F374389

General Info

Members Datasets Scaffolds Average Seq Length
266 160 532 155

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_367726_c1|nmdc:mga0n895_367726_c1_834_1382
Length 182
Sequence MMNGPTIIVTIYTSHRRRTVNYNPGIMQTVYEAAGSSDGLLRLAGAWHTRVLEDEVVSHAFSHGFHPQHTERLAAYWAEALGGPTTYSDRYGDETSVVRIHSGNGLHEEMDQRAIACFDQALEDVGLARDERLRRVLHDYFAWATTTTMSRYHRSAKDVPDGLHIPKWSWHGLVGGAETDDI

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.5
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 24.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_367726_c1 3300050512 Unclassified 1456
2 Ga0065712_10185751 3300005290 Bacteria 1171
3 Ga0065712_10223592 3300005290 Bacteria 1033
4 Ga0065707_10093758 3300005295 Bacteria 3583
5 Ga0070676_10192646 3300005328 Unclassified 1332
6 Ga0070690_100002502 3300005330 Bacteria 9884
7 Ga0070670_100228512 3300005331 Bacteria 1619
8 Ga0070670_100349520 3300005331 Bacteria 1299
9 Ga0070670_100599341 3300005331 Bacteria 986
10 Ga0070670_101077804 3300005331 Unclassified 732
11 Ga0070677_10037085 3300005333 Bacteria 1900
12 Ga0070677_10143905 3300005333 Bacteria 1103
13 Ga0068869_100096768 3300005334 Bacteria 2228
14 Ga0068869_100104266 3300005334 Bacteria 2149
15 Ga0070666_10159586 3300005335 Bacteria 1576
16 Ga0070680_100108675 3300005336 Bacteria 2308
17 Ga0070682_101355682 3300005337 Unclassified 606
18 Ga0068868_100042873 3300005338 Bacteria 3534
19 Ga0070660_100249816 3300005339 Unclassified 1446
20 Ga0070689_100072199 3300005340 Bacteria 2697
21 Ga0070689_100670308 3300005340 Bacteria 904
22 Ga0070687_100012016 3300005343 Bacteria 3808
23 Ga0070661_100040247 3300005344 Bacteria 3409
24 Ga0070661_100136375 3300005344 Unclassified 1847
25 Ga0070669_100786556 3300005353 Bacteria 808
26 Ga0070675_100048481 3300005354 Bacteria 3483
27 Ga0070675_100066338 3300005354 Bacteria 2985
28 Ga0070675_100544297 3300005354 Unclassified 1049
29 Ga0070671_100009154 3300005355 Bacteria 7949
30 Ga0070688_100140849 3300005365 Bacteria 1638
31 Ga0070659_100051000 3300005366 Bacteria 3253
32 Ga0070701_10137160 3300005438 Unclassified 1395
33 Ga0070701_10149795 3300005438 Unclassified 1342
34 Ga0070701_10512094 3300005438 Unclassified 781
35 Ga0070700_101238009 3300005441 Bacteria 625
36 Ga0070694_100042467 3300005444 Bacteria 3037
37 Ga0070678_101873689 3300005456 Unclassified 566
38 Ga0070681_10006551 3300005458 Bacteria 11335
39 Ga0068867_100945910 3300005459 Unclassified 778
40 Ga0070685_10241074 3300005466 Unclassified 1193
41 Ga0070706_100000162 3300005467 Bacteria 84837
42 Ga0070706_100333763 3300005467 Unclassified 1414
43 Ga0070706_100756976 3300005467 Bacteria 900
44 Ga0070707_100761139 3300005468 Bacteria 932
45 Ga0070698_100157850 3300005471 Bacteria 2213
46 Ga0070698_100544332 3300005471 Bacteria 1100
47 Ga0070698_100794711 3300005471 Bacteria 890
48 Ga0070679_100004440 3300005530 Bacteria 12964
49 Ga0068853_100009362 3300005539 Bacteria 7897
50 Ga0070672_100267357 3300005543 Bacteria 1443
51 Ga0070672_100324944 3300005543 Unclassified 1308
52 Ga0070672_100503488 3300005543 Bacteria 1048
