F374639

General Info

Members Datasets Scaffolds Average Seq Length
267 173 257 155

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100248397|Ga0070664_1002483972
Length 180
Sequence MIPQAENLDPVRVSSHMPPPNRGTTSMKSTLSLKPAEVKKDWVLIDAEGVVLGRLASVIANRLRGKHKPQFTPHVDCGDNVVVVNAAKLRVTGKKPDQSVFYYHTGYPGGIKGRSIRQRMEGKHPESVLEKAVERMITRGPLQRRQMKHLYVYAGPEHKHAAQQPVPLDIAAMNPKNKRG

Samples

Sample ID Description Type Environment
1 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
2 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
3 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
4 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
5 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
6 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
7 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
8 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
9 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
43 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
72 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
78 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
169 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
170 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 7.49
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0.37
Rhizoplane 0.75
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_101649160 3300005367 Bacteria 603
2 Ga0070709_10023675 3300005434 Bacteria 3610
3 Ga0070714_100085583 3300005435 Bacteria 2754
4 Ga0070713_100003594 3300005436 Bacteria 10246
5 Ga0070713_100039290 3300005436 Bacteria 3840
6 Ga0070713_100136939 3300005436 Bacteria 2165
7 Ga0070710_10394687 3300005437 Bacteria 926
8 Ga0070711_100023767 3300005439 Bacteria 3991
9 Ga0070711_100696800 3300005439 Bacteria 855
10 Ga0070681_10693405 3300005458 Bacteria 934
11 Ga0070684_100613563 3300005535 Bacteria 1012
12 Ga0070684_100912577 3300005535 Bacteria 823
13 Ga0070686_100154034 3300005544 Bacteria 1612
14 Ga0070665_100908480 3300005548 Bacteria 893
15 Ga0070664_100248397 3300005564 Bacteria 1599
16 Ga0068856_100277188 3300005614 Bacteria 1693
17 Ga0068856_100367300 3300005614 Bacteria 1458
18 Ga0068856_100521108 3300005614 Bacteria 1210
19 Ga0068852_100206332 3300005616 Bacteria 1862
20 Ga0068862_100019286 3300005844 Bacteria 5690
21 Ga0081455_10170238 3300005937 Bacteria 1660
22 Ga0070717_10038424 3300006028 Bacteria 3891
23 Ga0070712_100029453 3300006175 Bacteria 3680
24 Ga0070712_100224079 3300006175 Bacteria 1490
25 Ga0105240_11534625 3300009093 Bacteria 698
26 Ga0111539_11373789 3300009094 Bacteria 819
27 Ga0105245_10034590 3300009098 Bacteria 4482
28 Ga0105247_10694793 3300009101 Unclassified 765
29 Ga0105238_10690016 3300009551 Bacteria 1033
30 Ga0105249_11986913 3300009553 Bacteria 654
31 Ga0105246_10502084 3300011119 Bacteria 1030
32 Ga0157370_10794606 3300013104 Bacteria 861
33 Ga0157369_10163094 3300013105 Bacteria 2352
34 Ga0157374_10144301 3300013296 Bacteria 2312
35 Ga0157374_10575306 3300013296 Bacteria 1135
36 Ga0157374_12422189 3300013296 Bacteria 552
37 Ga0163162_10797183 3300013306 Bacteria 1062
38 Ga0163162_11404502 3300013306 Bacteria 794
39 Ga0163163_10561778 3300014325 Bacteria 1204
40 Ga0182008_10131759 3300014497 Bacteria 1246
41 Ga0182008_10405626 3300014497 Bacteria 733
42 Ga0157379_11485507 3300014968 Bacteria 659
43 Ga0157376_10554359 3300014969 Bacteria 1138
44 Ga0157376_11435758 3300014969 Bacteria 722
45 Ga0206355_1557341 3300020076 Bacteria 611
46 Ga0206351_10132956 3300020077 Bacteria 1346
47 Ga0213874_10101073 3300021377 Bacteria 958
48 Ga0213875_10003035 3300021388 Bacteria 9735
49 Ga0213875_10012317 3300021388 Bacteria 4229
50 Ga0213875_10032225 3300021388 Bacteria 2477
51 Ga0213875_10050340 3300021388 Bacteria 1952
52 Ga0213871_10023198 3300021441 Bacteria 1561
53 Ga0213871_10051987 3300021441 Bacteria 1125
54 Ga0213871_10082254 3300021441 Bacteria 924
