Bacteria 2173
171 Ga0373927_0077943 3300035695 Bacteria 2147
172 Ga0373927_0112108 3300035695 Bacteria 1777
173 Ga0373933_0029302 3300035724 Bacteria 3182
174 Ga0373933_0159583 3300035724 Bacteria 1431
175 Ga0373947_0025464 3300035725 Bacteria 3451
176 Ga0373947_0092758 3300035725 Bacteria 1886
177 Ga0373947_0925015 3300035725 Bacteria 595
178 Ga0373937_0006308 3300036401 Bacteria 10226
179 Ga0373937_0015236 3300036401 Bacteria 6797
180 Ga0373937_0040609 3300036401 Bacteria 4240
181 Ga0395898_1296073 3300037466 Bacteria 658
182 Ga0436364_0049233 3300037853 Bacteria 32067
183 Ga0436364_0683745 3300037853 Bacteria 23735
184 Ga0436364_0714254 3300037853 Bacteria 36578
185 Ga0436364_1164389 3300037853 Bacteria 895
186 Ga0436364_1377595 3300037853 Bacteria 877
187 Ga0395901_0611436 3300038443 Bacteria 1098
188 Ga0436365_0458022 3300039437 Bacteria 1015
189 Ga0436365_0792312 3300039437 Bacteria 1204
190 Ga0436365_0870928 3300039437 Bacteria 1259
191 Ga0436365_0890140 3300039437 Bacteria 1216
192 Ga0436365_0944839 3300039437 Bacteria 571
193 Ga0436365_1364128 3300039437 Bacteria 1179
194 Ga0436365_1689031 3300039437 Bacteria 565
195 Ga0436365_1702533 3300039437 Bacteria 9957
196 Ga0436365_1907124 3300039437 Bacteria 1978
197 Ga0436360_0116140 3300039438 Bacteria 608
198 Ga0436360_0610222 3300039438 Bacteria 2988
199 Ga0436360_0839958 3300039438 Bacteria 730
200 Ga0436361_0433835 3300039447 Bacteria 2203
201 Ga0436361_1130362 3300039447 Bacteria 893
202 Ga0436363_0710781 3300039450 Bacteria 903
203 Ga0436363_0792552 3300039450 Bacteria 1100
204 Ga0436363_1142814 3300039450 Bacteria 1250
205 Ga0436362_0979787 3300039453 Bacteria 3877
206 Ga0436362_1271474 3300039453 Bacteria 693
207 Ga0451853_0147122 3300041512 Bacteria 616
208 Ga0451577_0058747 3300042876 Bacteria 3429
209 Ga0453684_0024347 3300044712 Bacteria 8851
210 Ga0453684_0176953 3300044712 Bacteria 2508
211 Ga0466957_0397665 3300044842 Bacteria 942
212 Ga0466960_0505794 3300044901 Bacteria 708
213 Ga0451576_0358821 3300045051 Bacteria 1526
214 Ga0466958_0476830 3300045836 Bacteria 809
215 Ga0466967_0465713 3300045976 Bacteria 1237
216 Ga0466967_0932901 3300045976 Bacteria 864
217 Ga0466967_1709059 3300045976 Bacteria 627
218 Ga0495653_0732815 3300046463 Bacteria 598
219 Ga0495639_0123538 3300046475 Bacteria 1236
220 Ga0495662_0488263 3300046476 Bacteria 604
221 Ga0495618_0256426 3300046514 Bacteria 1096
222 Ga0495640_0157925 3300046533 Bacteria 1455
223 Ga0495586_0127083 3300046535 Bacteria 1426
224 Ga0495667_0055811 3300046559 Bacteria 2598
225 Ga0495667_0100273 3300046559 Bacteria 1874
226 Ga0495600_0024059 3300046809 Bacteria 3921
227 Ga0495674_0287003 3300047319 Bacteria 1347
228 Ga0495680_0052753 3300047322 Bacteria 3169
229 Ga0495684_0053797 3300047471 Bacteria 3071
230 Ga0496111_0207235 3300048914 Bacteria 1457
231 Ga0496112_0117426 3300048915 Bacteria 2630
232 Ga0496113_0097266 3300048916 Bacteria 2277
233 Ga0496115_0437332 3300048918 Bacteria 1058
234 Ga0501318_001889 3300049534 Bacteria 1735
235 Ga0501325_040221 3300049541 Bacteria 567
236 Ga0501034_0743549 3300049571 Bacteria 877
237 Ga0501034_1120043 3300049571 Bacteria 668
238 Ga0501037_0556484 3300049573 Bacteria 774
239 Ga0501038_0321812 3300049574 Bacteria 1210
240 Ga0501047_0385727 3300049581 Bacteria 1235
241 Ga0501047_0429471 3300049581 Bacteria 1152
242 Ga0501047_0430816 3300049581 Bacteria 1150
243 Ga0501067_0191619 3300049583 Bacteria 1139
244 Ga0501070_0035507 3300049586 Bacteria 4166
245 Ga0501070_0900158 3300049586 Bacteria 690
246 Ga0501071_0874803 3300049587 Bacteria 693
