F374639
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 173 | 257 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100248397|Ga0070664_1002483972 |
| Length | 180 |
| Sequence | MIPQAENLDPVRVSSHMPPPNRGTTSMKSTLSLKPAEVKKDWVLIDAEGVVLGRLASVIANRLRGKHKPQFTPHVDCGDNVVVVNAAKLRVTGKKPDQSVFYYHTGYPGGIKGRSIRQRMEGKHPESVLEKAVERMITRGPLQRRQMKHLYVYAGPEHKHAAQQPVPLDIAAMNPKNKRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 2 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 3 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 4 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 5 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 6 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 7 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 8 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 9 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 40 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 43 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 45 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 46 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 47 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 72 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 73 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 75 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 77 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 78 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 80 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 82 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 83 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 84 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 85 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 86 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 87 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 88 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 89 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 90 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 91 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 92 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 95 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 96 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 97 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 98 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 99 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 100 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 101 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 102 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 103 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 104 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 105 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 106 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 107 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 108 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 109 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 154 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 160 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 161 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 162 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 163 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 164 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 165 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 166 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 167 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 168 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 169 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 170 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.76 |
| Metatranscriptomes | 7.49 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.49 |
| Nodule | 0.37 |
| Rhizoplane | 0.75 |
| Rhizosphere | 84.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070667_101649160 | 3300005367 | Bacteria | 603 |
| 2 | Ga0070709_10023675 | 3300005434 | Bacteria | 3610 |
| 3 | Ga0070714_100085583 | 3300005435 | Bacteria | 2754 |
| 4 | Ga0070713_100003594 | 3300005436 | Bacteria | 10246 |
| 5 | Ga0070713_100039290 | 3300005436 | Bacteria | 3840 |
| 6 | Ga0070713_100136939 | 3300005436 | Bacteria | 2165 |
| 7 | Ga0070710_10394687 | 3300005437 | Bacteria | 926 |
| 8 | Ga0070711_100023767 | 3300005439 | Bacteria | 3991 |
| 9 | Ga0070711_100696800 | 3300005439 | Bacteria | 855 |
| 10 | Ga0070681_10693405 | 3300005458 | Bacteria | 934 |
| 11 | Ga0070684_100613563 | 3300005535 | Bacteria | 1012 |
| 12 | Ga0070684_100912577 | 3300005535 | Bacteria | 823 |
| 13 | Ga0070686_100154034 | 3300005544 | Bacteria | 1612 |
| 14 | Ga0070665_100908480 | 3300005548 | Bacteria | 893 |
| 15 | Ga0070664_100248397 | 3300005564 | Bacteria | 1599 |
| 16 | Ga0068856_100277188 | 3300005614 | Bacteria | 1693 |
| 17 | Ga0068856_100367300 | 3300005614 | Bacteria | 1458 |
| 18 | Ga0068856_100521108 | 3300005614 | Bacteria | 1210 |
| 19 | Ga0068852_100206332 | 3300005616 | Bacteria | 1862 |