55 Ga0224712_10113877 3300022467 Bacteria 1163
56 Ga0207426_1016533 3300025302 Bacteria 2646
57 Ga0207692_10241180 3300025898 Bacteria 1080
58 Ga0207699_10034616 3300025906 Bacteria 2867
59 Ga0207707_10981187 3300025912 Bacteria 694
60 Ga0207693_10008362 3300025915 Bacteria 8468
61 Ga0207693_10196640 3300025915 Bacteria 1586
62 Ga0207663_10062477 3300025916 Bacteria 2368
63 Ga0207663_10592383 3300025916 Bacteria 870
64 Ga0207694_10485260 3300025924 Unclassified 1034
65 Ga0207687_10034753 3300025927 Bacteria 3424
66 Ga0207700_10008369 3300025928 Bacteria 6403
67 Ga0207700_10055090 3300025928 Bacteria 2988
68 Ga0207700_10188262 3300025928 Bacteria 1733
69 Ga0207700_11382361 3300025928 Bacteria 626
70 Ga0207664_10233728 3300025929 Bacteria 1598
71 Ga0207664_10473070 3300025929 Bacteria 1120
72 Ga0207686_10181967 3300025934 Bacteria 1491
73 Ga0207689_10646917 3300025942 Bacteria 890
74 Ga0207661_10561448 3300025944 Bacteria 1046
75 Ga0207679_10634864 3300025945 Bacteria 965
76 Ga0207712_10345681 3300025961 Bacteria 1235
77 Ga0207677_10313801 3300026023 Bacteria 1300
78 Ga0207703_11366834 3300026035 Bacteria 681
79 Ga0207702_10643064 3300026078 Bacteria 1043
80 Ga0207702_10886664 3300026078 Bacteria 884
81 Ga0207683_10525971 3300026121 Bacteria 1093
82 Ga0207683_10530024 3300026121 Bacteria 1089
83 Ga0207683_11135150 3300026121 Bacteria 725
84 Ga0207698_10713295 3300026142 Bacteria 999
85 Ga0268266_10814899 3300028379 Bacteria 902
86 Ga0268265_10004868 3300028380 Bacteria 9254
87 Ga0268264_10670226 3300028381 Bacteria 1028
88 Ga0265323_10000021 3300028653 Bacteria 87631
89 Ga0265322_10172076 3300028654 Unclassified 620
90 Ga0265338_10023742 3300028800 Bacteria 6290
91 Ga0265330_10209320 3300031235 Unclassified 824
92 Ga0265316_10005104 3300031344 Bacteria 12865
93 Ga0265316_10005692 3300031344 Bacteria 12049
94 Ga0307513_10499254 3300031456 Bacteria 934
95 Ga0316583_10210040 3300032133 Bacteria 675
96 Ga0316593_10034640 3300032168 Bacteria 1657
97 Ga0307510_10278846 3300033180 Bacteria 1143
98 Ga0316596_1247149 3300033541 Bacteria 503
99 Ga0373926_0054573 3300035083 Bacteria 1448
100 Ga0373936_0026039 3300035113 Bacteria 2290
101 Ga0373956_0112445 3300035119 Bacteria 1268
102 Ga0373957_0453255 3300035120 Bacteria 555
103 Ga0373946_0053523 3300035171 Bacteria 1696
104 Ga0373955_0165426 3300035172 Bacteria 1307
105 Ga0373955_0319594 3300035172 Bacteria 938
106 Ga0373955_0848091 3300035172 Bacteria 562
107 Ga0373955_0964645 3300035172 Bacteria 525
108 Ga0373924_0026388 3300035410 Bacteria 2304
109 Ga0373924_0188658 3300035410 Bacteria 908
110 Ga0373935_0056083 3300035692 Bacteria 2511
111 Ga0373935_0092084 3300035692 Bacteria 1986
112 Ga0373927_0149251 3300035695 Bacteria 1531
113 Ga0373933_0062848 3300035724 Bacteria 2243
114 Ga0373933_0176153 3300035724 Bacteria 1362
115 Ga0373947_0101193 3300035725 Bacteria 1811
116 Ga0373947_0258418 3300035725 Bacteria 1153
117 Ga0373947_0319196 3300035725 Bacteria 1039
118 Ga0373947_0413343 3300035725 Bacteria 911
119 Ga0373937_0003385 3300036401 Bacteria 13385
120 Ga0373937_0013290 3300036401 Bacteria 7251
121 Ga0373937_0025656 3300036401 Bacteria 5322
122 Ga0373937_0494925 3300036401 Bacteria 1161
123 Ga0373925_0034027 3300037068 Bacteria 3756
124 Ga0373925_0106764 3300037068 Bacteria 2159
125 Ga0373925_0367823 3300037068 Bacteria 1169
126 Ga0436364_0000925 3300037853 Bacteria 1952
127 Ga0436364_0177761 3300037853 Bacteria 1851
128 Ga0436364_0586931 3300037853 Bacteria 20819
129 Ga0436364_0889300 3300037853 Bacteria 29470
130 Ga0436364_0916429 3300037853 Bacteria 1890
131 Ga0436364_1208690 3300037853 Bacteria 2703
132 Ga0436364_1343969 3300037853 Bacteria 2940
133 Ga0395901_1114893 3300038443 Bacteria 759
134 Ga0400483_027776 3300039062 Bacteria 4862
135 Ga0400483_110357 3300039062 Bacteria 1227
136 Ga0400483_236952 3300039062 Bacteria 2817
137 Ga0436365_0017363 3300039437 Bacteria 1189