247 Ga0501073_0362671 3300049589 Bacteria 1001
248 Ga0501074_0761601 3300049590 Bacteria 683
249 Ga0501077_0096282 3300049593 Bacteria 1876
250 Ga0501080_0021665 3300049742 Bacteria 5951
251 Ga0501080_0022032 3300049742 Bacteria 5902
252 Ga0501080_0902367 3300049742 Bacteria 770
253 Ga0501080_1341519 3300049742 Bacteria 612
254 Ga0501081_0171566 3300049743 Bacteria 1566
255 Ga0501083_0024611 3300049744 Bacteria 4169
256 nmdc:mga0k408_379194_c1 3300050493 Bacteria 842
257 nmdc:mga06z11_736966_c1 3300050494 Bacteria 600
258 Ga0495601_0046386 3300053077 Bacteria 2735
259 Ga0495601_0564574 3300053077 Bacteria 732
260 Ga0495595_0016043 3300053084 Bacteria 3200
261 Ga0495619_0280997 3300053085 Bacteria 1153
262 Ga0495619_1197472 3300053085 Bacteria 503
263 Ga0500568_0011984 3300053139 Bacteria 4000
264 Ga0500616_0038306 3300053153 Bacteria 2590
265 Ga0501084_0036163 3300054114 Bacteria 4126
266 Ga0501082_0384904 3300060353 Bacteria 1224
267 2842333391 2842333319 Bacteria 8899485
268 Ga0068857_100736068
269 Ga0006778J45830_1083460
270 Ga0007410J51695_1043164
271 Ga0070658_10150849
272 Ga0070683_101204232
273 Ga0070666_10767660
274 Ga0070680_100000601
275 Ga0070680_100762695
276 Ga0070680_100772902
277 Ga0070682_100738957
278 Ga0070660_100760343
279 Ga0070689_100486435
280 Ga0070668_100314860
281 Ga0070671_100028301
282 Ga0070671_100170989
283 Ga0070667_100396837
284 Ga0070667_101692115
285 Ga0070714_100898913
286 Ga0070713_100184942
287 Ga0070710_10085657
288 Ga0070710_10380144
289 Ga0070711_100116955
290 Ga0070705_100054322
291 Ga0070700_100269880
292 Ga0070694_100003451
293 Ga0070662_100517920
294 Ga0070681_10014010
295 Ga0070681_10023097
296 Ga0070681_10099667
297 Ga0070681_10125932
298 Ga0070681_10818494
299 Ga0070681_11273160
300 Ga0070685_10303883
301 Ga0070706_100028382
302 Ga0070706_100237795
303 Ga0070706_100806387
304 Ga0070707_100048114
305 Ga0070698_100274997
306 Ga0070698_100558109
307 Ga0070699_100213023
308 Ga0070699_100343670
309 Ga0070699_100759220
310 Ga0070679_100005677
311 Ga0070679_100115178
312 Ga0070697_100100323
313 Ga0070697_101310707
314 Ga0068853_101177092
315 Ga0068853_101763285
316 Ga0070695_100090580
317 Ga0068854_101597801
318 Ga0068856_100069535
319 Ga0068856_100361593
320 Ga0068852_101935442
321 Ga0068859_101265415
322 Ga0068863_101019301
323 Ga0081540_1134539
324 Ga0070717_10092707
325 Ga0070717_10271973
326 Ga0070717_10508795
327 Ga0070712_100155258
328 Ga0075434_100928820
329 Ga0075434_101361147
330 Ga0075436_100024729
331 Ga0097620_101265366
332 Ga0075435_100530599
333 Ga0099795_10012199
334 Ga0105240_10245206
335 Ga0105240_11445489
336 Ga0105247_10629950
337 Ga0105238_10040462
338 Ga0105249_10195460
339 Ga0099796_10065267
340 Ga0105239_12599369
341 Ga0105246_11297750
342 Ga0157370_10005287
343 Ga0157370_10085546
344 Ga0157369_11036353
345 Ga0163162_10692470
346 Ga0163162_12133801
347 Ga0157372_10696673
348 Ga0157375_10428343
349 Ga0182008_10881765
350 Ga0157379_10056988
351 Ga0157379_11044315
352 Ga0157379_11604780
353 Ga0157376_10553459
354 Ga0182007_10155197
355 Ga0213873_10013578
356 Ga0213874_10105098
357 Ga0213876_10003524
358 Ga0213875_10000803
359 Ga0213875_10008213
360 Ga0213875_10013153
361 Ga0213875_10117584
362 Ga0213871_10005092
363 Ga0224712_10172918
364 Ga0207692_10782499
365 Ga0207680_10454001
366 Ga0207699_10029778
367 Ga0207684_10153434
368 Ga0207707_10043099
369 Ga0207707_10118648
370 Ga0207707_10350149
371 Ga0207707_10409819
372 Ga0207707_10623077
373 Ga0207695_10147531
374 Ga0207695_10485555
375 Ga0207695_10974871
376 Ga0207671_10436834
377 Ga0207693_10282973
