F374524

General Info

Members Datasets Scaffolds Average Seq Length
267 205 534 107

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100275102|Ga0070690_1002751022
Length 107
Sequence MERVCFRLQLKLDRLDEYIERHAEVWPEMRAALTETGWTNYSLFVDERDGTLIGYLETPDLAAAQAGMADRPVNTKWQATMAEFFVDLEDRQPDEGFVRLREIFHLA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
107 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
108 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
130 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
195 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
196 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 2643221649 Leifsonia sp. Root4 Isolate Unclassified
204 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
205 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0
Rhizoplane 3
Rhizosphere 86.52
Stem 0
Stem Tuber 0
Unclassified 16.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100275102 3300005330 Bacteria 1199
2 Ga0070683_100474498 3300005329 Bacteria 1194
3 Ga0070690_100487274 3300005330 Bacteria 920
4 Ga0070670_100182611 3300005331 Bacteria 1822
5 Ga0070666_10099069 3300005335 Bacteria 2007
6 Ga0070682_100160309 3300005337 Bacteria 1553
7 Ga0070682_101887975 3300005337 Bacteria 523
8 Ga0068868_100740556 3300005338 Unclassified 882
9 Ga0070689_100234564 3300005340 Bacteria 1509
10 Ga0070669_100132925 3300005353 Bacteria 1911
11 Ga0070671_100085450 3300005355 Bacteria 2639
12 Ga0070671_100224910 3300005355 Unclassified 1592
13 Ga0070673_100168804 3300005364 Bacteria 1866
14 Ga0070667_100074265 3300005367 Bacteria 2900
15 Ga0070709_10405033 3300005434 Bacteria 1019
16 Ga0070713_102009752 3300005436 Unclassified 561
17 Ga0070710_10390782 3300005437 Bacteria 930
18 Ga0070705_100265571 3300005440 Bacteria 1213
19 Ga0070694_101229403 3300005444 Unclassified 628
20 Ga0070708_101441029 3300005445 Bacteria 642
21 Ga0070663_101556354 3300005455 Bacteria 589
22 Ga0070681_10002307 3300005458 Bacteria 17454
23 Ga0070681_10021477 3300005458 Bacteria 6472
24 Ga0070679_100119098 3300005530 Unclassified 2625
25 Ga0070679_100485160 3300005530 Bacteria 1180
26 Ga0070684_100238295 3300005535 Bacteria 1662
27 Ga0070684_101118714 3300005535 Bacteria 740
28 Ga0068853_100127073 3300005539 Bacteria 2278
29 Ga0070672_100943322 3300005543 Bacteria 763
30 Ga0070686_100495177 3300005544 Bacteria 947
31 Ga0070695_100368821 3300005545 Unclassified 1080
32 Ga0070695_100993492 3300005545 Unclassified 682
33 Ga0070693_101008929 3300005547 Unclassified 630
34 Ga0070665_100976222 3300005548 Bacteria 860
35 Ga0068855_100773705 3300005563 Unclassified 1022
36 Ga0068855_100885985 3300005563 Bacteria 944
37 Ga0070664_101040872 3300005564 Unclassified 770
38 Ga0070664_101587616 3300005564 Bacteria 620
39 Ga0068857_102047409 3300005577 Unclassified 562
40 Ga0068854_100216964 3300005578 Bacteria 1511
41 Ga0068854_101178843 3300005578 Bacteria 685
42 Ga0068856_101258776 3300005614 Bacteria 755
43 Ga0068856_102427020 3300005614 Bacteria 531