| 20 | Ga0068862_100019286 | 3300005844 | Bacteria | 5690 |
| 21 | Ga0081455_10170238 | 3300005937 | Bacteria | 1660 |
| 22 | Ga0070717_10038424 | 3300006028 | Bacteria | 3891 |
| 23 | Ga0070712_100029453 | 3300006175 | Bacteria | 3680 |
| 24 | Ga0070712_100224079 | 3300006175 | Bacteria | 1490 |
| 25 | Ga0105240_11534625 | 3300009093 | Bacteria | 698 |
| 26 | Ga0111539_11373789 | 3300009094 | Bacteria | 819 |
| 27 | Ga0105245_10034590 | 3300009098 | Bacteria | 4482 |
| 28 | Ga0105247_10694793 | 3300009101 | Unclassified | 765 |
| 29 | Ga0105238_10690016 | 3300009551 | Bacteria | 1033 |
| 30 | Ga0105249_11986913 | 3300009553 | Bacteria | 654 |
| 31 | Ga0105246_10502084 | 3300011119 | Bacteria | 1030 |
| 32 | Ga0157370_10794606 | 3300013104 | Bacteria | 861 |
| 33 | Ga0157369_10163094 | 3300013105 | Bacteria | 2352 |
| 34 | Ga0157374_10144301 | 3300013296 | Bacteria | 2312 |
| 35 | Ga0157374_10575306 | 3300013296 | Bacteria | 1135 |
| 36 | Ga0157374_12422189 | 3300013296 | Bacteria | 552 |
| 37 | Ga0163162_10797183 | 3300013306 | Bacteria | 1062 |
| 38 | Ga0163162_11404502 | 3300013306 | Bacteria | 794 |
| 39 | Ga0163163_10561778 | 3300014325 | Bacteria | 1204 |
| 40 | Ga0182008_10131759 | 3300014497 | Bacteria | 1246 |
| 41 | Ga0182008_10405626 | 3300014497 | Bacteria | 733 |
| 42 | Ga0157379_11485507 | 3300014968 | Bacteria | 659 |
| 43 | Ga0157376_10554359 | 3300014969 | Bacteria | 1138 |
| 44 | Ga0157376_11435758 | 3300014969 | Bacteria | 722 |
| 45 | Ga0206355_1557341 | 3300020076 | Bacteria | 611 |
| 46 | Ga0206351_10132956 | 3300020077 | Bacteria | 1346 |
| 47 | Ga0213874_10101073 | 3300021377 | Bacteria | 958 |
| 48 | Ga0213875_10003035 | 3300021388 | Bacteria | 9735 |
| 49 | Ga0213875_10012317 | 3300021388 | Bacteria | 4229 |
| 50 | Ga0213875_10032225 | 3300021388 | Bacteria | 2477 |
| 51 | Ga0213875_10050340 | 3300021388 | Bacteria | 1952 |
| 52 | Ga0213871_10023198 | 3300021441 | Bacteria | 1561 |
| 53 | Ga0213871_10051987 | 3300021441 | Bacteria | 1125 |
| 54 | Ga0213871_10082254 | 3300021441 | Bacteria | 924 |
| 55 | Ga0224712_10113877 | 3300022467 | Bacteria | 1163 |
| 56 | Ga0207426_1016533 | 3300025302 | Bacteria | 2646 |
| 57 | Ga0207692_10241180 | 3300025898 | Bacteria | 1080 |
| 58 | Ga0207699_10034616 | 3300025906 | Bacteria | 2867 |
| 59 | Ga0207707_10981187 | 3300025912 | Bacteria | 694 |
| 60 | Ga0207693_10008362 | 3300025915 | Bacteria | 8468 |
| 61 | Ga0207693_10196640 | 3300025915 | Bacteria | 1586 |
| 62 | Ga0207663_10062477 | 3300025916 | Bacteria | 2368 |
| 63 | Ga0207663_10592383 | 3300025916 | Bacteria | 870 |
| 64 | Ga0207694_10485260 | 3300025924 | Unclassified | 1034 |
| 65 | Ga0207687_10034753 | 3300025927 | Bacteria | 3424 |
| 66 | Ga0207700_10008369 | 3300025928 | Bacteria | 6403 |
| 67 | Ga0207700_10055090 | 3300025928 | Bacteria | 2988 |
| 68 | Ga0207700_10188262 | 3300025928 | Bacteria | 1733 |
| 69 | Ga0207700_11382361 | 3300025928 | Bacteria | 626 |
| 70 | Ga0207664_10233728 | 3300025929 | Bacteria | 1598 |
| 71 | Ga0207664_10473070 | 3300025929 | Bacteria | 1120 |
| 72 | Ga0207686_10181967 | 3300025934 | Bacteria | 1491 |
| 73 | Ga0207689_10646917 | 3300025942 | Bacteria | 890 |
| 74 | Ga0207661_10561448 | 3300025944 | Bacteria | 1046 |
| 75 | Ga0207679_10634864 | 3300025945 | Bacteria | 965 |
| 76 | Ga0207712_10345681 | 3300025961 | Bacteria | 1235 |
| 77 | Ga0207677_10313801 | 3300026023 | Bacteria | 1300 |
| 78 | Ga0207703_11366834 | 3300026035 | Bacteria | 681 |
| 79 | Ga0207702_10643064 | 3300026078 | Bacteria | 1043 |
| 80 | Ga0207702_10886664 | 3300026078 | Bacteria | 884 |
| 81 | Ga0207683_10525971 | 3300026121 | Bacteria | 1093 |
| 82 | Ga0207683_10530024 | 3300026121 | Bacteria | 1089 |
| 83 | Ga0207683_11135150 | 3300026121 | Bacteria | 725 |
| 84 | Ga0207698_10713295 | 3300026142 | Bacteria | 999 |
| 85 | Ga0268266_10814899 | 3300028379 | Bacteria | 902 |
| 86 | Ga0268265_10004868 | 3300028380 | Bacteria | 9254 |
| 87 | Ga0268264_10670226 | 3300028381 | Bacteria | 1028 |
| 88 | Ga0265323_10000021 | 3300028653 | Bacteria | 87631 |
| 89 | Ga0265322_10172076 | 3300028654 | Unclassified | 620 |
| 90 | Ga0265338_10023742 | 3300028800 | Bacteria | 6290 |
| 91 | Ga0265330_10209320 | 3300031235 | Unclassified | 824 |
| 92 | Ga0265316_10005104 | 3300031344 | Bacteria | 12865 |
| 93 | Ga0265316_10005692 | 3300031344 | Bacteria | 12049 |
| 94 | Ga0307513_10499254 | 3300031456 | Bacteria | 934 |
| 95 | Ga0316583_10210040 | 3300032133 | Bacteria | 675 |
| 96 | Ga0316593_10034640 | 3300032168 | Bacteria | 1657 |
| 97 | Ga0307510_10278846 | 3300033180 | Bacteria | 1143 |
| 98 | Ga0316596_1247149 | 3300033541 | Bacteria | 503 |
| 99 | Ga0373926_0054573 | 3300035083 | Bacteria | 1448 |
| 100 | Ga0373936_0026039 | 3300035113 | Bacteria | 2290 |
| 101 | Ga0373956_0112445 | 3300035119 | Bacteria | 1268 |
| 102 | Ga0373957_0453255 | 3300035120 | Bacteria | 555 |
| 103 | Ga0373946_0053523 | 3300035171 | Bacteria | 1696 |