378 Ga0207663_10264109
379 Ga0207660_10021673
380 Ga0207660_10699419
381 Ga0207652_10006182
382 Ga0207652_10551232
383 Ga0207646_10014240
384 Ga0207646_11251427
385 Ga0207694_10058910
386 Ga0207659_10297370
387 Ga0207664_10023352
388 Ga0207664_10092607
389 Ga0207664_10115159
390 Ga0207644_10087451
391 Ga0207644_11076299
392 Ga0207690_10096306
393 Ga0207706_10347750
394 Ga0207665_10101273
395 Ga0207689_10910668
396 Ga0207661_11188930
397 Ga0207712_10481195
398 Ga0207668_10292438
399 Ga0207658_10353372
400 Ga0207658_10993262
401 Ga0207658_11049711
402 Ga0207703_10678900
403 Ga0207678_12025716
404 Ga0207708_10800423
405 Ga0207702_10216497
406 Ga0209179_1024998
407 Ga0311001_1019492
408 Ga0265324_10082711
409 Ga0265320_10009341
410 Ga0265327_10001029
411 Ga0265327_10017930
412 Ga0265316_10662298
413 Ga0265313_10003622
414 Ga0307508_10623489
415 Ga0265314_10042823
416 Ga0265314_10201498
417 Ga0307516_10380023
418 Ga0307406_10720927
419 Ga0307416_100884995
420 Ga0307416_101451490
421 Ga0307414_10828253
422 Ga0307415_101389454
423 Ga0373938_0136825
424 Ga0373926_0063144
425 Ga0373926_0100619
426 Ga0373940_0166152
427 Ga0373923_0243165
428 Ga0373932_0124163
429 Ga0373945_0214003
430 Ga0373953_0164205
431 Ga0373954_0149621
432 Ga0373943_0029298
433 Ga0373943_0036689
434 Ga0373955_0079808
435 Ga0373931_0019148
436 Ga0373935_0162155
437 Ga0373927_0076161
438 Ga0373927_0077943
439 Ga0373927_0112108
440 Ga0373933_0029302
441 Ga0373933_0159583
442 Ga0373947_0025464
443 Ga0373947_0092758
444 Ga0373947_0925015
445 Ga0373937_0006308
446 Ga0373937_0015236
447 Ga0373937_0040609
448 Ga0395898_1296073
449 Ga0436364_0049233
450 Ga0436364_0683745
451 Ga0436364_0714254
452 Ga0436364_1164389
453 Ga0436364_1377595
454 Ga0395901_0611436
455 Ga0436365_0458022
456 Ga0436365_0792312
457 Ga0436365_0870928
458 Ga0436365_0890140
459 Ga0436365_0944839
460 Ga0436365_1364128
461 Ga0436365_1689031
462 Ga0436365_1702533
463 Ga0436365_1907124
464 Ga0436360_0116140
465 Ga0436360_0610222
466 Ga0436360_0839958
467 Ga0436361_0433835
468 Ga0436361_1130362
469 Ga0436363_0710781
470 Ga0436363_0792552
471 Ga0436363_1142814
472 Ga0436362_0979787
473 Ga0436362_1271474
474 Ga0451853_0147122
475 Ga0451577_0058747
476 Ga0453684_0024347
477 Ga0453684_0176953
478 Ga0466957_0397665
479 Ga0466960_0505794
480 Ga0451576_0358821
481 Ga0466958_0476830
482 Ga0466967_0465713
483 Ga0466967_0932901
484 Ga0466967_1709059
485 Ga0495653_0732815
486 Ga0495639_0123538
487 Ga0495662_0488263
488 Ga0495618_0256426
489 Ga0495640_0157925
490 Ga0495586_0127083
491 Ga0495667_0055811
492 Ga0495667_0100273
493 Ga0495600_0024059
494 Ga0495674_0287003
495 Ga0495680_0052753
496 Ga0495684_0053797
497 Ga0496111_0207235
498 Ga0496112_0117426
499 Ga0496113_0097266
500 Ga0496115_0437332
501 Ga0501318_001889
502 Ga0501325_040221
503 Ga0501034_0743549
504 Ga0501034_1120043
505 Ga0501037_0556484
506 Ga0501038_0321812
507 Ga0501047_0385727
508 Ga0501047_0429471
509 Ga0501047_0430816
510 Ga0501067_0191619
511 Ga0501070_0035507
512 Ga0501070_0900158
513 Ga0501071_0874803
514 Ga0501073_0362671
515 Ga0501074_0761601
516 Ga0501077_0096282
517 Ga0501080_0021665
518 Ga0501080_0022032
519 Ga0501080_0902367
520 Ga0501080_1341519
521 Ga0501081_0171566
522 Ga0501083_0024611
523 nmdc:mga0k408_379194_c1
524 nmdc:mga06z11_736966_c1
525 Ga0495601_0046386
526 Ga0495601_0564574
527 Ga0495595_0016043
528 Ga0495619_0280997
529 Ga0495619_1197472
530 Ga0500568_0011984
531 Ga0500616_0038306
532 Ga0501084_0036163
533 Ga0501082_0384904
534 2842333391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