138 Ga0436365_0294586 3300039437 Bacteria 870
139 Ga0436365_0401213 3300039437 Bacteria 906
140 Ga0436365_0445440 3300039437 Bacteria 748
141 Ga0436360_0104063 3300039438 Bacteria 2111
142 Ga0436360_0532029 3300039438 Bacteria 9001
143 Ga0436360_0661503 3300039438 Bacteria 515
144 Ga0436360_0673666 3300039438 Bacteria 1725
145 Ga0436360_0694697 3300039438 Bacteria 1303
146 Ga0436360_0724514 3300039438 Bacteria 683
147 Ga0436360_0869334 3300039438 Bacteria 1084
148 Ga0436360_0940096 3300039438 Bacteria 2235
149 Ga0436360_1215704 3300039438 Bacteria 1167
150 Ga0436360_1219275 3300039438 Bacteria 791
151 Ga0436361_0752992 3300039447 Bacteria 1006
152 Ga0436363_0214820 3300039450 Bacteria 1109
153 Ga0436363_0269741 3300039450 Bacteria 703
154 Ga0436363_1699186 3300039450 Bacteria 1233
155 Ga0436362_0073904 3300039453 Bacteria 678
156 Ga0436362_1270356 3300039453 Bacteria 4228
157 Ga0451791_1198215 3300041451 Bacteria 690
158 Ga0453684_0028835 3300044712 Bacteria 7902
159 Ga0453684_0152896 3300044712 Bacteria 2740
160 Ga0453684_0602675 3300044712 Bacteria 1204
161 Ga0453684_1032006 3300044712 Bacteria 873
162 Ga0466968_0164930 3300044735 Bacteria 1024
163 Ga0466957_1009261 3300044842 Bacteria 598
164 Ga0451576_0014804 3300045051 Bacteria 8669
165 Ga0466958_0415874 3300045836 Bacteria 869
166 Ga0466967_0878972 3300045976 Bacteria 891
167 Ga0495592_0028572 3300046454 Bacteria 4224
168 Ga0495629_0165653 3300046459 Bacteria 1535
169 Ga0495629_0450804 3300046459 Bacteria 871
170 Ga0495629_0749793 3300046459 Bacteria 646
171 Ga0495651_0012362 3300046462 Bacteria 6580
172 Ga0495662_0278223 3300046476 Bacteria 824
173 Ga0495664_0010085 3300046477 Bacteria 5299
174 Ga0495664_0214430 3300046477 Bacteria 1166
175 Ga0495664_0429863 3300046477 Bacteria 792
176 Ga0495608_0216627 3300046511 Bacteria 1202
177 Ga0495608_0272607 3300046511 Bacteria 1052
178 Ga0495618_0031077 3300046514 Bacteria 3339
179 Ga0495628_0020102 3300046516 Bacteria 5511
180 Ga0495628_0186076 3300046516 Bacteria 1569
181 Ga0495630_0037943 3300046517 Bacteria 3603
182 Ga0495652_0028225 3300046529 Bacteria 4940
183 Ga0495640_0082309 3300046533 Bacteria 2138
184 Ga0495640_0162628 3300046533 Bacteria 1429
185 Ga0495640_0444950 3300046533 Bacteria 792
186 Ga0495640_0615011 3300046533 Bacteria 655
187 Ga0495645_0009755 3300046543 Bacteria 6718
188 Ga0495645_0173244 3300046543 Bacteria 1484
189 Ga0495667_0093193 3300046559 Bacteria 1950
190 Ga0495667_0132698 3300046559 Bacteria 1606
191 Ga0495625_0414564 3300046660 Bacteria 839
192 Ga0495635_0043510 3300046663 Bacteria 3099
193 Ga0495635_0581456 3300046663 Bacteria 732
194 Ga0495599_0085805 3300046678 Bacteria 1966
195 Ga0495599_0149941 3300046678 Bacteria 1444
196 Ga0495599_0303664 3300046678 Bacteria 963
197 Ga0495623_0066255 3300046679 Bacteria 2257
198 Ga0495646_0197904 3300046680 Bacteria 1096
199 Ga0495646_0518007 3300046680 Bacteria 611
200 Ga0495600_0133893 3300046809 Bacteria 1610
201 Ga0495604_0174986 3300047317 Bacteria 1506
202 Ga0495674_0076687 3300047319 Bacteria 2875
203 Ga0495680_0043905 3300047322 Bacteria 3537
204 Ga0495680_0061283 3300047322 Bacteria 2895
205 Ga0495675_0426136 3300047444 Bacteria 770
206 Ga0495684_0102295 3300047471 Bacteria 2166
207 Ga0495684_0117994 3300047471 Bacteria 2000
208 Ga0495684_0322523 3300047471 Bacteria 1104
209 Ga0495684_0494205 3300047471 Bacteria 842
210 Ga0495684_0716335 3300047471 Bacteria 662
211 Ga0495686_0318489 3300047472 Bacteria 853
212 Ga0495593_0097725 3300047673 Bacteria 1508
213 Ga0495602_0003840 3300048088 Bacteria 15633
214 Ga0495602_0138725 3300048088 Bacteria 1928
215 Ga0495602_0147568 3300048088 Bacteria 1853
216 Ga0495602_0739338 3300048088 Bacteria 665
217 Ga0496112_1269851 3300048915 Bacteria 652
218 Ga0496126_0266443 3300048929 Bacteria 1423
219 Ga0501306_057800 3300049127 Bacteria 634
220 Ga0501310_007728 3300049130 Bacteria 1154