| 104 | Ga0373955_0165426 | 3300035172 | Bacteria | 1307 |
| 105 | Ga0373955_0319594 | 3300035172 | Bacteria | 938 |
| 106 | Ga0373955_0848091 | 3300035172 | Bacteria | 562 |
| 107 | Ga0373955_0964645 | 3300035172 | Bacteria | 525 |
| 108 | Ga0373924_0026388 | 3300035410 | Bacteria | 2304 |
| 109 | Ga0373924_0188658 | 3300035410 | Bacteria | 908 |
| 110 | Ga0373935_0056083 | 3300035692 | Bacteria | 2511 |
| 111 | Ga0373935_0092084 | 3300035692 | Bacteria | 1986 |
| 112 | Ga0373927_0149251 | 3300035695 | Bacteria | 1531 |
| 113 | Ga0373933_0062848 | 3300035724 | Bacteria | 2243 |
| 114 | Ga0373933_0176153 | 3300035724 | Bacteria | 1362 |
| 115 | Ga0373947_0101193 | 3300035725 | Bacteria | 1811 |
| 116 | Ga0373947_0258418 | 3300035725 | Bacteria | 1153 |
| 117 | Ga0373947_0319196 | 3300035725 | Bacteria | 1039 |
| 118 | Ga0373947_0413343 | 3300035725 | Bacteria | 911 |
| 119 | Ga0373937_0003385 | 3300036401 | Bacteria | 13385 |
| 120 | Ga0373937_0013290 | 3300036401 | Bacteria | 7251 |
| 121 | Ga0373937_0025656 | 3300036401 | Bacteria | 5322 |
| 122 | Ga0373937_0494925 | 3300036401 | Bacteria | 1161 |
| 123 | Ga0373925_0034027 | 3300037068 | Bacteria | 3756 |
| 124 | Ga0373925_0106764 | 3300037068 | Bacteria | 2159 |
| 125 | Ga0373925_0367823 | 3300037068 | Bacteria | 1169 |
| 126 | Ga0436364_0000925 | 3300037853 | Bacteria | 1952 |
| 127 | Ga0436364_0177761 | 3300037853 | Bacteria | 1851 |
| 128 | Ga0436364_0586931 | 3300037853 | Bacteria | 20819 |
| 129 | Ga0436364_0889300 | 3300037853 | Bacteria | 29470 |
| 130 | Ga0436364_0916429 | 3300037853 | Bacteria | 1890 |
| 131 | Ga0436364_1208690 | 3300037853 | Bacteria | 2703 |
| 132 | Ga0436364_1343969 | 3300037853 | Bacteria | 2940 |
| 133 | Ga0395901_1114893 | 3300038443 | Bacteria | 759 |
| 134 | Ga0400483_027776 | 3300039062 | Bacteria | 4862 |
| 135 | Ga0400483_110357 | 3300039062 | Bacteria | 1227 |
| 136 | Ga0400483_236952 | 3300039062 | Bacteria | 2817 |
| 137 | Ga0436365_0017363 | 3300039437 | Bacteria | 1189 |
| 138 | Ga0436365_0294586 | 3300039437 | Bacteria | 870 |
| 139 | Ga0436365_0401213 | 3300039437 | Bacteria | 906 |
| 140 | Ga0436365_0445440 | 3300039437 | Bacteria | 748 |
| 141 | Ga0436360_0104063 | 3300039438 | Bacteria | 2111 |
| 142 | Ga0436360_0532029 | 3300039438 | Bacteria | 9001 |
| 143 | Ga0436360_0661503 | 3300039438 | Bacteria | 515 |
| 144 | Ga0436360_0673666 | 3300039438 | Bacteria | 1725 |
| 145 | Ga0436360_0694697 | 3300039438 | Bacteria | 1303 |
| 146 | Ga0436360_0724514 | 3300039438 | Bacteria | 683 |
| 147 | Ga0436360_0869334 | 3300039438 | Bacteria | 1084 |
| 148 | Ga0436360_0940096 | 3300039438 | Bacteria | 2235 |
| 149 | Ga0436360_1215704 | 3300039438 | Bacteria | 1167 |
| 150 | Ga0436360_1219275 | 3300039438 | Bacteria | 791 |
| 151 | Ga0436361_0752992 | 3300039447 | Bacteria | 1006 |
| 152 | Ga0436363_0214820 | 3300039450 | Bacteria | 1109 |
| 153 | Ga0436363_0269741 | 3300039450 | Bacteria | 703 |
| 154 | Ga0436363_1699186 | 3300039450 | Bacteria | 1233 |
| 155 | Ga0436362_0073904 | 3300039453 | Bacteria | 678 |
| 156 | Ga0436362_1270356 | 3300039453 | Bacteria | 4228 |
| 157 | Ga0451791_1198215 | 3300041451 | Bacteria | 690 |
| 158 | Ga0453684_0028835 | 3300044712 | Bacteria | 7902 |
| 159 | Ga0453684_0152896 | 3300044712 | Bacteria | 2740 |
| 160 | Ga0453684_0602675 | 3300044712 | Bacteria | 1204 |
| 161 | Ga0453684_1032006 | 3300044712 | Bacteria | 873 |
| 162 | Ga0466968_0164930 | 3300044735 | Bacteria | 1024 |
| 163 | Ga0466957_1009261 | 3300044842 | Bacteria | 598 |
| 164 | Ga0451576_0014804 | 3300045051 | Bacteria | 8669 |
| 165 | Ga0466958_0415874 | 3300045836 | Bacteria | 869 |
| 166 | Ga0466967_0878972 | 3300045976 | Bacteria | 891 |
| 167 | Ga0495592_0028572 | 3300046454 | Bacteria | 4224 |
| 168 | Ga0495629_0165653 | 3300046459 | Bacteria | 1535 |
| 169 | Ga0495629_0450804 | 3300046459 | Bacteria | 871 |
| 170 | Ga0495629_0749793 | 3300046459 | Bacteria | 646 |
| 171 | Ga0495651_0012362 | 3300046462 | Bacteria | 6580 |
| 172 | Ga0495662_0278223 | 3300046476 | Bacteria | 824 |
| 173 | Ga0495664_0010085 | 3300046477 | Bacteria | 5299 |
| 174 | Ga0495664_0214430 | 3300046477 | Bacteria | 1166 |
| 175 | Ga0495664_0429863 | 3300046477 | Bacteria | 792 |
| 176 | Ga0495608_0216627 | 3300046511 | Bacteria | 1202 |
| 177 | Ga0495608_0272607 | 3300046511 | Bacteria | 1052 |
| 178 | Ga0495618_0031077 | 3300046514 | Bacteria | 3339 |
| 179 | Ga0495628_0020102 | 3300046516 | Bacteria | 5511 |
| 180 | Ga0495628_0186076 | 3300046516 | Bacteria | 1569 |
| 181 | Ga0495630_0037943 | 3300046517 | Bacteria | 3603 |
| 182 | Ga0495652_0028225 | 3300046529 | Bacteria | 4940 |
| 183 | Ga0495640_0082309 | 3300046533 | Bacteria | 2138 |
| 184 | Ga0495640_0162628 | 3300046533 | Bacteria | 1429 |
| 185 | Ga0495640_0444950 | 3300046533 | Bacteria | 792 |
| 186 | Ga0495640_0615011 | 3300046533 | Bacteria | 655 |
| 187 | Ga0495645_0009755 | 3300046543 | Bacteria | 6718 |
| 188 | Ga0495645_0173244 | 3300046543 | Bacteria | 1484 |