44 Ga0070702_101738406 3300005615 Bacteria 519
45 Ga0068852_102211032 3300005616 Unclassified 572
46 Ga0068859_100059180 3300005617 Bacteria 3860
47 Ga0068864_100195626 3300005618 Bacteria 1855
48 Ga0068861_100222154 3300005719 Bacteria 1597
49 Ga0068863_100003637 3300005841 Bacteria 15230
50 Ga0068858_100018118 3300005842 Bacteria 6597
51 Ga0068860_100006036 3300005843 Bacteria 12192
52 Ga0068862_100223567 3300005844 Bacteria 1705
53 Ga0068862_100667190 3300005844 Unclassified 1004
54 Ga0075365_10583624 3300006038 Bacteria 790
55 Ga0075363_100174416 3300006048 Bacteria 1221
56 Ga0075367_10058913 3300006178 Bacteria 2286
57 Ga0097621_100057241 3300006237 Bacteria 3187
58 Ga0097621_101463508 3300006237 Bacteria 647
59 Ga0068871_100505960 3300006358 Bacteria 1089
60 Ga0075428_100830289 3300006844 Bacteria 982
61 Ga0075430_101002622 3300006846 Bacteria 688
62 Ga0075431_100492907 3300006847 Bacteria 1217
63 Ga0075431_100578094 3300006847 Bacteria 1109
64 Ga0075429_100943826 3300006880 Bacteria 755
65 Ga0097620_100059179 3300006931 Bacteria 3860
66 Ga0075435_101503502 3300007076 Unclassified 590
67 Ga0105240_10000622 3300009093 Bacteria 65686
68 Ga0105240_10001075 3300009093 Bacteria 48253
69 Ga0105240_10023043 3300009093 Bacteria 8246
70 Ga0105240_10026623 3300009093 Bacteria 7589
71 Ga0105240_10106296 3300009093 Bacteria 3404
72 Ga0105240_11521322 3300009093 Unclassified 701
73 Ga0111539_12571825 3300009094 Bacteria 590
74 Ga0105245_10186656 3300009098 Bacteria 1984
75 Ga0105247_10161267 3300009101 Unclassified 1485
76 Ga0114129_10431865 3300009147 Bacteria 1730
77 Ga0114129_11076239 3300009147 Bacteria 1008
78 Ga0114129_11132781 3300009147 Bacteria 978
79 Ga0105241_10351459 3300009174 Unclassified 1280
80 Ga0105242_10548528 3300009176 Bacteria 1108
81 Ga0105248_10094064 3300009177 Unclassified 3375
82 Ga0105248_10901721 3300009177 Bacteria 998
83 Ga0105237_10005092 3300009545 Bacteria 14921
84 Ga0105237_10100537 3300009545 Bacteria 2883
85 Ga0105237_10272029 3300009545 Bacteria 1697
86 Ga0105237_10409063 3300009545 Unclassified 1362
87 Ga0105237_11001945 3300009545 Unclassified 842
88 Ga0105237_11082372 3300009545 Unclassified 808
89 Ga0105237_12474803 3300009545 Unclassified 529
90 Ga0105238_10395362 3300009551 Bacteria 1375
91 Ga0105238_10442349 3300009551 Bacteria 1296
92 Ga0105238_10452835 3300009551 Unclassified 1280
93 Ga0105249_10056571 3300009553 Bacteria 3591
94 Ga0105249_10658175 3300009553 Bacteria 1105
95 Ga0105239_10012431 3300010375 Bacteria 9480
96 Ga0105239_10152714 3300010375 Bacteria 2577
97 Ga0105239_10863522 3300010375 Bacteria 1038
98 Ga0157369_10598634 3300013105 Bacteria 1138
99 Ga0157369_11302176 3300013105 Unclassified 741
100 Ga0157378_12153718 3300013297 Archaea 608
101 Ga0163162_10473156 3300013306 Bacteria 1384
102 Ga0157372_10000531 3300013307 Bacteria 42253
103 Ga0157372_10573326 3300013307 Bacteria 1315
104 Ga0157375_10956897 3300013308 Bacteria 998
105 Ga0157375_13224113 3300013308 Bacteria 544
106 Ga0157380_11277435 3300014326 Bacteria 780