221 Ga0501305_022812 3300049161 Bacteria 933
222 Ga0501307_015867 3300049162 Bacteria 934
223 Ga0501312_068143 3300049528 Bacteria 627
224 Ga0501312_109225 3300049528 Bacteria 526
225 Ga0501313_047860 3300049529 Bacteria 586
226 Ga0501314_045165 3300049530 Bacteria 522
227 Ga0501315_017006 3300049531 Bacteria 946
228 Ga0501319_015687 3300049535 Bacteria 645
229 Ga0501323_013796 3300049539 Bacteria 1004
230 Ga0501324_010802 3300049540 Bacteria 836
231 Ga0501325_045863 3300049541 Bacteria 544
232 Ga0501039_0166379 3300049575 Bacteria 1733
233 Ga0501048_0085562 3300049582 Bacteria 2224
234 Ga0501076_0674317 3300049592 Bacteria 853
235 Ga0501280_019686 3300049776 Bacteria 996
236 Ga0501035_1142238 3300049822 Bacteria 607
237 Ga0495601_0009530 3300053077 Bacteria 5748
238 Ga0495612_0008929 3300053078 Bacteria 4062
239 Ga0495612_0309603 3300053078 Bacteria 709
240 Ga0495595_0030391 3300053084 Bacteria 2423
241 Ga0495619_0113538 3300053085 Bacteria 1853
242 Ga0495619_0265101 3300053085 Bacteria 1190
243 Ga0495619_0288741 3300053085 Bacteria 1136
244 Ga0500578_0004852 3300053086 Bacteria 9308
245 Ga0500643_026768 3300053087 Bacteria 1800
246 Ga0500646_0006416 3300053090 Bacteria 2991
247 Ga0500583_0210537 3300053092 Bacteria 965
248 Ga0500651_0195070 3300053093 Bacteria 1197
249 Ga0500562_036207 3300053108 Bacteria 1308
250 Ga0500642_0000985 3300053130 Bacteria 8179
251 Ga0500568_0009965 3300053139 Bacteria 4483
252 Ga0500588_0280886 3300053146 Bacteria 628
253 Ga0500609_006982 3300053731 Bacteria 1528
254 Ga0500599_010995 3300053736 Bacteria 1201
255 Ga0587085_066823 3300059506 Bacteria 694
256 Ga0587128_102311 3300059630 Bacteria 602
257 Ga0501082_1077920 3300060353 Bacteria 702

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0602675 Ga0453684_0602675_508_963 126
2 3300005937 Ga0081455_10170238 Ga0081455_101702382 144
3 3300044735 Ga0466968_0164930 Ga0466968_0164930_45_479 144
4 3300045836 Ga0466958_0415874 Ga0466958_0415874_266_733 144
5 3300021441 Ga0213871_10023198 Ga0213871_100231983 145
6 3300039438 Ga0436360_0673666 Ga0436360_0673666_1012_1476 145
7 3300039438 Ga0436360_0940096 Ga0436360_0940096_191_655 145
8 3300028653 Ga0265323_10000021 Ga0265323_1000002124 147
9 3300028654 Ga0265322_10172076 Ga0265322_101720761 147
10 3300031235 Ga0265330_10209320 Ga0265330_102093201 147
11 3300031344 Ga0265316_10005104 Ga0265316_1000510413 147
12 3300031344 Ga0265316_10005692 Ga0265316_100056921 147
13 3300044712 Ga0453684_0028835 Ga0453684_0028835_5170_5625 147
14 3300044712 Ga0453684_1032006 Ga0453684_1032006_284_739 147
15 3300039438 Ga0436360_1215704 Ga0436360_1215704_613_1134 148
16 3300039447 Ga0436361_0752992 Ga0436361_0752992_126_590 148
17 iso_pu_bacteria 2840878972 2840881063 148
18 iso_pu_bacteria 2713897090 2715501417 149
19 iso_pu_bacteria 2854681122 2854682876 149
20 iso_pu_bacteria 2898795034 2898797140 149
21 iso_pu_bacteria 2899259804 2899262258 149
22 iso_pu_bacteria 2899275550 2899276213 149
23 iso_pu_bacteria 2919679072 2919682461 149
24 iso_pu_bacteria 3000017691 3000020267 149
25 iso_pu_bacteria 3000405567 3000409176 149
26 iso_pu_bacteria 8057132660 8057134952 149
27 3300032133 Ga0316583_10210040 Ga0316583_102100401 152
28 3300032168 Ga0316593_10034640 Ga0316593_100346403 152
29 3300033541 Ga0316596_1247149 Ga0316596_12471491 152
30 3300039062 Ga0400483_027776 Ga0400483_027776_4060_4518 152
31 3300039062 Ga0400483_110357 Ga0400483_110357_199_657 152
32 3300039062 Ga0400483_236952 Ga0400483_236952_891_1352 152
33 3300049130 Ga0501310_007728 Ga0501310_007728_658_1119 152
34 3300049161 Ga0501305_022812 Ga0501305_022812_446_907 152
35 3300049162 Ga0501307_015867 Ga0501307_015867_440_901 152
36 3300049528 Ga0501312_068143 Ga0501312_068143_37_498 152
37 3300049528 Ga0501312_109225 Ga0501312_109225_34_495 152
38 3300049530 Ga0501314_045165 Ga0501314_045165_44_505 152