| 189 | Ga0495667_0093193 | 3300046559 | Bacteria | 1950 |
| 190 | Ga0495667_0132698 | 3300046559 | Bacteria | 1606 |
| 191 | Ga0495625_0414564 | 3300046660 | Bacteria | 839 |
| 192 | Ga0495635_0043510 | 3300046663 | Bacteria | 3099 |
| 193 | Ga0495635_0581456 | 3300046663 | Bacteria | 732 |
| 194 | Ga0495599_0085805 | 3300046678 | Bacteria | 1966 |
| 195 | Ga0495599_0149941 | 3300046678 | Bacteria | 1444 |
| 196 | Ga0495599_0303664 | 3300046678 | Bacteria | 963 |
| 197 | Ga0495623_0066255 | 3300046679 | Bacteria | 2257 |
| 198 | Ga0495646_0197904 | 3300046680 | Bacteria | 1096 |
| 199 | Ga0495646_0518007 | 3300046680 | Bacteria | 611 |
| 200 | Ga0495600_0133893 | 3300046809 | Bacteria | 1610 |
| 201 | Ga0495604_0174986 | 3300047317 | Bacteria | 1506 |
| 202 | Ga0495674_0076687 | 3300047319 | Bacteria | 2875 |
| 203 | Ga0495680_0043905 | 3300047322 | Bacteria | 3537 |
| 204 | Ga0495680_0061283 | 3300047322 | Bacteria | 2895 |
| 205 | Ga0495675_0426136 | 3300047444 | Bacteria | 770 |
| 206 | Ga0495684_0102295 | 3300047471 | Bacteria | 2166 |
| 207 | Ga0495684_0117994 | 3300047471 | Bacteria | 2000 |
| 208 | Ga0495684_0322523 | 3300047471 | Bacteria | 1104 |
| 209 | Ga0495684_0494205 | 3300047471 | Bacteria | 842 |
| 210 | Ga0495684_0716335 | 3300047471 | Bacteria | 662 |
| 211 | Ga0495686_0318489 | 3300047472 | Bacteria | 853 |
| 212 | Ga0495593_0097725 | 3300047673 | Bacteria | 1508 |
| 213 | Ga0495602_0003840 | 3300048088 | Bacteria | 15633 |
| 214 | Ga0495602_0138725 | 3300048088 | Bacteria | 1928 |
| 215 | Ga0495602_0147568 | 3300048088 | Bacteria | 1853 |
| 216 | Ga0495602_0739338 | 3300048088 | Bacteria | 665 |
| 217 | Ga0496112_1269851 | 3300048915 | Bacteria | 652 |
| 218 | Ga0496126_0266443 | 3300048929 | Bacteria | 1423 |
| 219 | Ga0501306_057800 | 3300049127 | Bacteria | 634 |
| 220 | Ga0501310_007728 | 3300049130 | Bacteria | 1154 |
| 221 | Ga0501305_022812 | 3300049161 | Bacteria | 933 |
| 222 | Ga0501307_015867 | 3300049162 | Bacteria | 934 |
| 223 | Ga0501312_068143 | 3300049528 | Bacteria | 627 |
| 224 | Ga0501312_109225 | 3300049528 | Bacteria | 526 |
| 225 | Ga0501313_047860 | 3300049529 | Bacteria | 586 |
| 226 | Ga0501314_045165 | 3300049530 | Bacteria | 522 |
| 227 | Ga0501315_017006 | 3300049531 | Bacteria | 946 |
| 228 | Ga0501319_015687 | 3300049535 | Bacteria | 645 |
| 229 | Ga0501323_013796 | 3300049539 | Bacteria | 1004 |
| 230 | Ga0501324_010802 | 3300049540 | Bacteria | 836 |
| 231 | Ga0501325_045863 | 3300049541 | Bacteria | 544 |
| 232 | Ga0501039_0166379 | 3300049575 | Bacteria | 1733 |
| 233 | Ga0501048_0085562 | 3300049582 | Bacteria | 2224 |
| 234 | Ga0501076_0674317 | 3300049592 | Bacteria | 853 |
| 235 | Ga0501280_019686 | 3300049776 | Bacteria | 996 |
| 236 | Ga0501035_1142238 | 3300049822 | Bacteria | 607 |
| 237 | Ga0495601_0009530 | 3300053077 | Bacteria | 5748 |
| 238 | Ga0495612_0008929 | 3300053078 | Bacteria | 4062 |
| 239 | Ga0495612_0309603 | 3300053078 | Bacteria | 709 |
| 240 | Ga0495595_0030391 | 3300053084 | Bacteria | 2423 |
| 241 | Ga0495619_0113538 | 3300053085 | Bacteria | 1853 |
| 242 | Ga0495619_0265101 | 3300053085 | Bacteria | 1190 |
| 243 | Ga0495619_0288741 | 3300053085 | Bacteria | 1136 |
| 244 | Ga0500578_0004852 | 3300053086 | Bacteria | 9308 |
| 245 | Ga0500643_026768 | 3300053087 | Bacteria | 1800 |
| 246 | Ga0500646_0006416 | 3300053090 | Bacteria | 2991 |
| 247 | Ga0500583_0210537 | 3300053092 | Bacteria | 965 |
| 248 | Ga0500651_0195070 | 3300053093 | Bacteria | 1197 |
| 249 | Ga0500562_036207 | 3300053108 | Bacteria | 1308 |
| 250 | Ga0500642_0000985 | 3300053130 | Bacteria | 8179 |
| 251 | Ga0500568_0009965 | 3300053139 | Bacteria | 4483 |
| 252 | Ga0500588_0280886 | 3300053146 | Bacteria | 628 |
| 253 | Ga0500609_006982 | 3300053731 | Bacteria | 1528 |
| 254 | Ga0500599_010995 | 3300053736 | Bacteria | 1201 |
| 255 | Ga0587085_066823 | 3300059506 | Bacteria | 694 |
| 256 | Ga0587128_102311 | 3300059630 | Bacteria | 602 |
| 257 | Ga0501082_1077920 | 3300060353 | Bacteria | 702 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0602675 | Ga0453684_0602675_508_963 | 126 |
| 2 | 3300005937 | Ga0081455_10170238 | Ga0081455_101702382 | 144 |
| 3 | 3300044735 | Ga0466968_0164930 | Ga0466968_0164930_45_479 | 144 |
| 4 | 3300045836 | Ga0466958_0415874 | Ga0466958_0415874_266_733 | 144 |
| 5 | 3300021441 | Ga0213871_10023198 | Ga0213871_100231983 | 145 |
| 6 | 3300039438 | Ga0436360_0673666 | Ga0436360_0673666_1012_1476 | 145 |
| 7 | 3300039438 | Ga0436360_0940096 | Ga0436360_0940096_191_655 | 145 |
| 8 | 3300028653 | Ga0265323_10000021 | Ga0265323_1000002124 | 147 |
| 9 | 3300028654 | Ga0265322_10172076 | Ga0265322_101720761 | 147 |
| 10 | 3300031235 | Ga0265330_10209320 | Ga0265330_102093201 | 147 |
| 11 | 3300031344 | Ga0265316_10005104 | Ga0265316_1000510413 | 147 |
| 12 | 3300031344 | Ga0265316_10005692 | Ga0265316_100056921 | 147 |
| 13 | 3300044712 | Ga0453684_0028835 | Ga0453684_0028835_5170_5625 | 147 |