107 Ga0157377_10112121 3300014745 Bacteria 1641
108 Ga0157379_10104078 3300014968 Bacteria 2547
109 Ga0157376_11405011 3300014969 Bacteria 730
110 Ga0207710_10107279 3300025900 Unclassified 1323
111 Ga0207680_10356468 3300025903 Bacteria 1028
112 Ga0207647_10079699 3300025904 Bacteria 1965
113 Ga0207685_10060014 3300025905 Bacteria 1502
114 Ga0207699_10324836 3300025906 Bacteria 1080
115 Ga0207699_10503579 3300025906 Bacteria 874
116 Ga0207707_10001926 3300025912 Bacteria 18866
117 Ga0207707_10013914 3300025912 Bacteria 7015
118 Ga0207707_10388497 3300025912 Unclassified 1199
119 Ga0207695_10001412 3300025913 Bacteria 40469
120 Ga0207695_10017793 3300025913 Bacteria 8246
121 Ga0207695_10051301 3300025913 Bacteria 4333
122 Ga0207695_10076383 3300025913 Bacteria 3405
123 Ga0207695_11442995 3300025913 Unclassified 569
124 Ga0207671_10143172 3300025914 Bacteria 1843
125 Ga0207671_10521663 3300025914 Unclassified 947
126 Ga0207671_10644268 3300025914 Unclassified 844
127 Ga0207671_10757230 3300025914 Unclassified 771
128 Ga0207671_11237270 3300025914 Unclassified 583
129 Ga0207671_11363439 3300025914 Unclassified 551
130 Ga0207693_10149039 3300025915 Unclassified 1839
131 Ga0207652_10191444 3300025921 Bacteria 1840
132 Ga0207681_10121783 3300025923 Bacteria 1914
133 Ga0207694_10427221 3300025924 Bacteria 1104
134 Ga0207650_10051453 3300025925 Bacteria 3049
135 Ga0207700_10022215 3300025928 Unclassified 4349
136 Ga0207644_10158763 3300025931 Bacteria 1756
137 Ga0207686_10271646 3300025934 Bacteria 1247
138 Ga0207691_11064094 3300025940 Unclassified 674
139 Ga0207711_10143112 3300025941 Bacteria 2153
140 Ga0207667_10478714 3300025949 Bacteria 1264
141 Ga0207667_10647102 3300025949 Unclassified 1063
142 Ga0207651_10567702 3300025960 Unclassified 988
143 Ga0207712_10435463 3300025961 Bacteria 1109
144 Ga0207640_11486636 3300025981 Bacteria 608
145 Ga0207658_10389566 3300025986 Bacteria 1222
146 Ga0207703_10001355 3300026035 Bacteria 22437
147 Ga0207678_10308616 3300026067 Bacteria 1360
148 Ga0207702_10083200 3300026078 Unclassified 2784
149 Ga0207641_10000197 3300026088 Bacteria 81805
150 Ga0207676_10217609 3300026095 Bacteria 1699
151 Ga0207675_100077130 3300026118 Bacteria 3121
152 Ga0268266_10889543 3300028379 Bacteria 861
153 Ga0268265_10173014 3300028380 Bacteria 1848
154 Ga0268264_10000025 3300028381 Bacteria 468619
155 Ga0307512_10187757 3300030522 Bacteria 1147
156 Ga0314311_1058560 3300030733 Bacteria 777
157 Ga0316183_1103671 3300030742 Bacteria 858
158 Ga0307509_10832649 3300031507 Bacteria 587
159 Ga0307408_100139937 3300031548 Bacteria 1899
160 Ga0316576_10992374 3300031727 Bacteria 599
161 Ga0307405_10002700 3300031731 Bacteria 7922
162 Ga0307413_10033540 3300031824 Bacteria 2925
163 Ga0307410_10121341 3300031852 Bacteria 1906
164 Ga0307406_10129061 3300031901 Bacteria 1771
165 Ga0307407_10393329 3300031903 Bacteria 993
166 Ga0307412_10031012 3300031911 Bacteria 3372
167 Ga0307409_100000181 3300031995 Bacteria 24481
168 Ga0307416_100011847 3300032002 Bacteria 5844
169 Ga0307416_101912665 3300032002 Bacteria 696
170 Ga0307416_102273010 3300032002 Bacteria 643
171 Ga0307414_11468388 3300032004 Bacteria 634
172 Ga0307411_10775341 3300032005 Bacteria 842
173 Ga0307411_11195800 3300032005 Bacteria 689
174 Ga0307415_100000148 3300032126 Bacteria 31023
175 Ga0307507_10437784 3300033179 Bacteria 727
176 Ga0307510_10006047 3300033180 Bacteria 14432
177 Ga0373936_0004561 3300035113 Bacteria 5243
178 Ga0373936_0136946 3300035113 Bacteria 1055
179 Ga0395900_0808229 3300037418 Bacteria 865
180 Ga0395898_0603598 3300037466 Bacteria 1040
181 Ga0395898_0958742 3300037466 Bacteria 792
182 Ga0436364_1208221 3300037853 Bacteria 5126
183 Ga0451789_0300580 3300041443 Bacteria 1095
184 Ga0451835_0348554 3300041492 Bacteria 665
185 Ga0451837_0353108 3300041494 Bacteria 558
186 Ga0451841_0123973 3300041498 Bacteria 2112
187 Ga0439448_0123854 3300042005 Unclassified 888
188 Ga0439432_172479 3300042006 Bacteria 631
189 Ga0439450_154431 3300042008 Bacteria 603
190 Ga0439464_0299204 3300042439 Bacteria 525
191 Ga0439440_0097300 3300042993 Bacteria 797
192 Ga0466969_0003471 3300044656 Bacteria 8378
193 Ga0466966_0013892 3300044684 Bacteria 5330
194 Ga0466961_0030724 3300044693 Bacteria 3451
195 Ga0466971_0000748 3300044719 Bacteria 13022
196 Ga0466970_0071951 3300044765 Bacteria 1860
197 Ga0466959_0001143 3300045049 Bacteria 16004
198 Ga0451576_1616302 3300045051 Bacteria 672
199 Ga0466958_0084152 3300045836 Bacteria 1961
200 Ga0466967_0055559 3300045976 Bacteria 3488
201 Ga0495629_0753600 3300046459 Bacteria 644
202 Ga0495651_0001356 3300046462 Bacteria 18940
203 Ga0495606_0596411 3300046507 Bacteria 543
204 Ga0495628_0010146 3300046516 Bacteria 8010
205 Ga0495652_0044702 3300046529 Bacteria 3812
206 Ga0495645_0044652 3300046543 Bacteria 3232
207 Ga0495625_0304220 3300046660 Bacteria 1019
208 Ga0495657_0821846 3300046675 Bacteria 530
209 Ga0495623_0591147 3300046679 Bacteria 577
210 Ga0495646_0277716 3300046680 Bacteria 891
211 Ga0495658_0367912 3300046683 Bacteria 914
212 Ga0495613_0480017 3300046689 Bacteria 839
213 Ga0495600_0137756 3300046809 Bacteria 1584
214 Ga0495604_0008908 3300047317 Bacteria 7931
215 Ga0495614_0574859 3300048089 Bacteria 540
216 Ga0496100_1507070 3300048903 Bacteria 531
217 Ga0496104_0451191 3300048907 Bacteria 1198
218 Ga0496105_0560159 3300048908 Bacteria 891
219 Ga0496108_0344684 3300048911 Bacteria 1300
220 Ga0496110_0677398 3300048913 Bacteria 932
221 Ga0496111_0707210 3300048914 Bacteria 733
222 Ga0496114_0352666 3300048917 Bacteria 1301
223 Ga0496118_0137057 3300048921 Unclassified 1560
224 Ga0496119_0190987 3300048922 Bacteria 1067
225 Ga0496121_0054912 3300048924 Bacteria 3324
226 Ga0496123_0430175 3300048926 Bacteria 593
227 Ga0496125_0002527 3300048928 Bacteria 23604
228 Ga0496126_0194938 3300048929 Bacteria 1713
229 Ga0501034_0120483 3300049571 Bacteria 2610
230 Ga0501036_0182613 3300049572 Bacteria 1766
231 Ga0501037_0097028 3300049573 Bacteria 2130
232 Ga0501040_0155905 3300049576 Bacteria 1613
233 Ga0501047_0018243 3300049581 Bacteria 6725
234 Ga0501047_0264486 3300049581 Bacteria 1567
235 Ga0501047_0456733 3300049581 Bacteria 1106
236 Ga0501048_0037801 3300049582 Bacteria 3467
237 Ga0501048_1120922 3300049582 Bacteria 566
238 Ga0501069_0476922 3300049585 Unclassified 743
239 Ga0501072_0526796 3300049588 Unclassified 934
240 Ga0501074_0220099 3300049590 Unclassified 1352
241 Ga0501080_1851567 3300049742 Bacteria 506
242 Ga0501035_0016727 3300049822 Bacteria 6762
243 Ga0501044_0003530 3300049823 Bacteria 17605
244 Ga0501044_0105804 3300049823 Bacteria 2826
245 Ga0501044_1454063 3300049823 Bacteria 551
246 nmdc:mga03n38_223847_c1 3300050490 Bacteria 983
247 nmdc:mga05p37_644742_c1 3300050507 Bacteria 1187
248 nmdc:mga05p37_717205_c1 3300050507 Bacteria 1108
249 nmdc:mga05p37_871299_c1 3300050507 Bacteria 975
250 nmdc:mga09592_706587_c1 3300050508 Bacteria 858
251 nmdc:mga0qj67_1034394_c1 3300050509 Bacteria 643
252 nmdc:mga06r32_264530_c1 3300050510 Bacteria 1707
253 nmdc:mga08y16_1681654_c1 3300050511 Bacteria 590
254 Ga0495619_0802392 3300053085 Bacteria 637
255 Ga0500560_029227 3300053107 Bacteria 1652
256 Ga0500580_206140 3300053113 Bacteria 637
257 Ga0500591_195820 3300053115 Bacteria 707
258 Ga0500559_0403065 3300053136 Unclassified 636
259 Ga0500559_0439423 3300053136 Bacteria 604
260 Ga0500573_0050450 3300053140 Bacteria 2393
261 Ga0500590_082297 3300053148 Bacteria 1579
262 Ga0500630_119805 3300053159 Bacteria 1168
263 Ga0500636_0315208 3300053177 Bacteria 763
264 Ga0466962_0000355 3300061719 Bacteria 19651
265 2644280004 2643221649 Bacteria 3867359
266 2844853759 2844852863 Bacteria 3849151
267 2887482304 2887478801 Bacteria 8972725
268 Ga0070690_100275102
269 Ga0070683_100474498
270 Ga0070690_100487274
271 Ga0070670_100182611
272 Ga0070666_10099069
273 Ga0070682_100160309
274 Ga0070682_101887975
275 Ga0068868_100740556
276 Ga0070689_100234564
277 Ga0070669_100132925
278 Ga0070671_100085450
279 Ga0070671_100224910
280 Ga0070673_100168804
281 Ga0070667_100074265
282 Ga0070709_10405033
283 Ga0070713_102009752
284 Ga0070710_10390782
285 Ga0070705_100265571
286 Ga0070694_101229403
287 Ga0070708_101441029
288 Ga0070663_101556354
289 Ga0070681_10002307
290 Ga0070681_10021477
291 Ga0070679_100119098
292 Ga0070679_100485160
293 Ga0070684_100238295
294 Ga0070684_101118714
295 Ga0068853_100127073
296 Ga0070672_100943322
297 Ga0070686_100495177
298 Ga0070695_100368821
299 Ga0070695_100993492
300 Ga0070693_101008929
301 Ga0070665_100976222
302 Ga0068855_100773705
303 Ga0068855_100885985
304 Ga0070664_101040872
305 Ga0070664_101587616
306 Ga0068857_102047409
307 Ga0068854_100216964
308 Ga0068854_101178843
309 Ga0068856_101258776
310 Ga0068856_102427020
311 Ga0070702_101738406
312 Ga0068852_102211032
313 Ga0068859_100059180
314 Ga0068864_100195626
315 Ga0068861_100222154
316 Ga0068863_100003637
317 Ga0068858_100018118
318 Ga0068860_100006036
319 Ga0068862_100223567
320 Ga0068862_100667190
321 Ga0075365_10583624