53 Ga0070686_100609296 3300005544 Unclassified 861
54 Ga0070686_100913973 3300005544 Bacteria 715
55 Ga0070704_100036797 3300005549 Bacteria 3338
56 Ga0070704_100267066 3300005549 Bacteria 1412
57 Ga0070704_100658683 3300005549 Unclassified 925
58 Ga0070664_100010664 3300005564 Bacteria 7447
59 Ga0068857_100002517 3300005577 Bacteria 15003
60 Ga0068852_100378422 3300005616 Unclassified 1388
61 Ga0068859_100030211 3300005617 Bacteria 5437
62 Ga0068859_100058551 3300005617 Bacteria 3881
63 Ga0068859_100128182 3300005617 Bacteria 2608
64 Ga0068859_100170440 3300005617 Unclassified 2258
65 Ga0068859_100426796 3300005617 Unclassified 1422
66 Ga0068864_100026117 3300005618 Bacteria 4923
67 Ga0068864_101425164 3300005618 Bacteria 695
68 Ga0068861_100005582 3300005719 Bacteria 8526
69 Ga0068861_100131817 3300005719 Bacteria 2029
70 Ga0068870_10256520 3300005840 Bacteria 1086
71 Ga0068870_10263377 3300005840 Unclassified 1074
72 Ga0068870_11278306 3300005840 Bacteria 534
73 Ga0068863_100017362 3300005841 Bacteria 6899
74 Ga0068863_100063311 3300005841 Unclassified 3498
75 Ga0068858_100155991 3300005842 Bacteria 2148
76 Ga0068858_100181204 3300005842 Bacteria 1989
77 Ga0068860_100783728 3300005843 Bacteria 966
78 Ga0068862_100013387 3300005844 Bacteria 6788
79 Ga0068862_100595661 3300005844 Bacteria 1061
80 Ga0068862_101485881 3300005844 Unclassified 683
81 Ga0081539_10012605 3300005985 Bacteria 6488
82 Ga0070717_10057160 3300006028 Bacteria 3225
83 Ga0070717_10071626 3300006028 Bacteria 2892
84 Ga0070715_10000349 3300006163 Bacteria 11566
85 Ga0097621_100007356 3300006237 Bacteria 7875
86 Ga0068871_100017067 3300006358 Bacteria 5485
87 Ga0075428_100080794 3300006844 Bacteria 3548
88 Ga0075428_100814744 3300006844 Bacteria 992
89 Ga0075428_101432514 3300006844 Bacteria 725
90 Ga0075430_100044261 3300006846 Bacteria 3766
91 Ga0075430_100858553 3300006846 Bacteria 748
92 Ga0075431_100018023 3300006847 Bacteria 7182
93 Ga0075431_100108433 3300006847 Bacteria 2866
94 Ga0075431_100281252 3300006847 Bacteria 1684
95 Ga0075431_100529991 3300006847 Bacteria 1166
96 Ga0075431_100695235 3300006847 Bacteria 995
97 Ga0075431_100863644 3300006847 Unclassified 876
98 Ga0075431_100956577 3300006847 Bacteria 824
99 Ga0075433_10220827 3300006852 Bacteria 1683
100 Ga0075434_100228318 3300006871 Bacteria 1881
101 Ga0075429_100020658 3300006880 Bacteria 5716
102 Ga0075429_100064445 3300006880 Bacteria 3192
103 Ga0068865_100006789 3300006881 Bacteria 7006
104 Ga0068865_100384253 3300006881 Unclassified 1146
105 Ga0097620_100030211 3300006931 Bacteria 5437
106 Ga0097620_100058550 3300006931 Bacteria 3881
107 Ga0097620_100128164 3300006931 Bacteria 2608
108 Ga0097620_100170441 3300006931 Unclassified 2258
109 Ga0097620_100426817 3300006931 Unclassified 1422
110 Ga0075435_100359946 3300007076 Unclassified 1248
111 Ga0075435_100602024 3300007076 Unclassified 953
112 Ga0099794_10129645 3300007265 Bacteria 1273
113 Ga0111539_10048479 3300009094 Bacteria 5072
114 Ga0111539_11016925 3300009094 Unclassified 963