| 14 | 3300044712 | Ga0453684_1032006 | Ga0453684_1032006_284_739 | 147 |
| 15 | 3300039438 | Ga0436360_1215704 | Ga0436360_1215704_613_1134 | 148 |
| 16 | 3300039447 | Ga0436361_0752992 | Ga0436361_0752992_126_590 | 148 |
| 17 | iso_pu_bacteria | 2840878972 | 2840881063 | 148 |
| 18 | iso_pu_bacteria | 2713897090 | 2715501417 | 149 |
| 19 | iso_pu_bacteria | 2854681122 | 2854682876 | 149 |
| 20 | iso_pu_bacteria | 2898795034 | 2898797140 | 149 |
| 21 | iso_pu_bacteria | 2899259804 | 2899262258 | 149 |
| 22 | iso_pu_bacteria | 2899275550 | 2899276213 | 149 |
| 23 | iso_pu_bacteria | 2919679072 | 2919682461 | 149 |
| 24 | iso_pu_bacteria | 3000017691 | 3000020267 | 149 |
| 25 | iso_pu_bacteria | 3000405567 | 3000409176 | 149 |
| 26 | iso_pu_bacteria | 8057132660 | 8057134952 | 149 |
| 27 | 3300032133 | Ga0316583_10210040 | Ga0316583_102100401 | 152 |
| 28 | 3300032168 | Ga0316593_10034640 | Ga0316593_100346403 | 152 |
| 29 | 3300033541 | Ga0316596_1247149 | Ga0316596_12471491 | 152 |
| 30 | 3300039062 | Ga0400483_027776 | Ga0400483_027776_4060_4518 | 152 |
| 31 | 3300039062 | Ga0400483_110357 | Ga0400483_110357_199_657 | 152 |
| 32 | 3300039062 | Ga0400483_236952 | Ga0400483_236952_891_1352 | 152 |
| 33 | 3300049130 | Ga0501310_007728 | Ga0501310_007728_658_1119 | 152 |
| 34 | 3300049161 | Ga0501305_022812 | Ga0501305_022812_446_907 | 152 |
| 35 | 3300049162 | Ga0501307_015867 | Ga0501307_015867_440_901 | 152 |
| 36 | 3300049528 | Ga0501312_068143 | Ga0501312_068143_37_498 | 152 |
| 37 | 3300049528 | Ga0501312_109225 | Ga0501312_109225_34_495 | 152 |
| 38 | 3300049530 | Ga0501314_045165 | Ga0501314_045165_44_505 | 152 |
| 39 | 3300049531 | Ga0501315_017006 | Ga0501315_017006_459_920 | 152 |
| 40 | 3300049535 | Ga0501319_015687 | Ga0501319_015687_162_623 | 152 |
| 41 | 3300049539 | Ga0501323_013796 | Ga0501323_013796_517_978 | 152 |
| 42 | 3300049540 | Ga0501324_010802 | Ga0501324_010802_33_494 | 152 |
| 43 | 3300049541 | Ga0501325_045863 | Ga0501325_045863_26_487 | 152 |
| 44 | 3300005544 | Ga0070686_100154034 | Ga0070686_1001540343 | 153 |
| 45 | 3300013306 | Ga0163162_11404502 | Ga0163162_114045021 | 153 |
| 46 | 3300025942 | Ga0207689_10646917 | Ga0207689_106469171 | 153 |
| 47 | 3300025961 | Ga0207712_10345681 | Ga0207712_103456811 | 153 |
| 48 | 3300028381 | Ga0268264_10670226 | Ga0268264_106702262 | 153 |
| 49 | 3300031456 | Ga0307513_10499254 | Ga0307513_104992541 | 153 |
| 50 | 3300039438 | Ga0436360_0694697 | Ga0436360_0694697_752_1216 | 153 |
| 51 | 3300039438 | Ga0436360_1219275 | Ga0436360_1219275_60_521 | 153 |
| 52 | 3300041451 | Ga0451791_1198215 | Ga0451791_1198215_171_632 | 153 |
| 53 | 3300044842 | Ga0466957_1009261 | Ga0466957_1009261_81_545 | 153 |
| 54 | 3300045051 | Ga0451576_0014804 | Ga0451576_0014804_4045_4509 | 153 |
| 55 | 3300049127 | Ga0501306_057800 | Ga0501306_057800_32_505 | 153 |
| 56 | 3300049529 | Ga0501313_047860 | Ga0501313_047860_36_500 | 153 |
| 57 | 3300049575 | Ga0501039_0166379 | Ga0501039_0166379_1257_1718 | 153 |
| 58 | 3300049582 | Ga0501048_0085562 | Ga0501048_0085562_1128_1589 | 153 |
| 59 | 3300049592 | Ga0501076_0674317 | Ga0501076_0674317_240_701 | 153 |
| 60 | 3300049776 | Ga0501280_019686 | Ga0501280_019686_146_610 | 153 |
| 61 | 3300060353 | Ga0501082_1077920 | Ga0501082_1077920_98_559 | 153 |
| 62 | 3300005367 | Ga0070667_101649160 | Ga0070667_1016491601 | 154 |
| 63 | 3300005434 | Ga0070709_10023675 | Ga0070709_100236753 | 154 |
| 64 | 3300005435 | Ga0070714_100085583 | Ga0070714_1000855831 | 154 |
| 65 | 3300005436 | Ga0070713_100003594 | Ga0070713_1000035942 | 154 |
| 66 | 3300005436 | Ga0070713_100039290 | Ga0070713_1000392902 | 154 |
| 67 | 3300005436 | Ga0070713_100136939 | Ga0070713_1001369392 | 154 |
| 68 | 3300005437 | Ga0070710_10394687 | Ga0070710_103946871 | 154 |
| 69 | 3300005439 | Ga0070711_100023767 | Ga0070711_1000237672 | 154 |
| 70 | 3300005439 | Ga0070711_100696800 | Ga0070711_1006968001 | 154 |
| 71 | 3300005458 | Ga0070681_10693405 | Ga0070681_106934052 | 154 |
| 72 | 3300005535 | Ga0070684_100613563 | Ga0070684_1006135632 | 154 |
| 73 | 3300005535 | Ga0070684_100912577 | Ga0070684_1009125772 | 154 |
| 74 | 3300005548 | Ga0070665_100908480 | Ga0070665_1009084801 | 154 |
| 75 | 3300005564 | Ga0070664_100248397 | Ga0070664_1002483972 | 154 |
| 76 | 3300005614 | Ga0068856_100277188 | Ga0068856_1002771882 | 154 |
| 77 | 3300005614 | Ga0068856_100367300 | Ga0068856_1003673001 | 154 |
| 78 | 3300005614 | Ga0068856_100521108 | Ga0068856_1005211082 | 154 |
| 79 | 3300005616 | Ga0068852_100206332 | Ga0068852_1002063323 | 154 |
| 80 | 3300005844 | Ga0068862_100019286 | Ga0068862_1000192865 | 154 |
| 81 | 3300006028 | Ga0070717_10038424 | Ga0070717_100384244 | 154 |
| 82 | 3300006175 | Ga0070712_100029453 | Ga0070712_1000294533 | 154 |
| 83 | 3300006175 | Ga0070712_100224079 | Ga0070712_1002240792 | 154 |
| 84 | 3300009093 | Ga0105240_11534625 | Ga0105240_115346251 | 154 |
| 85 | 3300009094 | Ga0111539_11373789 | Ga0111539_113737891 | 154 |