322 Ga0075363_100174416
323 Ga0075367_10058913
324 Ga0097621_100057241
325 Ga0097621_101463508
326 Ga0068871_100505960
327 Ga0075428_100830289
328 Ga0075430_101002622
329 Ga0075431_100492907
330 Ga0075431_100578094
331 Ga0075429_100943826
332 Ga0097620_100059179
333 Ga0075435_101503502
334 Ga0105240_10000622
335 Ga0105240_10001075
336 Ga0105240_10023043
337 Ga0105240_10026623
338 Ga0105240_10106296
339 Ga0105240_11521322
340 Ga0111539_12571825
341 Ga0105245_10186656
342 Ga0105247_10161267
343 Ga0114129_10431865
344 Ga0114129_11076239
345 Ga0114129_11132781
346 Ga0105241_10351459
347 Ga0105242_10548528
348 Ga0105248_10094064
349 Ga0105248_10901721
350 Ga0105237_10005092
351 Ga0105237_10100537
352 Ga0105237_10272029
353 Ga0105237_10409063
354 Ga0105237_11001945
355 Ga0105237_11082372
356 Ga0105237_12474803
357 Ga0105238_10395362
358 Ga0105238_10442349
359 Ga0105238_10452835
360 Ga0105249_10056571
361 Ga0105249_10658175
362 Ga0105239_10012431
363 Ga0105239_10152714
364 Ga0105239_10863522
365 Ga0157369_10598634
366 Ga0157369_11302176
367 Ga0157378_12153718
368 Ga0163162_10473156
369 Ga0157372_10000531
370 Ga0157372_10573326
371 Ga0157375_10956897
372 Ga0157375_13224113
373 Ga0157380_11277435
374 Ga0157377_10112121
375 Ga0157379_10104078
376 Ga0157376_11405011
377 Ga0207710_10107279
378 Ga0207680_10356468
379 Ga0207647_10079699
380 Ga0207685_10060014
381 Ga0207699_10324836
382 Ga0207699_10503579
383 Ga0207707_10001926
384 Ga0207707_10013914
385 Ga0207707_10388497
386 Ga0207695_10001412
387 Ga0207695_10017793
388 Ga0207695_10051301
389 Ga0207695_10076383
390 Ga0207695_11442995
391 Ga0207671_10143172
392 Ga0207671_10521663
393 Ga0207671_10644268
394 Ga0207671_10757230
395 Ga0207671_11237270
396 Ga0207671_11363439
397 Ga0207693_10149039
398 Ga0207652_10191444
399 Ga0207681_10121783
400 Ga0207694_10427221
401 Ga0207650_10051453
402 Ga0207700_10022215
403 Ga0207644_10158763
404 Ga0207686_10271646
405 Ga0207691_11064094
406 Ga0207711_10143112
407 Ga0207667_10478714
408 Ga0207667_10647102
409 Ga0207651_10567702
410 Ga0207712_10435463
411 Ga0207640_11486636
412 Ga0207658_10389566
413 Ga0207703_10001355
414 Ga0207678_10308616
415 Ga0207702_10083200
416 Ga0207641_10000197
417 Ga0207676_10217609
418 Ga0207675_100077130
419 Ga0268266_10889543
420 Ga0268265_10173014
421 Ga0268264_10000025
422 Ga0307512_10187757
423 Ga0314311_1058560
424 Ga0316183_1103671
425 Ga0307509_10832649
426 Ga0307408_100139937
427 Ga0316576_10992374
428 Ga0307405_10002700
429 Ga0307413_10033540
430 Ga0307410_10121341
431 Ga0307406_10129061
432 Ga0307407_10393329
433 Ga0307412_10031012
434 Ga0307409_100000181
435 Ga0307416_100011847
436 Ga0307416_101912665
437 Ga0307416_102273010
438 Ga0307414_11468388
439 Ga0307411_10775341
440 Ga0307411_11195800
441 Ga0307415_100000148
442 Ga0307507_10437784
443 Ga0307510_10006047
444 Ga0373936_0004561
445 Ga0373936_0136946
446 Ga0395900_0808229
447 Ga0395898_0603598
448 Ga0395898_0958742
449 Ga0436364_1208221
450 Ga0451789_0300580
451 Ga0451835_0348554
452 Ga0451837_0353108
453 Ga0451841_0123973
454 Ga0439448_0123854
455 Ga0439432_172479
456 Ga0439450_154431
457 Ga0439464_0299204
458 Ga0439440_0097300
459 Ga0466969_0003471
460 Ga0466966_0013892
461 Ga0466961_0030724
462 Ga0466971_0000748
463 Ga0466970_0071951
464 Ga0466959_0001143
465 Ga0451576_1616302
466 Ga0466958_0084152
467 Ga0466967_0055559
468 Ga0495629_0753600
469 Ga0495651_0001356
470 Ga0495606_0596411
471 Ga0495628_0010146
472 Ga0495652_0044702
473 Ga0495645_0044652
474 Ga0495625_0304220
475 Ga0495657_0821846
476 Ga0495623_0591147
477 Ga0495646_0277716
478 Ga0495658_0367912
479 Ga0495613_0480017
480 Ga0495600_0137756
481 Ga0495604_0008908
482 Ga0495614_0574859
483 Ga0496100_1507070
484 Ga0496104_0451191
485 Ga0496105_0560159
486 Ga0496108_0344684
487 Ga0496110_0677398
488 Ga0496111_0707210
489 Ga0496114_0352666
490 Ga0496118_0137057
491 Ga0496119_0190987
492 Ga0496121_0054912
493 Ga0496123_0430175
494 Ga0496125_0002527
495 Ga0496126_0194938
496 Ga0501034_0120483
497 Ga0501036_0182613
498 Ga0501037_0097028
499 Ga0501040_0155905
500 Ga0501047_0018243
501 Ga0501047_0264486
502 Ga0501047_0456733
503 Ga0501048_0037801
504 Ga0501048_1120922
505 Ga0501069_0476922
506 Ga0501072_0526796
507 Ga0501074_0220099
508 Ga0501080_1851567
509 Ga0501035_0016727
510 Ga0501044_0003530
511 Ga0501044_0105804
512 Ga0501044_1454063
513 nmdc:mga03n38_223847_c1
514 nmdc:mga05p37_644742_c1
515 nmdc:mga05p37_717205_c1
516 nmdc:mga05p37_871299_c1
517 nmdc:mga09592_706587_c1
518 nmdc:mga0qj67_1034394_c1
519 nmdc:mga06r32_264530_c1
520 nmdc:mga08y16_1681654_c1
521 Ga0495619_0802392
522 Ga0500560_029227
523 Ga0500580_206140
524 Ga0500591_195820
525 Ga0500559_0403065
526 Ga0500559_0439423
527 Ga0500573_0050450
528 Ga0500590_082297
529 Ga0500630_119805
530 Ga0500636_0315208
531 Ga0466962_0000355
532 2644280004
533 2844853759
534 2887482304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

3

106

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8645 1 104
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.8588 2 104
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8567 1 104
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8564 1 104
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.8442 2 104
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8681 1 97 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.86 1 97 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8449 2 97 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8052 2 97 3.30.70.100
af_Q499A3_294_393_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7725 41 59 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A1G3FWQ0-F1-model_v4 L-rhamnose mutarotase 0.9093 1 85 GO:0016857
GO:0019301
AF-A0A827J6F2-F1-model_v4 deleted 0.9009 1 88
AF-A0A1G3FWQ0-F1-model_v4 L-rhamnose mutarotase 0.8996 1 85 GO:0016857
GO:0019301
AF-A0A7X0DF02-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.8936 2 104 GO:0019301
GO:0062192
AF-F7S7N3-F1-model_v4 L-rhamnose mutarotase 0.8887 1 76 GO:0016857
GO:0019301

Map