115 Ga0111539_11248807 3300009094 Bacteria 862
116 Ga0111539_12858679 3300009094 Unclassified 559
117 Ga0105245_11337083 3300009098 Unclassified 766
118 Ga0105245_11511760 3300009098 Bacteria 722
119 Ga0105245_11708792 3300009098 Unclassified 682
120 Ga0105245_12735398 3300009098 Bacteria 546
121 Ga0114129_10019547 3300009147 Bacteria 9645
122 Ga0114129_10058920 3300009147 Bacteria 5370
123 Ga0114129_10194803 3300009147 Bacteria 2749
124 Ga0114129_10305023 3300009147 Bacteria 2121
125 Ga0105242_10120041 3300009176 Bacteria 2254
126 Ga0105242_12338869 3300009176 Unclassified 581
127 Ga0105248_10169857 3300009177 Bacteria 2458
128 Ga0105237_11064121 3300009545 Unclassified 816
129 Ga0105249_10046913 3300009553 Bacteria 3934
130 Ga0105249_10079105 3300009553 Unclassified 3052
131 Ga0105249_10493889 3300009553 Unclassified 1268
132 Ga0157378_10039047 3300013297 Bacteria 4210
133 Ga0157372_10123468 3300013307 Bacteria 2976
134 Ga0157375_10026345 3300013308 Bacteria 5417
135 Ga0157375_10467184 3300013308 Unclassified 1427
136 Ga0157375_10873245 3300013308 Unclassified 1045
137 Ga0163163_10065549 3300014325 Bacteria 3606
138 Ga0157380_10017343 3300014326 Bacteria 5328
139 Ga0157380_10079513 3300014326 Bacteria 2678
140 Ga0157380_10331786 3300014326 Unclassified 1415
141 Ga0157380_10446374 3300014326 Bacteria 1241
142 Ga0157377_11090041 3300014745 Bacteria 611
143 Ga0157379_10341477 3300014968 Bacteria 1370
144 Ga0157376_10010495 3300014969 Bacteria 6779
145 Ga0228598_1025955 3300024227 Bacteria 1153
146 Ga0207682_10016628 3300025893 Bacteria 2871
147 Ga0207682_10024200 3300025893 Bacteria 2403
148 Ga0207688_10453145 3300025901 Unclassified 800
149 Ga0207680_10858567 3300025903 Bacteria 651
150 Ga0207645_10508968 3300025907 Unclassified 815
151 Ga0207684_10001089 3300025910 Bacteria 30474
152 Ga0207707_10003031 3300025912 Bacteria 14935
153 Ga0207671_10628721 3300025914 Unclassified 855
154 Ga0207662_10015380 3300025918 Bacteria 4306
155 Ga0207657_10257364 3300025919 Bacteria 1390
156 Ga0207649_10040187 3300025920 Unclassified 2841
157 Ga0207649_10468446 3300025920 Unclassified 954
158 Ga0207646_10487250 3300025922 Bacteria 1111
159 Ga0207650_10163557 3300025925 Bacteria 1765
160 Ga0207650_10312676 3300025925 Unclassified 1285
161 Ga0207650_10661629 3300025925 Bacteria 881
162 Ga0207650_11031799 3300025925 Bacteria 700
163 Ga0207650_11219488 3300025925 Unclassified 640
164 Ga0207659_10005305 3300025926 Bacteria 7812
165 Ga0207659_10309939 3300025926 Bacteria 1299
166 Ga0207700_11144194 3300025928 Bacteria 695
167 Ga0207664_10357434 3300025929 Bacteria 1293
168 Ga0207690_10012318 3300025932 Bacteria 5117
169 Ga0207706_10944659 3300025933 Bacteria 727
170 Ga0207686_10051504 3300025934 Bacteria 2565
171 Ga0207686_11421443 3300025934 Unclassified 571
172 Ga0207670_10457880 3300025936 Bacteria 1029
173 Ga0207704_10018874 3300025938 Bacteria 3610
174 Ga0207704_10794653 3300025938 Bacteria 790
175 Ga0207665_10054697 3300025939 Bacteria 2692
176 Ga0207665_10308811 3300025939 Bacteria 1184
177 Ga0207691_10448937 3300025940 Unclassified 1097
178 Ga0207691_10562329 3300025940 Bacteria 967
179 Ga0207689_10019883 3300025942 Bacteria 5657
180 Ga0207689_10545009 3300025942 Bacteria 974
181 Ga0207689_10854989 3300025942 Bacteria 768
182 Ga0207679_10036095 3300025945 Bacteria 3503
183 Ga0207679_10329466 3300025945 Bacteria 1325
184 Ga0207651_10045470 3300025960 Bacteria 2945
185 Ga0207651_11255436 3300025960 Unclassified 666
186 Ga0207712_10079304 3300025961 Bacteria 2385
187 Ga0207712_10100022 3300025961 Unclassified 2154
188 Ga0207658_10917346 3300025986 Bacteria 798
189 Ga0207677_10330949 3300026023 Unclassified 1269
190 Ga0207703_10102060 3300026035 Bacteria 2433
191 Ga0207639_10040883 3300026041 Bacteria 3464
192 Ga0207708_10415715 3300026075 Bacteria 1114
193 Ga0207641_10008385 3300026088 Bacteria 8540
194 Ga0207648_10081068 3300026089 Bacteria 2831
195 Ga0207676_10059195 3300026095 Bacteria 3024
196 Ga0207676_10208355 3300026095 Unclassified 1732
197 Ga0207674_10000036 3300026116 Bacteria 135434
198 Ga0207675_100032131 3300026118 Bacteria 4890
199 Ga0207675_100043798 3300026118 Bacteria 4180
200 Ga0207683_10150252 3300026121 Unclassified 2102
201 Ga0207428_10013903 3300027907 Bacteria 7011
202 Ga0268266_10609811 3300028379 Bacteria 1049
203 Ga0268265_10022614 3300028380 Bacteria 4420
204 Ga0268264_10802689 3300028381 Unclassified 940
205 Ga0268264_11708327 3300028381 Bacteria 640
206 Ga0307515_10627980 3300028794 Bacteria 686
207 Ga0307513_10003151 3300031456 Bacteria 22534
208 Ga0307509_10237108 3300031507 Bacteria 1621
209 Ga0307405_11232926 3300031731 Unclassified 648
210 Ga0373954_0102389 3300035118 Bacteria 1382
211 Ga0373956_0031135 3300035119 Bacteria 2336
212 Ga0373955_0344994 3300035172 Bacteria 901
213 Ga0373955_0437326 3300035172 Bacteria 797
214 Ga0373927_0051938 3300035695 Bacteria 2651
215 Ga0373933_0301718 3300035724 Bacteria 1037
216 Ga0373933_0424050 3300035724 Bacteria 869
217 Ga0373937_0029661 3300036401 Bacteria 4955
218 Ga0373937_0667906 3300036401 Bacteria 985
219 Ga0373925_0816632 3300037068 Bacteria 769
220 Ga0395900_0131676 3300037418 Bacteria 2563
221 Ga0395900_1453307 3300037418 Unclassified 598
222 Ga0395900_1571940 3300037418 Unclassified 569
223 Ga0395900_1868779 3300037418 Bacteria 511
224 Ga0395898_0102321 3300037466 Bacteria 2750
225 Ga0395901_0023057 3300038443 Bacteria 6380
226 Ga0436361_0556452 3300039447 Bacteria 1006
227 Ga0436363_0003405 3300039450 Bacteria 523
228 Ga0436362_0452539 3300039453 Bacteria 731
229 Ga0451833_0166373 3300041491 Bacteria 616
230 Ga0495592_0027739 3300046454 Bacteria 4290
231 Ga0495629_0858570 3300046459 Bacteria 597
232 Ga0495582_0175217 3300046473 Bacteria 1222
233 Ga0495664_0151124 3300046477 Bacteria 1408
234 Ga0495628_0132162 3300046516 Bacteria 1908
235 Ga0495652_0076264 3300046529 Bacteria 2781
236 Ga0495586_0029313 3300046535 Bacteria 2945
237 Ga0495599_0127641 3300046678 Bacteria 1580
238 Ga0495623_0018028 3300046679 Bacteria 4559
239 Ga0495600_0828570 3300046809 Bacteria 550
240 Ga0495593_0353094 3300047673 Bacteria 735
241 Ga0496109_0369664 3300048912 Unclassified 1355
242 Ga0496110_0026082 3300048913 Bacteria 4997
243 Ga0496111_0372371 3300048914 Unclassified 1057
244 Ga0496114_0189996 3300048917 Archaea 1797
245 nmdc:mga09592_542833_c1 3300050508 Bacteria 999
246 nmdc:mga09592_82947_c1 3300050508 Bacteria 2732
247 nmdc:mga0qj67_178088_c1 3300050509 Bacteria 1727
248 nmdc:mga0qj67_91467_c1 3300050509 Bacteria 2445
249 nmdc:mga0qj67_9216_c1 3300050509 Bacteria 7334
250 nmdc:mga06r32_103319_c1 3300050510 Bacteria 2798
251 nmdc:mga06r32_244665_c1 3300050510 Bacteria 1781
252 nmdc:mga06r32_308048_c1 3300050510 Bacteria 1569
253 nmdc:mga06r32_770893_c1 3300050510 Bacteria 924
254 nmdc:mga08y16_300468_c1 3300050511 Bacteria 1655
255 nmdc:mga08y16_439418_c1 3300050511 Bacteria 1332
256 nmdc:mga0n895_1444193_c1 3300050512 Unclassified 655
257 nmdc:mga0n895_470065_c1 3300050512 Bacteria 1268
258 nmdc:mga0n895_507947_c1 3300050512 Unclassified 1214
259 nmdc:mga0n895_648142_c1 3300050512 Unclassified 1055
260 nmdc:mga0rr50_1194893_c1 3300050513 Unclassified 646
261 nmdc:mga0rr50_326788_c1 3300050513 Unclassified 1287
262 nmdc:mga0rr50_369976_c1 3300050513 Bacteria 1207
263 nmdc:mga0a205_25596_c1 3300050515 Bacteria 5622
264 nmdc:mga0a205_342108_c1 3300050515 Bacteria 1364
265 Ga0495601_0046388 3300053077 Bacteria 2735
266 Ga0495612_0372360 3300053078 Bacteria 647
267 nmdc:mga0n895_367726_c1
268 Ga0065712_10185751
269 Ga0065712_10223592
270 Ga0065707_10093758
271 Ga0070676_10192646
272 Ga0070690_100002502
273 Ga0070670_100228512
274 Ga0070670_100349520
275 Ga0070670_100599341
276 Ga0070670_101077804
277 Ga0070677_10037085
278 Ga0070677_10143905
279 Ga0068869_100096768
280 Ga0068869_100104266
281 Ga0070666_10159586
282 Ga0070680_100108675
283 Ga0070682_101355682
284 Ga0068868_100042873
285 Ga0070660_100249816
286 Ga0070689_100072199
287 Ga0070689_100670308
288 Ga0070687_100012016
289 Ga0070661_100040247
290 Ga0070661_100136375
291 Ga0070669_100786556
292 Ga0070675_100048481
293 Ga0070675_100066338
294 Ga0070675_100544297
295 Ga0070671_100009154
296 Ga0070688_100140849
297 Ga0070659_100051000
298 Ga0070701_10137160
299 Ga0070701_10149795
300 Ga0070701_10512094
301 Ga0070700_101238009
302 Ga0070694_100042467
303 Ga0070678_101873689
304 Ga0070681_10006551
305 Ga0068867_100945910
306 Ga0070685_10241074
307 Ga0070706_100000162
308 Ga0070706_100333763
309 Ga0070706_100756976
310 Ga0070707_100761139
311 Ga0070698_100157850
312 Ga0070698_100544332
313 Ga0070698_100794711
314 Ga0070679_100004440
315 Ga0068853_100009362
316 Ga0070672_100267357
317 Ga0070672_100324944
318 Ga0070672_100503488
319 Ga0070686_100609296
320 Ga0070686_100913973
321 Ga0070704_100036797
322 Ga0070704_100267066
323 Ga0070704_100658683
324 Ga0070664_100010664
325 Ga0068857_100002517
326 Ga0068852_100378422
327 Ga0068859_100030211
328 Ga0068859_100058551
329 Ga0068859_100128182
330 Ga0068859_100170440
331 Ga0068859_100426796
332 Ga0068864_100026117
333 Ga0068864_101425164
334 Ga0068861_100005582
335 Ga0068861_100131817
336 Ga0068870_10256520
337 Ga0068870_10263377
338 Ga0068870_11278306
339 Ga0068863_100017362
340 Ga0068863_100063311
341 Ga0068858_100155991
342 Ga0068858_100181204
343 Ga0068860_100783728
344 Ga0068862_100013387
345 Ga0068862_100595661
346 Ga0068862_101485881
347 Ga0081539_10012605
348 Ga0070717_10057160
349 Ga0070717_10071626
350 Ga0070715_10000349
351 Ga0097621_100007356
352 Ga0068871_100017067
353 Ga0075428_100080794
354 Ga0075428_100814744
355 Ga0075428_101432514
356 Ga0075430_100044261
357 Ga0075430_100858553
358 Ga0075431_100018023
359 Ga0075431_100108433
360 Ga0075431_100281252
361 Ga0075431_100529991
362 Ga0075431_100695235
363 Ga0075431_100863644
364 Ga0075431_100956577
365 Ga0075433_10220827
366 Ga0075434_100228318
367 Ga0075429_100020658
368 Ga0075429_100064445
369 Ga0068865_100006789
370 Ga0068865_100384253
371 Ga0097620_100030211
372 Ga0097620_100058550
373 Ga0097620_100128164
374 Ga0097620_100170441
375 Ga0097620_100426817
376 Ga0075435_100359946
377 Ga0075435_100602024
378 Ga0099794_10129645
379 Ga0111539_10048479
380 Ga0111539_11016925
381 Ga0111539_11248807
382 Ga0111539_12858679
383 Ga0105245_11337083
384 Ga0105245_11511760
385 Ga0105245_11708792
386 Ga0105245_12735398
387 Ga0114129_10019547
388 Ga0114129_10058920
389 Ga0114129_10194803
390 Ga0114129_10305023
391 Ga0105242_10120041
392 Ga0105242_12338869
393 Ga0105248_10169857
394 Ga0105237_11064121
395 Ga0105249_10046913
396 Ga0105249_10079105
397 Ga0105249_10493889
398 Ga0157378_10039047
399 Ga0157372_10123468
400 Ga0157375_10026345
401 Ga0157375_10467184
402 Ga0157375_10873245
403 Ga0163163_10065549
404 Ga0157380_10017343
405 Ga0157380_10079513
406 Ga0157380_10331786
407 Ga0157380_10446374
408 Ga0157377_11090041
409 Ga0157379_10341477
410 Ga0157376_10010495
411 Ga0228598_1025955
412 Ga0207682_10016628
413 Ga0207682_10024200
414 Ga0207688_10453145
415 Ga0207680_10858567
416 Ga0207645_10508968
417 Ga0207684_10001089
418 Ga0207707_10003031
419 Ga0207671_10628721
420 Ga0207662_10015380
421 Ga0207657_10257364
422 Ga0207649_10040187
423 Ga0207649_10468446
424 Ga0207646_10487250
425 Ga0207650_10163557
426 Ga0207650_10312676
427 Ga0207650_10661629
428 Ga0207650_11031799
429 Ga0207650_11219488
430 Ga0207659_10005305
431 Ga0207659_10309939
432 Ga0207700_11144194
433 Ga0207664_10357434
434 Ga0207690_10012318
435 Ga0207706_10944659
436 Ga0207686_10051504
437 Ga0207686_11421443
438 Ga0207670_10457880
439 Ga0207704_10018874
440 Ga0207704_10794653
441 Ga0207665_10054697
442 Ga0207665_10308811
443 Ga0207691_10448937
444 Ga0207691_10562329
445 Ga0207689_10019883
446 Ga0207689_10545009
447 Ga0207689_10854989
448 Ga0207679_10036095
449 Ga0207679_10329466
450 Ga0207651_10045470
451 Ga0207651_11255436
452 Ga0207712_10079304
453 Ga0207712_10100022
454 Ga0207658_10917346
455 Ga0207677_10330949
456 Ga0207703_10102060
457 Ga0207639_10040883
458 Ga0207708_10415715
459 Ga0207641_10008385
460 Ga0207648_10081068
461 Ga0207676_10059195
462 Ga0207676_10208355
463 Ga0207674_10000036
464 Ga0207675_100032131
465 Ga0207675_100043798
466 Ga0207683_10150252
467 Ga0207428_10013903
468 Ga0268266_10609811
469 Ga0268265_10022614
470 Ga0268264_10802689
471 Ga0268264_11708327
472 Ga0307515_10627980
473 Ga0307513_10003151
474 Ga0307509_10237108
475 Ga0307405_11232926
476 Ga0373954_0102389
477 Ga0373956_0031135
478 Ga0373955_0344994
479 Ga0373955_0437326
480 Ga0373927_0051938
481 Ga0373933_0301718
482 Ga0373933_0424050
483 Ga0373937_0029661
484 Ga0373937_0667906
485 Ga0373925_0816632
486 Ga0395900_0131676
487 Ga0395900_1453307
488 Ga0395900_1571940
489 Ga0395900_1868779
490 Ga0395898_0102321
491 Ga0395901_0023057
492 Ga0436361_0556452
493 Ga0436363_0003405
494 Ga0436362_0452539
495 Ga0451833_0166373
496 Ga0495592_0027739
497 Ga0495629_0858570
498 Ga0495582_0175217
499 Ga0495664_0151124
500 Ga0495628_0132162
501 Ga0495652_0076264
502 Ga0495586_0029313
503 Ga0495599_0127641
504 Ga0495623_0018028
505 Ga0495600_0828570
506 Ga0495593_0353094
507 Ga0496109_0369664
508 Ga0496110_0026082
509 Ga0496111_0372371
510 Ga0496114_0189996
511 nmdc:mga09592_542833_c1
512 nmdc:mga09592_82947_c1
513 nmdc:mga0qj67_178088_c1
514 nmdc:mga0qj67_91467_c1
515 nmdc:mga0qj67_9216_c1
516 nmdc:mga06r32_103319_c1
517 nmdc:mga06r32_244665_c1
518 nmdc:mga06r32_308048_c1
519 nmdc:mga06r32_770893_c1
520 nmdc:mga08y16_300468_c1
521 nmdc:mga08y16_439418_c1
522 nmdc:mga0n895_1444193_c1
523 nmdc:mga0n895_470065_c1
524 nmdc:mga0n895_507947_c1
525 nmdc:mga0n895_648142_c1
526 nmdc:mga0rr50_1194893_c1
527 nmdc:mga0rr50_326788_c1
528 nmdc:mga0rr50_369976_c1
529 nmdc:mga0a205_25596_c1
530 nmdc:mga0a205_342108_c1
531 Ga0495601_0046388
532 Ga0495612_0372360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

29

146

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ab8-assembly1.cif.gz_A-2 high resolution x-ray structure of the n-terminal truncated form (residues 1-11) of mycobacterium tuberculosis hbn 0.8877 1 121
2gln-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis trhbn, glne11ala mutant 0.8862 3 124
5v3t-assembly1.cif.gz_A crystal structure of the group ii truncated hemoglobin from bacillus anthracis 0.8861 1 129
5v3v-assembly1.cif.gz_A crystal structure of the group ii truncated hemoglobin from bacillus anthracis: tyr26ala mutant 0.8855 1 129
1ux8-assembly1.cif.gz_A x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis 0.8768 2 125
ID Description Score Start End Superfamily
1ux8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8967 2 125 1.10.490.10
5ab8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8877 1 121 1.10.490.10
1ux8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8827 2 125 1.10.490.10
af_P9WN25_1_136_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8794 3 124 1.10.490.10
5d1vB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8702 1 125 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A5Q2FIK7-F1-model_v4 Oxidoreductase 0.9948 1 149 GO:0019825
GO:0020037
AF-A0A3E0NRU6-F1-model_v4 Oxidoreductase 0.9944 15 150 GO:0019825
GO:0020037
AF-A0A4R6JJI2-F1-model_v4 Hemoglobin 0.993 1 149 GO:0019825
GO:0020037
AF-A0A4R7VAW3-F1-model_v4 Hemoglobin 0.9911 1 150 GO:0019825
GO:0020037
AF-A0A839PPA4-F1-model_v4 Hemoglobin 0.9911 1 150 GO:0019825
GO:0020037

Map