| 86 | 3300009098 | Ga0105245_10034590 | Ga0105245_100345905 | 154 |
| 87 | 3300009101 | Ga0105247_10694793 | Ga0105247_106947931 | 154 |
| 88 | 3300009551 | Ga0105238_10690016 | Ga0105238_106900161 | 154 |
| 89 | 3300009553 | Ga0105249_11986913 | Ga0105249_119869132 | 154 |
| 90 | 3300011119 | Ga0105246_10502084 | Ga0105246_105020842 | 154 |
| 91 | 3300013104 | Ga0157370_10794606 | Ga0157370_107946062 | 154 |
| 92 | 3300013105 | Ga0157369_10163094 | Ga0157369_101630943 | 154 |
| 93 | 3300013296 | Ga0157374_10144301 | Ga0157374_101443012 | 154 |
| 94 | 3300013296 | Ga0157374_10575306 | Ga0157374_105753062 | 154 |
| 95 | 3300013296 | Ga0157374_12422189 | Ga0157374_124221891 | 154 |
| 96 | 3300013306 | Ga0163162_10797183 | Ga0163162_107971832 | 154 |
| 97 | 3300014325 | Ga0163163_10561778 | Ga0163163_105617782 | 154 |
| 98 | 3300014497 | Ga0182008_10131759 | Ga0182008_101317591 | 154 |
| 99 | 3300014497 | Ga0182008_10405626 | Ga0182008_104056262 | 154 |
| 100 | 3300014968 | Ga0157379_11485507 | Ga0157379_114855071 | 154 |
| 101 | 3300014969 | Ga0157376_10554359 | Ga0157376_105543592 | 154 |
| 102 | 3300014969 | Ga0157376_11435758 | Ga0157376_114357582 | 154 |
| 103 | 3300020076 | Ga0206355_1557341 | Ga0206355_15573411 | 154 |
| 104 | 3300020077 | Ga0206351_10132956 | Ga0206351_101329562 | 154 |
| 105 | 3300021377 | Ga0213874_10101073 | Ga0213874_101010732 | 154 |
| 106 | 3300021388 | Ga0213875_10003035 | Ga0213875_100030352 | 154 |
| 107 | 3300021388 | Ga0213875_10012317 | Ga0213875_100123172 | 154 |
| 108 | 3300021388 | Ga0213875_10032225 | Ga0213875_100322254 | 154 |
| 109 | 3300021388 | Ga0213875_10050340 | Ga0213875_100503403 | 154 |
| 110 | 3300021441 | Ga0213871_10051987 | Ga0213871_100519872 | 154 |
| 111 | 3300021441 | Ga0213871_10082254 | Ga0213871_100822542 | 154 |
| 112 | 3300022467 | Ga0224712_10113877 | Ga0224712_101138771 | 154 |
| 113 | 3300025302 | Ga0207426_1016533 | Ga0207426_10165334 | 154 |
| 114 | 3300025898 | Ga0207692_10241180 | Ga0207692_102411802 | 154 |
| 115 | 3300025906 | Ga0207699_10034616 | Ga0207699_100346162 | 154 |
| 116 | 3300025912 | Ga0207707_10981187 | Ga0207707_109811872 | 154 |
| 117 | 3300025915 | Ga0207693_10008362 | Ga0207693_100083628 | 154 |
| 118 | 3300025915 | Ga0207693_10196640 | Ga0207693_101966402 | 154 |
| 119 | 3300025916 | Ga0207663_10062477 | Ga0207663_100624772 | 154 |
| 120 | 3300025916 | Ga0207663_10592383 | Ga0207663_105923831 | 154 |
| 121 | 3300025924 | Ga0207694_10485260 | Ga0207694_104852602 | 154 |
| 122 | 3300025927 | Ga0207687_10034753 | Ga0207687_100347534 | 154 |
| 123 | 3300025928 | Ga0207700_10008369 | Ga0207700_100083699 | 154 |
| 124 | 3300025928 | Ga0207700_10055090 | Ga0207700_100550902 | 154 |
| 125 | 3300025928 | Ga0207700_10188262 | Ga0207700_101882621 | 154 |
| 126 | 3300025928 | Ga0207700_11382361 | Ga0207700_113823611 | 154 |
| 127 | 3300025929 | Ga0207664_10233728 | Ga0207664_102337282 | 154 |
| 128 | 3300025929 | Ga0207664_10473070 | Ga0207664_104730702 | 154 |
| 129 | 3300025934 | Ga0207686_10181967 | Ga0207686_101819672 | 154 |
| 130 | 3300025944 | Ga0207661_10561448 | Ga0207661_105614481 | 154 |
| 131 | 3300025945 | Ga0207679_10634864 | Ga0207679_106348642 | 154 |
| 132 | 3300026023 | Ga0207677_10313801 | Ga0207677_103138012 | 154 |
| 133 | 3300026035 | Ga0207703_11366834 | Ga0207703_113668342 | 154 |
| 134 | 3300026078 | Ga0207702_10643064 | Ga0207702_106430642 | 154 |
| 135 | 3300026078 | Ga0207702_10886664 | Ga0207702_108866642 | 154 |
| 136 | 3300026121 | Ga0207683_10525971 | Ga0207683_105259712 | 154 |
| 137 | 3300026121 | Ga0207683_10530024 | Ga0207683_105300242 | 154 |
| 138 | 3300026121 | Ga0207683_11135150 | Ga0207683_111351502 | 154 |
| 139 | 3300026142 | Ga0207698_10713295 | Ga0207698_107132952 | 154 |
| 140 | 3300028379 | Ga0268266_10814899 | Ga0268266_108148992 | 154 |
| 141 | 3300028380 | Ga0268265_10004868 | Ga0268265_100048682 | 154 |
| 142 | 3300028800 | Ga0265338_10023742 | Ga0265338_100237426 | 154 |
| 143 | 3300033180 | Ga0307510_10278846 | Ga0307510_102788462 | 154 |
| 144 | 3300035083 | Ga0373926_0054573 | Ga0373926_0054573_100_564 | 154 |
| 145 | 3300035113 | Ga0373936_0026039 | Ga0373936_0026039_468_935 | 154 |
| 146 | 3300035119 | Ga0373956_0112445 | Ga0373956_0112445_617_1084 | 154 |
| 147 | 3300035120 | Ga0373957_0453255 | Ga0373957_0453255_24_488 | 154 |
| 148 | 3300035171 | Ga0373946_0053523 | Ga0373946_0053523_644_1108 | 154 |
| 149 | 3300035172 | Ga0373955_0165426 | Ga0373955_0165426_26_490 | 154 |
| 150 | 3300035172 | Ga0373955_0319594 | Ga0373955_0319594_62_526 | 154 |
| 151 | 3300035172 | Ga0373955_0848091 | Ga0373955_0848091_44_511 | 154 |
| 152 | 3300035172 | Ga0373955_0964645 | Ga0373955_0964645_11_478 | 154 |
| 153 | 3300035410 | Ga0373924_0026388 | Ga0373924_0026388_433_897 | 154 |
| 154 | 3300035410 | Ga0373924_0188658 | Ga0373924_0188658_148_612 | 154 |
| 155 | 3300035692 | Ga0373935_0056083 | Ga0373935_0056083_1226_1693 | 154 |