34

158

0.98

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

25

164

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.8727 2 142
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.852 3 141
7jta-assembly1.cif.gz_A crystal structure of a putative nuclease with anti-cas9 activity from an uncultured clostridia bacterium 0.848 34 81
1jss-assembly2.cif.gz_B crystal structure of the mus musculus cholesterol-regulated start protein 4 (stard4). 0.8435 3 139
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.84 2 142
ID Description Score Start End Superfamily
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9705 2 143 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9618 2 143 3.30.530.20
af_Q556V1_54_199_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9564 4 143 3.30.530.20
af_Q6PBN4_75_220_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9542 1 143 3.30.530.20
af_C0H4S7_40_178_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9426 2 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0U5I3W4-F1-model_v4 Oligoketide cyclase/lipid transport protein 0.9953 1 143 GO:0045333
GO:0048039
AF-A0A1G6WFT5-F1-model_v4 Coenzyme Q-binding protein COQ10 0.992 1 143 GO:0045333
GO:0048039
AF-A0A2E3ZND5-F1-model_v4 Ubiquinone-binding protein 0.9907 1 142 GO:0045333
GO:0048039
AF-A0A2E0ELB7-F1-model_v4 Ubiquinone-binding protein 0.9888 1 146 GO:0045333
GO:0048039
AF-A0A7Y6YUE9-F1-model_v4 Type II toxin-antitoxin system RatA family toxin 0.9887 1 142 GO:0045333
GO:0048039

Map