39 3300049531 Ga0501315_017006 Ga0501315_017006_459_920 152
40 3300049535 Ga0501319_015687 Ga0501319_015687_162_623 152
41 3300049539 Ga0501323_013796 Ga0501323_013796_517_978 152
42 3300049540 Ga0501324_010802 Ga0501324_010802_33_494 152
43 3300049541 Ga0501325_045863 Ga0501325_045863_26_487 152
44 3300005544 Ga0070686_100154034 Ga0070686_1001540343 153
45 3300013306 Ga0163162_11404502 Ga0163162_114045021 153
46 3300025942 Ga0207689_10646917 Ga0207689_106469171 153
47 3300025961 Ga0207712_10345681 Ga0207712_103456811 153
48 3300028381 Ga0268264_10670226 Ga0268264_106702262 153
49 3300031456 Ga0307513_10499254 Ga0307513_104992541 153
50 3300039438 Ga0436360_0694697 Ga0436360_0694697_752_1216 153
51 3300039438 Ga0436360_1219275 Ga0436360_1219275_60_521 153
52 3300041451 Ga0451791_1198215 Ga0451791_1198215_171_632 153
53 3300044842 Ga0466957_1009261 Ga0466957_1009261_81_545 153
54 3300045051 Ga0451576_0014804 Ga0451576_0014804_4045_4509 153
55 3300049127 Ga0501306_057800 Ga0501306_057800_32_505 153
56 3300049529 Ga0501313_047860 Ga0501313_047860_36_500 153
57 3300049575 Ga0501039_0166379 Ga0501039_0166379_1257_1718 153
58 3300049582 Ga0501048_0085562 Ga0501048_0085562_1128_1589 153
59 3300049592 Ga0501076_0674317 Ga0501076_0674317_240_701 153
60 3300049776 Ga0501280_019686 Ga0501280_019686_146_610 153
61 3300060353 Ga0501082_1077920 Ga0501082_1077920_98_559 153
62 3300005367 Ga0070667_101649160 Ga0070667_1016491601 154
63 3300005434 Ga0070709_10023675 Ga0070709_100236753 154
64 3300005435 Ga0070714_100085583 Ga0070714_1000855831 154
65 3300005436 Ga0070713_100003594 Ga0070713_1000035942 154
66 3300005436 Ga0070713_100039290 Ga0070713_1000392902 154
67 3300005436 Ga0070713_100136939 Ga0070713_1001369392 154
68 3300005437 Ga0070710_10394687 Ga0070710_103946871 154
69 3300005439 Ga0070711_100023767 Ga0070711_1000237672 154
70 3300005439 Ga0070711_100696800 Ga0070711_1006968001 154
71 3300005458 Ga0070681_10693405 Ga0070681_106934052 154
72 3300005535 Ga0070684_100613563 Ga0070684_1006135632 154
73 3300005535 Ga0070684_100912577 Ga0070684_1009125772 154
74 3300005548 Ga0070665_100908480 Ga0070665_1009084801 154
75 3300005564 Ga0070664_100248397 Ga0070664_1002483972 154
76 3300005614 Ga0068856_100277188 Ga0068856_1002771882 154
77 3300005614 Ga0068856_100367300 Ga0068856_1003673001 154
78 3300005614 Ga0068856_100521108 Ga0068856_1005211082 154
79 3300005616 Ga0068852_100206332 Ga0068852_1002063323 154
80 3300005844 Ga0068862_100019286 Ga0068862_1000192865 154
81 3300006028 Ga0070717_10038424 Ga0070717_100384244 154
82 3300006175 Ga0070712_100029453 Ga0070712_1000294533 154
83 3300006175 Ga0070712_100224079 Ga0070712_1002240792 154
84 3300009093 Ga0105240_11534625 Ga0105240_115346251 154
85 3300009094 Ga0111539_11373789 Ga0111539_113737891 154
86 3300009098 Ga0105245_10034590 Ga0105245_100345905 154
87 3300009101 Ga0105247_10694793 Ga0105247_106947931 154
88 3300009551 Ga0105238_10690016 Ga0105238_106900161 154
89 3300009553 Ga0105249_11986913 Ga0105249_119869132 154
90 3300011119 Ga0105246_10502084 Ga0105246_105020842 154
91 3300013104 Ga0157370_10794606 Ga0157370_107946062 154
92 3300013105 Ga0157369_10163094 Ga0157369_101630943 154
93 3300013296 Ga0157374_10144301 Ga0157374_101443012 154
94 3300013296 Ga0157374_10575306 Ga0157374_105753062 154
95 3300013296 Ga0157374_12422189 Ga0157374_124221891 154
96 3300013306 Ga0163162_10797183 Ga0163162_107971832 154
97 3300014325 Ga0163163_10561778 Ga0163163_105617782 154
98 3300014497 Ga0182008_10131759 Ga0182008_101317591 154
99 3300014497 Ga0182008_10405626 Ga0182008_104056262 154
100 3300014968 Ga0157379_11485507 Ga0157379_114855071 154
101 3300014969 Ga0157376_10554359 Ga0157376_105543592 154
102 3300014969 Ga0157376_11435758 Ga0157376_114357582 154
103 3300020076 Ga0206355_1557341 Ga0206355_15573411 154
104 3300020077 Ga0206351_10132956 Ga0206351_101329562 154
105 3300021377 Ga0213874_10101073 Ga0213874_101010732 154
106 3300021388 Ga0213875_10003035 Ga0213875_100030352 154
107 3300021388 Ga0213875_10012317 Ga0213875_100123172 154
108 3300021388 Ga0213875_10032225 Ga0213875_100322254 154
109 3300021388 Ga0213875_10050340 Ga0213875_100503403 154
110 3300021441 Ga0213871_10051987 Ga0213871_100519872 154
111 3300021441 Ga0213871_10082254 Ga0213871_100822542 154
112 3300022467 Ga0224712_10113877 Ga0224712_101138771 154
113 3300025302 Ga0207426_1016533 Ga0207426_10165334 154
114 3300025898 Ga0207692_10241180 Ga0207692_102411802 154
115 3300025906 Ga0207699_10034616 Ga0207699_100346162 154
116 3300025912 Ga0207707_10981187 Ga0207707_109811872 154
117 3300025915 Ga0207693_10008362 Ga0207693_100083628 154
118 3300025915 Ga0207693_10196640 Ga0207693_101966402 154
119 3300025916 Ga0207663_10062477 Ga0207663_100624772 154
120 3300025916 Ga0207663_10592383 Ga0207663_105923831 154
121 3300025924 Ga0207694_10485260 Ga0207694_104852602 154
122 3300025927 Ga0207687_10034753 Ga0207687_100347534 154
123 3300025928 Ga0207700_10008369 Ga0207700_100083699 154
124 3300025928 Ga0207700_10055090 Ga0207700_100550902 154
125 3300025928 Ga0207700_10188262 Ga0207700_101882621 154
126 3300025928 Ga0207700_11382361 Ga0207700_113823611 154
127 3300025929 Ga0207664_10233728 Ga0207664_102337282 154
128 3300025929 Ga0207664_10473070 Ga0207664_104730702 154
129 3300025934 Ga0207686_10181967 Ga0207686_101819672 154
130 3300025944 Ga0207661_10561448 Ga0207661_105614481 154
131 3300025945 Ga0207679_10634864 Ga0207679_106348642 154
132 3300026023 Ga0207677_10313801 Ga0207677_103138012 154
133 3300026035 Ga0207703_11366834 Ga0207703_113668342 154
134 3300026078 Ga0207702_10643064 Ga0207702_106430642 154
135 3300026078 Ga0207702_10886664 Ga0207702_108866642 154
136 3300026121 Ga0207683_10525971 Ga0207683_105259712 154
137 3300026121 Ga0207683_10530024 Ga0207683_105300242 154
138 3300026121 Ga0207683_11135150 Ga0207683_111351502 154
139 3300026142 Ga0207698_10713295 Ga0207698_107132952 154
140 3300028379 Ga0268266_10814899 Ga0268266_108148992 154
141 3300028380 Ga0268265_10004868 Ga0268265_100048682 154
142 3300028800 Ga0265338_10023742 Ga0265338_100237426 154
143 3300033180 Ga0307510_10278846 Ga0307510_102788462 154
144 3300035083 Ga0373926_0054573 Ga0373926_0054573_100_564 154
145 3300035113 Ga0373936_0026039 Ga0373936_0026039_468_935 154
146 3300035119 Ga0373956_0112445 Ga0373956_0112445_617_1084 154
147 3300035120 Ga0373957_0453255 Ga0373957_0453255_24_488 154
148 3300035171 Ga0373946_0053523 Ga0373946_0053523_644_1108 154
149 3300035172 Ga0373955_0165426 Ga0373955_0165426_26_490 154
150 3300035172 Ga0373955_0319594 Ga0373955_0319594_62_526 154
151 3300035172 Ga0373955_0848091 Ga0373955_0848091_44_511 154
152 3300035172 Ga0373955_0964645 Ga0373955_0964645_11_478 154
153 3300035410 Ga0373924_0026388 Ga0373924_0026388_433_897 154
154 3300035410 Ga0373924_0188658 Ga0373924_0188658_148_612 154
155 3300035692 Ga0373935_0056083 Ga0373935_0056083_1226_1693 154
156 3300035692 Ga0373935_0092084 Ga0373935_0092084_1365_1829 154
157 3300035695 Ga0373927_0149251 Ga0373927_0149251_157_624 154
158 3300035724 Ga0373933_0062848 Ga0373933_0062848_560_1027 154
159 3300035724 Ga0373933_0176153 Ga0373933_0176153_491_955 154
160 3300035725 Ga0373947_0101193 Ga0373947_0101193_170_634 154
161 3300035725 Ga0373947_0258418 Ga0373947_0258418_148_615 154
162 3300035725 Ga0373947_0319196 Ga0373947_0319196_452_922 154
163 3300035725 Ga0373947_0413343 Ga0373947_0413343_23_490 154
164 3300036401 Ga0373937_0003385 Ga0373937_0003385_601_1065 154
165 3300036401 Ga0373937_0013290 Ga0373937_0013290_4537_5001 154
166 3300036401 Ga0373937_0025656 Ga0373937_0025656_4575_5042 154
167 3300036401 Ga0373937_0494925 Ga0373937_0494925_365_829 154
168 3300037068 Ga0373925_0034027 Ga0373925_0034027_1953_2420 154
169 3300037068 Ga0373925_0106764 Ga0373925_0106764_26_490 154
170 3300037068 Ga0373925_0367823 Ga0373925_0367823_65_529 154
171 3300037853 Ga0436364_0000925 Ga0436364_0000925_1096_1560 154
172 3300037853 Ga0436364_0177761 Ga0436364_0177761_1052_1516 154
173 3300037853 Ga0436364_0586931 Ga0436364_0586931_11558_12022 154
174 3300037853 Ga0436364_0889300 Ga0436364_0889300_23376_23843 154
175 3300037853 Ga0436364_0916429 Ga0436364_0916429_266_730 154
176 3300037853 Ga0436364_1208690 Ga0436364_1208690_1855_2319 154
177 3300037853 Ga0436364_1343969 Ga0436364_1343969_422_889 154
178 3300038443 Ga0395901_1114893 Ga0395901_1114893_258_725 154
179 3300039437 Ga0436365_0017363 Ga0436365_0017363_156_620 154
180 3300039437 Ga0436365_0294586 Ga0436365_0294586_277_795 154
181 3300039437 Ga0436365_0401213 Ga0436365_0401213_55_519 154
182 3300039437 Ga0436365_0445440 Ga0436365_0445440_116_580 154
183 3300039438 Ga0436360_0104063 Ga0436360_0104063_601_1065 154
184 3300039438 Ga0436360_0532029 Ga0436360_0532029_4187_4654 154
185 3300039438 Ga0436360_0661503 Ga0436360_0661503_17_481 154
186 3300039438 Ga0436360_0724514 Ga0436360_0724514_203_667 154
187 3300039438 Ga0436360_0869334 Ga0436360_0869334_286_753 154
188 3300039450 Ga0436363_0214820 Ga0436363_0214820_167_631 154
189 3300039450 Ga0436363_0269741 Ga0436363_0269741_27_491 154
190 3300039450 Ga0436363_1699186 Ga0436363_1699186_531_998 154
191 3300039453 Ga0436362_0073904 Ga0436362_0073904_22_486 154
192 3300039453 Ga0436362_1270356 Ga0436362_1270356_904_1368 154
193 3300044712 Ga0453684_0152896 Ga0453684_0152896_313_777 154
194 3300045976 Ga0466967_0878972 Ga0466967_0878972_331_825 154
195 3300046454 Ga0495592_0028572 Ga0495592_0028572_3496_3963 154
196 3300046459 Ga0495629_0165653 Ga0495629_0165653_873_1337 154
197 3300046459 Ga0495629_0450804 Ga0495629_0450804_165_632 154
198 3300046459 Ga0495629_0749793 Ga0495629_0749793_20_484 154
199 3300046462 Ga0495651_0012362 Ga0495651_0012362_6036_6503 154
200 3300046476 Ga0495662_0278223 Ga0495662_0278223_107_577 154
201 3300046477 Ga0495664_0010085 Ga0495664_0010085_4536_5000 154
202 3300046477 Ga0495664_0214430 Ga0495664_0214430_228_695 154
203 3300046477 Ga0495664_0429863 Ga0495664_0429863_87_554 154
204 3300046511 Ga0495608_0216627 Ga0495608_0216627_433_897 154
205 3300046511 Ga0495608_0272607 Ga0495608_0272607_394_864 154
206 3300046514 Ga0495618_0031077 Ga0495618_0031077_674_1138 154
207 3300046516 Ga0495628_0020102 Ga0495628_0020102_291_755 154
208 3300046516 Ga0495628_0186076 Ga0495628_0186076_614_1081 154
209 3300046517 Ga0495630_0037943 Ga0495630_0037943_1864_2331 154
210 3300046529 Ga0495652_0028225 Ga0495652_0028225_230_694 154
211 3300046533 Ga0495640_0082309 Ga0495640_0082309_1084_1548 154
212 3300046533 Ga0495640_0162628 Ga0495640_0162628_803_1270 154
213 3300046533 Ga0495640_0444950 Ga0495640_0444950_254_718 154
214 3300046533 Ga0495640_0615011 Ga0495640_0615011_172_639 154
215 3300046543 Ga0495645_0009755 Ga0495645_0009755_4396_4860 154
216 3300046543 Ga0495645_0173244 Ga0495645_0173244_935_1402 154
217 3300046559 Ga0495667_0093193 Ga0495667_0093193_829_1293 154
218 3300046559 Ga0495667_0132698 Ga0495667_0132698_13_480 154
219 3300046660 Ga0495625_0414564 Ga0495625_0414564_128_601 154
220 3300046663 Ga0495635_0043510 Ga0495635_0043510_2522_2986 154
221 3300046663 Ga0495635_0581456 Ga0495635_0581456_198_665 154
222 3300046678 Ga0495599_0085805 Ga0495599_0085805_459_926 154
223 3300046678 Ga0495599_0149941 Ga0495599_0149941_898_1362 154
224 3300046678 Ga0495599_0303664 Ga0495599_0303664_40_504 154
225 3300046679 Ga0495623_0066255 Ga0495623_0066255_1219_1683 154
226 3300046680 Ga0495646_0197904 Ga0495646_0197904_200_664 154
227 3300046680 Ga0495646_0518007 Ga0495646_0518007_26_493 154
228 3300046809 Ga0495600_0133893 Ga0495600_0133893_164_631 154
229 3300047317 Ga0495604_0174986 Ga0495604_0174986_622_1089 154
230 3300047319 Ga0495674_0076687 Ga0495674_0076687_1653_2120 154
231 3300047322 Ga0495680_0043905 Ga0495680_0043905_1664_2131 154
232 3300047322 Ga0495680_0061283 Ga0495680_0061283_772_1236 154
233 3300047444 Ga0495675_0426136 Ga0495675_0426136_241_705 154
234 3300047471 Ga0495684_0102295 Ga0495684_0102295_987_1454 154
235 3300047471 Ga0495684_0117994 Ga0495684_0117994_686_1150 154
236 3300047471 Ga0495684_0322523 Ga0495684_0322523_475_939 154
237 3300047471 Ga0495684_0494205 Ga0495684_0494205_39_506 154
238 3300047471 Ga0495684_0716335 Ga0495684_0716335_31_501 154
239 3300047472 Ga0495686_0318489 Ga0495686_0318489_215_688 154
240 3300047673 Ga0495593_0097725 Ga0495593_0097725_933_1397 154
241 3300048088 Ga0495602_0003840 Ga0495602_0003840_13057_13521 154
242 3300048088 Ga0495602_0138725 Ga0495602_0138725_1057_1524 154
243 3300048088 Ga0495602_0147568 Ga0495602_0147568_1196_1660 154
244 3300048088 Ga0495602_0739338 Ga0495602_0739338_165_632 154
245 3300048915 Ga0496112_1269851 Ga0496112_1269851_92_586 154
246 3300048929 Ga0496126_0266443 Ga0496126_0266443_135_602 154
247 3300049822 Ga0501035_1142238 Ga0501035_1142238_121_588 154
248 3300053077 Ga0495601_0009530 Ga0495601_0009530_4639_5103 154
249 3300053078 Ga0495612_0008929 Ga0495612_0008929_1213_1677 154
250 3300053078 Ga0495612_0309603 Ga0495612_0309603_208_675 154
251 3300053084 Ga0495595_0030391 Ga0495595_0030391_773_1237 154
252 3300053085 Ga0495619_0113538 Ga0495619_0113538_810_1277 154
253 3300053085 Ga0495619_0265101 Ga0495619_0265101_330_794 154
254 3300053085 Ga0495619_0288741 Ga0495619_0288741_430_894 154
255 3300053086 Ga0500578_0004852 Ga0500578_0004852_8732_9205 154
256 3300053087 Ga0500643_026768 Ga0500643_026768_1014_1487 154
257 3300053090 Ga0500646_0006416 Ga0500646_0006416_1790_2263 154
258 3300053092 Ga0500583_0210537 Ga0500583_0210537_299_772 154
259 3300053093 Ga0500651_0195070 Ga0500651_0195070_403_876 154
260 3300053108 Ga0500562_036207 Ga0500562_036207_746_1219 154
261 3300053130 Ga0500642_0000985 Ga0500642_0000985_2428_2901 154
262 3300053139 Ga0500568_0009965 Ga0500568_0009965_1520_1993 154
263 3300053146 Ga0500588_0280886 Ga0500588_0280886_63_536 154
264 3300053731 Ga0500609_006982 Ga0500609_006982_414_887 154
265 3300053736 Ga0500599_010995 Ga0500599_010995_663_1136 154
266 3300059506 Ga0587085_066823 Ga0587085_066823_155_622 154
267 3300059630 Ga0587128_102311 Ga0587128_102311_123_590 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

40

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9698 5 142
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9557 1 144
8c99-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.9554 1 144
8cvm-assembly1.cif.gz_i cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9545 3 144
7mt7-assembly1.cif.gz_J mtb 70s with p and e site trnas 0.9529 5 144
ID Description Score Start End Superfamily
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.964 13 142 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9632 13 142 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.938 1 144 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9316 1 144 3.90.1180.10
af_O96222_56_212_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9306 10 142 3.90.1180.10
ID Description Score Start End GO Terms
AF-Q1MIP2-F1-model_v4 Large ribosomal subunit protein uL13 (50S ribosomal protein L13) 0.9855 6 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1Q7BZ54-F1-model_v4 50S ribosomal protein L13 0.9847 16 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A380TAC6-F1-model_v4 50S ribosomal subunit protein L13 0.9839 5 153 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1Y2K1C2-F1-model_v4 Large ribosomal subunit protein uL13 0.9829 6 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1G2WUJ1-F1-model_v4 deleted 0.9806 20 154

Feature Viewer

pLDDT pTM Quality
91.47 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map