| 156 | 3300035692 | Ga0373935_0092084 | Ga0373935_0092084_1365_1829 | 154 |
| 157 | 3300035695 | Ga0373927_0149251 | Ga0373927_0149251_157_624 | 154 |
| 158 | 3300035724 | Ga0373933_0062848 | Ga0373933_0062848_560_1027 | 154 |
| 159 | 3300035724 | Ga0373933_0176153 | Ga0373933_0176153_491_955 | 154 |
| 160 | 3300035725 | Ga0373947_0101193 | Ga0373947_0101193_170_634 | 154 |
| 161 | 3300035725 | Ga0373947_0258418 | Ga0373947_0258418_148_615 | 154 |
| 162 | 3300035725 | Ga0373947_0319196 | Ga0373947_0319196_452_922 | 154 |
| 163 | 3300035725 | Ga0373947_0413343 | Ga0373947_0413343_23_490 | 154 |
| 164 | 3300036401 | Ga0373937_0003385 | Ga0373937_0003385_601_1065 | 154 |
| 165 | 3300036401 | Ga0373937_0013290 | Ga0373937_0013290_4537_5001 | 154 |
| 166 | 3300036401 | Ga0373937_0025656 | Ga0373937_0025656_4575_5042 | 154 |
| 167 | 3300036401 | Ga0373937_0494925 | Ga0373937_0494925_365_829 | 154 |
| 168 | 3300037068 | Ga0373925_0034027 | Ga0373925_0034027_1953_2420 | 154 |
| 169 | 3300037068 | Ga0373925_0106764 | Ga0373925_0106764_26_490 | 154 |
| 170 | 3300037068 | Ga0373925_0367823 | Ga0373925_0367823_65_529 | 154 |
| 171 | 3300037853 | Ga0436364_0000925 | Ga0436364_0000925_1096_1560 | 154 |
| 172 | 3300037853 | Ga0436364_0177761 | Ga0436364_0177761_1052_1516 | 154 |
| 173 | 3300037853 | Ga0436364_0586931 | Ga0436364_0586931_11558_12022 | 154 |
| 174 | 3300037853 | Ga0436364_0889300 | Ga0436364_0889300_23376_23843 | 154 |
| 175 | 3300037853 | Ga0436364_0916429 | Ga0436364_0916429_266_730 | 154 |
| 176 | 3300037853 | Ga0436364_1208690 | Ga0436364_1208690_1855_2319 | 154 |
| 177 | 3300037853 | Ga0436364_1343969 | Ga0436364_1343969_422_889 | 154 |
| 178 | 3300038443 | Ga0395901_1114893 | Ga0395901_1114893_258_725 | 154 |
| 179 | 3300039437 | Ga0436365_0017363 | Ga0436365_0017363_156_620 | 154 |
| 180 | 3300039437 | Ga0436365_0294586 | Ga0436365_0294586_277_795 | 154 |
| 181 | 3300039437 | Ga0436365_0401213 | Ga0436365_0401213_55_519 | 154 |
| 182 | 3300039437 | Ga0436365_0445440 | Ga0436365_0445440_116_580 | 154 |
| 183 | 3300039438 | Ga0436360_0104063 | Ga0436360_0104063_601_1065 | 154 |
| 184 | 3300039438 | Ga0436360_0532029 | Ga0436360_0532029_4187_4654 | 154 |
| 185 | 3300039438 | Ga0436360_0661503 | Ga0436360_0661503_17_481 | 154 |
| 186 | 3300039438 | Ga0436360_0724514 | Ga0436360_0724514_203_667 | 154 |
| 187 | 3300039438 | Ga0436360_0869334 | Ga0436360_0869334_286_753 | 154 |
| 188 | 3300039450 | Ga0436363_0214820 | Ga0436363_0214820_167_631 | 154 |
| 189 | 3300039450 | Ga0436363_0269741 | Ga0436363_0269741_27_491 | 154 |
| 190 | 3300039450 | Ga0436363_1699186 | Ga0436363_1699186_531_998 | 154 |
| 191 | 3300039453 | Ga0436362_0073904 | Ga0436362_0073904_22_486 | 154 |
| 192 | 3300039453 | Ga0436362_1270356 | Ga0436362_1270356_904_1368 | 154 |
| 193 | 3300044712 | Ga0453684_0152896 | Ga0453684_0152896_313_777 | 154 |
| 194 | 3300045976 | Ga0466967_0878972 | Ga0466967_0878972_331_825 | 154 |
| 195 | 3300046454 | Ga0495592_0028572 | Ga0495592_0028572_3496_3963 | 154 |
| 196 | 3300046459 | Ga0495629_0165653 | Ga0495629_0165653_873_1337 | 154 |
| 197 | 3300046459 | Ga0495629_0450804 | Ga0495629_0450804_165_632 | 154 |
| 198 | 3300046459 | Ga0495629_0749793 | Ga0495629_0749793_20_484 | 154 |
| 199 | 3300046462 | Ga0495651_0012362 | Ga0495651_0012362_6036_6503 | 154 |
| 200 | 3300046476 | Ga0495662_0278223 | Ga0495662_0278223_107_577 | 154 |
| 201 | 3300046477 | Ga0495664_0010085 | Ga0495664_0010085_4536_5000 | 154 |
| 202 | 3300046477 | Ga0495664_0214430 | Ga0495664_0214430_228_695 | 154 |
| 203 | 3300046477 | Ga0495664_0429863 | Ga0495664_0429863_87_554 | 154 |
| 204 | 3300046511 | Ga0495608_0216627 | Ga0495608_0216627_433_897 | 154 |
| 205 | 3300046511 | Ga0495608_0272607 | Ga0495608_0272607_394_864 | 154 |
| 206 | 3300046514 | Ga0495618_0031077 | Ga0495618_0031077_674_1138 | 154 |
| 207 | 3300046516 | Ga0495628_0020102 | Ga0495628_0020102_291_755 | 154 |
| 208 | 3300046516 | Ga0495628_0186076 | Ga0495628_0186076_614_1081 | 154 |
| 209 | 3300046517 | Ga0495630_0037943 | Ga0495630_0037943_1864_2331 | 154 |
| 210 | 3300046529 | Ga0495652_0028225 | Ga0495652_0028225_230_694 | 154 |
| 211 | 3300046533 | Ga0495640_0082309 | Ga0495640_0082309_1084_1548 | 154 |
| 212 | 3300046533 | Ga0495640_0162628 | Ga0495640_0162628_803_1270 | 154 |
| 213 | 3300046533 | Ga0495640_0444950 | Ga0495640_0444950_254_718 | 154 |
| 214 | 3300046533 | Ga0495640_0615011 | Ga0495640_0615011_172_639 | 154 |
| 215 | 3300046543 | Ga0495645_0009755 | Ga0495645_0009755_4396_4860 | 154 |
| 216 | 3300046543 | Ga0495645_0173244 | Ga0495645_0173244_935_1402 | 154 |
| 217 | 3300046559 | Ga0495667_0093193 | Ga0495667_0093193_829_1293 | 154 |
| 218 | 3300046559 | Ga0495667_0132698 | Ga0495667_0132698_13_480 | 154 |
| 219 | 3300046660 | Ga0495625_0414564 | Ga0495625_0414564_128_601 | 154 |
| 220 | 3300046663 | Ga0495635_0043510 | Ga0495635_0043510_2522_2986 | 154 |
| 221 | 3300046663 | Ga0495635_0581456 | Ga0495635_0581456_198_665 | 154 |
| 222 | 3300046678 | Ga0495599_0085805 | Ga0495599_0085805_459_926 | 154 |
| 223 | 3300046678 | Ga0495599_0149941 | Ga0495599_0149941_898_1362 | 154 |
| 224 | 3300046678 | Ga0495599_0303664 | Ga0495599_0303664_40_504 | 154 |
| 225 | 3300046679 | Ga0495623_0066255 | Ga0495623_0066255_1219_1683 | 154 |
| 226 | 3300046680 | Ga0495646_0197904 | Ga0495646_0197904_200_664 | 154 |
| 227 | 3300046680 | Ga0495646_0518007 | Ga0495646_0518007_26_493 | 154 |
| 228 | 3300046809 | Ga0495600_0133893 | Ga0495600_0133893_164_631 | 154 |
| 229 | 3300047317 | Ga0495604_0174986 | Ga0495604_0174986_622_1089 | 154 |
| 230 | 3300047319 | Ga0495674_0076687 | Ga0495674_0076687_1653_2120 | 154 |
| 231 | 3300047322 | Ga0495680_0043905 | Ga0495680_0043905_1664_2131 | 154 |
| 232 | 3300047322 | Ga0495680_0061283 | Ga0495680_0061283_772_1236 | 154 |
| 233 | 3300047444 | Ga0495675_0426136 | Ga0495675_0426136_241_705 | 154 |
| 234 | 3300047471 | Ga0495684_0102295 | Ga0495684_0102295_987_1454 | 154 |
| 235 | 3300047471 | Ga0495684_0117994 | Ga0495684_0117994_686_1150 | 154 |
| 236 | 3300047471 | Ga0495684_0322523 | Ga0495684_0322523_475_939 | 154 |
| 237 | 3300047471 | Ga0495684_0494205 | Ga0495684_0494205_39_506 | 154 |
| 238 | 3300047471 | Ga0495684_0716335 | Ga0495684_0716335_31_501 | 154 |
| 239 | 3300047472 | Ga0495686_0318489 | Ga0495686_0318489_215_688 | 154 |
| 240 | 3300047673 | Ga0495593_0097725 | Ga0495593_0097725_933_1397 | 154 |
| 241 | 3300048088 | Ga0495602_0003840 | Ga0495602_0003840_13057_13521 | 154 |
| 242 | 3300048088 | Ga0495602_0138725 | Ga0495602_0138725_1057_1524 | 154 |
| 243 | 3300048088 | Ga0495602_0147568 | Ga0495602_0147568_1196_1660 | 154 |
| 244 | 3300048088 | Ga0495602_0739338 | Ga0495602_0739338_165_632 | 154 |
| 245 | 3300048915 | Ga0496112_1269851 | Ga0496112_1269851_92_586 | 154 |
| 246 | 3300048929 | Ga0496126_0266443 | Ga0496126_0266443_135_602 | 154 |
| 247 | 3300049822 | Ga0501035_1142238 | Ga0501035_1142238_121_588 | 154 |
| 248 | 3300053077 | Ga0495601_0009530 | Ga0495601_0009530_4639_5103 | 154 |
| 249 | 3300053078 | Ga0495612_0008929 | Ga0495612_0008929_1213_1677 | 154 |
| 250 | 3300053078 | Ga0495612_0309603 | Ga0495612_0309603_208_675 | 154 |
| 251 | 3300053084 | Ga0495595_0030391 | Ga0495595_0030391_773_1237 | 154 |
| 252 | 3300053085 | Ga0495619_0113538 | Ga0495619_0113538_810_1277 | 154 |
| 253 | 3300053085 | Ga0495619_0265101 | Ga0495619_0265101_330_794 | 154 |
| 254 | 3300053085 | Ga0495619_0288741 | Ga0495619_0288741_430_894 | 154 |
| 255 | 3300053086 | Ga0500578_0004852 | Ga0500578_0004852_8732_9205 | 154 |
| 256 | 3300053087 | Ga0500643_026768 | Ga0500643_026768_1014_1487 | 154 |
| 257 | 3300053090 | Ga0500646_0006416 | Ga0500646_0006416_1790_2263 | 154 |
| 258 | 3300053092 | Ga0500583_0210537 | Ga0500583_0210537_299_772 | 154 |
| 259 | 3300053093 | Ga0500651_0195070 | Ga0500651_0195070_403_876 | 154 |
| 260 | 3300053108 | Ga0500562_036207 | Ga0500562_036207_746_1219 | 154 |
| 261 | 3300053130 | Ga0500642_0000985 | Ga0500642_0000985_2428_2901 | 154 |
| 262 | 3300053139 | Ga0500568_0009965 | Ga0500568_0009965_1520_1993 | 154 |
| 263 | 3300053146 | Ga0500588_0280886 | Ga0500588_0280886_63_536 | 154 |
| 264 | 3300053731 | Ga0500609_006982 | Ga0500609_006982_414_887 | 154 |
| 265 | 3300053736 | Ga0500599_010995 | Ga0500599_010995_663_1136 | 154 |
| 266 | 3300059506 | Ga0587085_066823 | Ga0587085_066823_155_622 | 154 |
| 267 | 3300059630 | Ga0587128_102311 | Ga0587128_102311_123_590 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6spb-assembly1.cif.gz_J | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9698 | 5 | 142 |
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9557 | 1 | 144 |
| 8c99-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.9554 | 1 | 144 |
| 8cvm-assembly1.cif.gz_i | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9545 | 3 | 144 |
| 7mt7-assembly1.cif.gz_J | mtb 70s with p and e site trnas | 0.9529 | 5 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.964 | 13 | 142 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9632 | 13 | 142 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.938 | 1 | 144 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9316 | 1 | 144 | 3.90.1180.10 |
| af_O96222_56_212_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9306 | 10 | 142 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1MIP2-F1-model_v4 | Large ribosomal subunit protein uL13 (50S ribosomal protein L13) | 0.9855 | 6 | 154 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1Q7BZ54-F1-model_v4 | 50S ribosomal protein L13 | 0.9847 | 16 | 154 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A380TAC6-F1-model_v4 | 50S ribosomal subunit protein L13 | 0.9839 | 5 | 153 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1Y2K1C2-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9829 | 6 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1G2WUJ1-F1-model_v4 | deleted | 0.9806 | 20 | 154 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar