F373748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 173 | 232 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10000486|JGI24737J22298_100004866 |
| Length | 404 |
| Sequence | MFIPTASCTILIEGSLIVTNSSLYLFWLLIKLPRLTHAKGGRLIKPNLINFKFLPVASSIVMKSSRFLEYIYIDYYSSTPKYIQLANSIIKSVREGKLIINETLPSINELNCNFEISRDTAEKAYKHLKSIGLLGSVPGKGYYIKNTEAGQQFKVFLIFNKLSTHKKLVYDAIVDGLGHEAAIDFYIYNNDFEFFKKLLQNNSNDYTHYVILPHFMHGGENVHDIINTLPKEKLIILDKLVPGIKGDFAAVYENFEKDIYXALEEALPQLRKYHTLKXIFPEYTYFPGEILKGFFSFCIQYAFTYKVVHDIQGEPIHEGDVFINLMENDLVVLIERILATELKIGKDVGVISYNETPLKKIILNGLTTISTDFEQMGKMTAEIIKNGSTGRYEVPFYLTLRASL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 5 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 6 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 7 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 8 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 9 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 10 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 13 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 14 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 15 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 16 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 17 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 18 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 19 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 20 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 21 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 22 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 23 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 24 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 25 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 26 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 27 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 28 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 29 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 30 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 31 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 32 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 33 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 34 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 35 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 36 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 37 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 38 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 39 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 40 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 141 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 161 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 164 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 166 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 167 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 168 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 169 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 170 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 171 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 172 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 173 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.22 |
| Metatranscriptomes | 0 |
| Isolates | 12.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.89 |
| Nodule | 0 |
| Rhizoplane | 0.38 |
| Rhizosphere | 81.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1214182 | 2162886007 | Bacteria | 4939 |
| 2 | JGI24740J21852_10018664 | 3300001979 | Unclassified | 2453 |
| 3 | JGI24739J22299_10022800 | 3300001989 | Unclassified | 2218 |
| 4 | JGI24737J22298_10000486 | 3300001990 | Bacteria | 13796 |
| 5 | JGI24737J22298_10010086 | 3300001990 | Bacteria | 3129 |
| 6 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 7 | JGI24735J21928_10000040 | 3300002067 | Bacteria | 62364 |
| 8 | JGI25162J39368_1002645 | 3300002737 | Bacteria | 6620 |
| 9 | JGI25164J39214_1001242 | 3300002772 | Bacteria | 6779 |
| 10 | JGI25165J46597_1001079 | 3300003214 | Bacteria | 17498 |
| 11 | rootH2_10001273 | 3300003320 | Bacteria | 179792 |
| 12 | rootH2_10160524 | 3300003320 | Bacteria | 2344 |
| 13 | rootH2_10301589 | 3300003320 | Bacteria | 4090 |
| 14 | rootH1_10156687 | 3300003323 | Bacteria | 2825 |
| 15 | rootH1_10356556 | 3300003323 | Bacteria | 1532 |
| 16 | Ga0055530_10002315 | 3300003791 | Bacteria | 12450 |
| 17 | Ga0065704_10000769 | 3300005289 | Bacteria | 22711 |
| 18 | Ga0065704_10118604 | 3300005289 | Bacteria | 1814 |
| 19 | Ga0065715_10026982 | 3300005293 | Bacteria | 1472 |
| 20 | Ga0070676_10000015 | 3300005328 | Bacteria | 52703 |
| 21 | Ga0070670_100240469 | 3300005331 | Bacteria | 1576 |
| 22 | Ga0068869_100049007 | 3300005334 | Bacteria | 3057 |
| 23 | Ga0070680_100001527 | 3300005336 | Bacteria | 16861 |
| 24 | Ga0070682_100001986 | 3300005337 | Bacteria | 11402 |
| 25 | Ga0070660_100079228 | 3300005339 | Bacteria | 2577 |
| 26 | Ga0070660_100182801 | 3300005339 | Bacteria | 1697 |
| 27 | Ga0070660_100197772 | 3300005339 | Bacteria | 1630 |
| 28 | Ga0070691_10009319 | 3300005341 | Bacteria | 4486 |
| 29 | Ga0070671_100000813 | 3300005355 | Bacteria | 22610 |
| 30 | Ga0070659_100001837 | 3300005366 | Bacteria | 15247 |
| 31 | Ga0070659_100003795 | 3300005366 | Bacteria | 10784 |
| 32 | Ga0070659_100012780 | 3300005366 | Bacteria | 6233 |
| 33 | Ga0070659_100048236 | 3300005366 | Bacteria | 3345 |
| 34 | Ga0070659_100330193 | 3300005366 | Bacteria | 1276 |
| 35 | Ga0070662_100001108 | 3300005457 | Bacteria | 16442 |
| 36 | Ga0070681_10009603 | 3300005458 | Bacteria | 9513 |
| 37 | Ga0068867_100000210 | 3300005459 | Bacteria | 39145 |
| 38 | Ga0070679_100009588 | 3300005530 | Bacteria | 9156 |
| 39 | Ga0070679_100125660 | 3300005530 | Bacteria | 2547 |
| 40 | Ga0068853_100017039 | 3300005539 | Bacteria | 5992 |
| 41 | Ga0068853_100243082 | 3300005539 | Bacteria | 1650 |
| 42 | Ga0068853_100357256 | 3300005539 | Bacteria | 1360 |
| 43 | Ga0070693_100003359 | 3300005547 | Bacteria | 7440 |
| 44 | Ga0070693_100227688 | 3300005547 | Bacteria | 1225 |
| 45 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 46 | Ga0068855_100035459 | 3300005563 | Bacteria | 5941 |
| 47 | Ga0068855_100328814 | 3300005563 | Bacteria | 1688 |
| 48 | Ga0068855_100543656 | 3300005563 | Unclassified | 1258 |
| 49 | Ga0068857_100034693 | 3300005577 | Bacteria | 4462 |
| 50 | Ga0068857_100063356 | 3300005577 | Bacteria | 3287 |
| 51 | Ga0068857_100101474 | 3300005577 | Bacteria | 2582 |
| 52 | Ga0068852_100236281 | 3300005616 | Bacteria | 1744 |
| 53 | Ga0068859_100495253 | 3300005617 | Bacteria | 1317 |
| 54 | Ga0068866_10013871 | 3300005718 | Bacteria | 3545 |
| 55 | Ga0068858_100032875 | 3300005842 | Bacteria | 4817 |
| 56 | Ga0068860_100069780 | 3300005843 | Bacteria | 3341 |
| 57 | Ga0075432_10061477 | 3300006058 | Bacteria | 1338 |
| 58 | Ga0075366_10000387 | 3300006195 | Bacteria | 20440 |
| 59 | Ga0075366_10003776 | 3300006195 | Bacteria | 8052 |
| 60 | Ga0097621_100000308 | 3300006237 | Bacteria | 33071 |
| 61 | Ga0068871_100000046 | 3300006358 | Bacteria | 66964 |
| 62 | Ga0068865_100000041 | 3300006881 | Bacteria | 72569 |
| 63 | Ga0097620_100495258 | 3300006931 | Bacteria | 1317 |
| 64 | Ga0105240_10037052 | 3300009093 | Bacteria | 6269 |
| 65 | Ga0105240_10044397 | 3300009093 | Bacteria | 5647 |
| 66 | Ga0105240_10072391 | 3300009093 | Bacteria | 4260 |
| 67 | Ga0105241_10002777 | 3300009174 | Bacteria | 13113 |
| 68 | Ga0105241_10016943 | 3300009174 | Bacteria | 5348 |
| 69 | Ga0105242_10034989 | 3300009176 | Bacteria | 4028 |
| 70 | Ga0105237_10000287 | 3300009545 | Bacteria | 69624 |
| 71 | Ga0105237_10039774 | 3300009545 | Bacteria | 4745 |
| 72 | Ga0105237_10167449 | 3300009545 | Unclassified | 2197 |
| 73 | Ga0105237_10208258 | 3300009545 | Bacteria | 1956 |
| 74 | Ga0105239_10000619 | 3300010375 | Bacteria | 50485 |
| 75 | Ga0105239_10006457 | 3300010375 | Bacteria | 13603 |
| 76 | Ga0105239_10051186 | 3300010375 | Bacteria | 4528 |
| 77 | Ga0105239_10061262 | 3300010375 | Bacteria | 4129 |
| 78 | Ga0105239_10107248 | 3300010375 | Bacteria | 3094 |
| 79 | Ga0105239_10423443 | 3300010375 | Bacteria | 1508 |
| 80 | Ga0157373_10000480 | 3300013100 | Bacteria | 31713 |
| 81 | Ga0157373_10258152 | 3300013100 | Bacteria | 1233 |
| 82 | Ga0157371_10000276 | 3300013102 | Bacteria | 69547 |
| 83 | Ga0157371_10000998 | 3300013102 | Bacteria | 31279 |
| 84 | Ga0157371_10004483 | 3300013102 | Bacteria | 12178 |
| 85 | Ga0157371_10009933 | 3300013102 | Bacteria | 7451 |
| 86 | Ga0157371_10010559 | 3300013102 | Bacteria | 7177 |
| 87 | Ga0157371_10024422 | 3300013102 | Bacteria | 4413 |
| 88 | Ga0157371_10047446 | 3300013102 | Bacteria | 3054 |
| 89 | Ga0157371_10141179 | 3300013102 | Unclassified | 1715 |
| 90 | Ga0157370_10002270 | 3300013104 | Bacteria | 23330 |
| 91 | Ga0157370_10002639 | 3300013104 | Bacteria | 21536 |
| 92 | Ga0157370_10005312 | 3300013104 | Bacteria | 14472 |
| 93 | Ga0157370_10082990 | 3300013104 | Unclassified | 3014 |
| 94 | Ga0157370_10172102 | 3300013104 | Bacteria | 2013 |
| 95 | Ga0157370_10260368 | 3300013104 | Bacteria | 1603 |
| 96 | Ga0157369_10000040 | 3300013105 | Bacteria | 183469 |
| 97 | Ga0157369_10018288 | 3300013105 | Bacteria | 7860 |
| 98 | Ga0157369_10098378 | 3300013105 | Bacteria | 3120 |
| 99 | Ga0157369_10118769 | 3300013105 | Unclassified | 2806 |
| 100 | Ga0157374_10000137 | 3300013296 | Bacteria | 66006 |
| 101 | Ga0157378_10023504 | 3300013297 | Bacteria | 5423 |
| 102 | Ga0157378_10281634 | 3300013297 | Bacteria | 1603 |
| 103 | Ga0163162_10000026 | 3300013306 | Bacteria | 178701 |
| 104 | Ga0163162_10004457 | 3300013306 | Bacteria | 13490 |
| 105 | Ga0163162_10021695 | 3300013306 | Bacteria | 6325 |
| 106 | Ga0157372_10000228 | 3300013307 | Bacteria | 62408 |
| 107 | Ga0157372_10000296 | 3300013307 | Bacteria | 55447 |
| 108 | Ga0157372_10002785 | 3300013307 | Bacteria | 18895 |
| 109 | Ga0157372_10039367 | 3300013307 | Bacteria | 5217 |
| 110 | Ga0157372_10055428 | 3300013307 | Bacteria | 4427 |
| 111 | Ga0157372_10071543 | 3300013307 | Bacteria | 3906 |
| 112 | Ga0157372_10074458 | 3300013307 | Bacteria | 3829 |
| 113 | Ga0157372_10290577 | 3300013307 | Bacteria | 1901 |
| 114 | Ga0157372_10416229 | 3300013307 | Bacteria | 1566 |
| 115 | Ga0157375_10009717 | 3300013308 | Bacteria | 8458 |
| 116 | Ga0157375_10021830 | 3300013308 | Bacteria | 5881 |
| 117 | Ga0182006_1000302 | 3300015261 | Bacteria | 43116 |
| 118 | Ga0182006_1001597 | 3300015261 | Bacteria | 13410 |
| 119 | Ga0182006_1003223 | 3300015261 | Bacteria | 8475 |
| 120 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 121 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 122 | Ga0163161_10000284 | 3300017792 | Bacteria | 44309 |
| 123 | Ga0163161_10001539 | 3300017792 | Bacteria | 17026 |
| 124 | Ga0213872_10009434 | 3300021361 | Bacteria | 4679 |
| 125 | Ga0209436_106935 | 3300025208 | Bacteria | 2421 |
| 126 | Ga0207427_100159 | 3300025231 | Bacteria | 76256 |
| 127 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 128 | Ga0209026_1008917 | 3300025250 | Bacteria | 2032 |
| 129 | Ga0209026_1010986 | 3300025250 | Bacteria | 1658 |
| 130 | Ga0209148_1016117 | 3300025254 | Bacteria | 1292 |
| 131 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 132 | Ga0209233_1001666 | 3300025261 | Bacteria | 8650 |
| 133 | Ga0209455_1004652 | 3300025272 | Bacteria | 4423 |
| 134 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 135 | Ga0209050_1000055 | 3300025298 | Bacteria | 339254 |
| 136 | Ga0207426_1000135 | 3300025302 | Bacteria | 202216 |
| 137 | Ga0207647_10000049 | 3300025904 | Bacteria | 88392 |
| 138 | Ga0207647_10000368 | 3300025904 | Bacteria | 36725 |
| 139 | Ga0207645_10000058 | 3300025907 | Bacteria | 78487 |
| 140 | Ga0207654_10010359 | 3300025911 | Bacteria | 4747 |
| 141 | Ga0207707_10003937 | 3300025912 | Bacteria | 13190 |
| 142 | Ga0207695_10003843 | 3300025913 | Bacteria | 20795 |
| 143 | Ga0207695_10056707 | 3300025913 | Bacteria | 4075 |
| 144 | Ga0207695_10228228 | 3300025913 | Bacteria | 1767 |
| 145 | Ga0207671_10001256 | 3300025914 | Bacteria | 29879 |
| 146 | Ga0207671_10072031 | 3300025914 | Bacteria | 2578 |
| 147 | Ga0207660_10069123 | 3300025917 | Bacteria | 2563 |
| 148 | Ga0207657_10007096 | 3300025919 | Bacteria | 11513 |
| 149 | Ga0207657_10039808 | 3300025919 | Bacteria | 4172 |
| 150 | Ga0207657_10080308 | 3300025919 | Bacteria | 2742 |
| 151 | Ga0207652_10000016 | 3300025921 | Bacteria | 188815 |
| 152 | Ga0207652_10005245 | 3300025921 | Bacteria | 10532 |
| 153 | Ga0207644_10008722 | 3300025931 | Bacteria | 6637 |
| 154 | Ga0207690_10000302 | 3300025932 | Bacteria | 34397 |
| 155 | Ga0207690_10002357 | 3300025932 | Bacteria | 11464 |
| 156 | Ga0207690_10293034 | 3300025932 | Bacteria | 1271 |
| 157 | Ga0207706_10000111 | 3300025933 | Bacteria | 87282 |
| 158 | Ga0207686_10049374 | 3300025934 | Bacteria | 2612 |
| 159 | Ga0207704_10000152 | 3300025938 | Bacteria | 37143 |
| 160 | Ga0207691_10087873 | 3300025940 | Bacteria | 2788 |
| 161 | Ga0207689_10067487 | 3300025942 | Bacteria | 2939 |
| 162 | Ga0207667_10172426 | 3300025949 | Bacteria | 2223 |
| 163 | Ga0207667_10174486 | 3300025949 | Bacteria | 2209 |
| 164 | Ga0207703_10069276 | 3300026035 | Bacteria | 2909 |
| 165 | Ga0207648_10002875 | 3300026089 | Bacteria | 18229 |
| 166 | Ga0207674_10038635 | 3300026116 | Bacteria | 4951 |
| 167 | Ga0207674_10046923 | 3300026116 | Bacteria | 4432 |
| 168 | Ga0207698_10091370 | 3300026142 | Unclassified | 2492 |
| 169 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 170 | Ga0307515_10074920 | 3300028794 | Bacteria | 4518 |
| 171 | Ga0307509_10049621 | 3300031507 | Bacteria | 4499 |
| 172 | Ga0307408_100000340 | 3300031548 | Bacteria | 44104 |
| 173 | Ga0307408_100002479 | 3300031548 | Bacteria | 12928 |
| 174 | Ga0307408_100003293 | 3300031548 | Bacteria | 11109 |
| 175 | Ga0307408_100007348 | 3300031548 | Bacteria | 7290 |
| 176 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 177 | Ga0307412_10002965 | 3300031911 | Bacteria | 9418 |
| 178 | Ga0307412_10255154 | 3300031911 | Bacteria | 1364 |
| 179 | Ga0307409_100430415 | 3300031995 | Bacteria | 1268 |
| 180 | Ga0307416_100000014 | 3300032002 | Bacteria | 249053 |
| 181 | Ga0307416_100035152 | 3300032002 | Bacteria | 3823 |
| 182 | Ga0307414_10004388 | 3300032004 | Bacteria | 7660 |
| 183 | Ga0307414_10276534 | 3300032004 | Bacteria | 1409 |
| 184 | Ga0395899_0013151 | 3300037312 | Bacteria | 6328 |
| 185 | Ga0395900_0099243 | 3300037418 | Bacteria | 2991 |
| 186 | Ga0395900_0444319 | 3300037418 | Bacteria | 1254 |
| 187 | Ga0395898_0003621 | 3300037466 | Bacteria | 17202 |
| 188 | Ga0395901_0054180 | 3300038443 | Bacteria | 4168 |
| 189 | Ga0436361_0137765 | 3300039447 | Bacteria | 20400 |
| 190 | Ga0439431_0000333 | 3300041997 | Bacteria | 9831 |
| 191 | Ga0451577_0315214 | 3300042876 | Bacteria | 1418 |
| 192 | Ga0453684_0058238 | 3300044712 | Bacteria | 4991 |
| 193 | Ga0453684_0184231 | 3300044712 | Bacteria | 2448 |
| 194 | Ga0451576_0000828 | 3300045051 | Bacteria | 60328 |
| 195 | Ga0495585_0000290 | 3300046492 | Bacteria | 50496 |
| 196 | Ga0495610_0000062 | 3300046512 | Bacteria | 128923 |
| 197 | Ga0495610_0000889 | 3300046512 | Bacteria | 27794 |
| 198 | Ga0495610_0001152 | 3300046512 | Bacteria | 24038 |
| 199 | Ga0495616_0013733 | 3300046513 | Bacteria | 4559 |
| 200 | Ga0495616_0019402 | 3300046513 | Bacteria | 3711 |
| 201 | Ga0495648_0002877 | 3300046524 | Bacteria | 15501 |
| 202 | Ga0495648_0047607 | 3300046524 | Bacteria | 2648 |
| 203 | Ga0495652_0110203 | 3300046529 | Bacteria | 2215 |
| 204 | Ga0495654_0082386 | 3300046530 | Bacteria | 1506 |
| 205 | Ga0495609_0021998 | 3300046538 | Bacteria | 2940 |
| 206 | Ga0495633_0001742 | 3300046558 | Bacteria | 16209 |
| 207 | Ga0495668_0000021 | 3300046616 | Bacteria | 381308 |
| 208 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 209 | Ga0495625_0001186 | 3300046660 | Bacteria | 33408 |
| 210 | Ga0495625_0177104 | 3300046660 | Bacteria | 1420 |
| 211 | Ga0495661_0007042 | 3300046665 | Bacteria | 7859 |
| 212 | Ga0495658_0089842 | 3300046683 | Bacteria | 1817 |
| 213 | Ga0495649_0000006 | 3300046694 | Bacteria | 542188 |
| 214 | Ga0495686_0034004 | 3300047472 | Bacteria | 3286 |
| 215 | Ga0496117_0003230 | 3300048920 | Bacteria | 19233 |
| 216 | Ga0496122_0023576 | 3300048925 | Bacteria | 5417 |
| 217 | Ga0496123_0032954 | 3300048926 | Bacteria | 3737 |
| 218 | Ga0495678_019323 | 3300049459 | Bacteria | 3042 |
| 219 | Ga0501043_0246764 | 3300049579 | Unclassified | 1376 |
| 220 | Ga0501217_002732 | 3300049661 | Bacteria | 3502 |
| 221 | Ga0501223_002238 | 3300049663 | Bacteria | 4327 |
| 222 | Ga0501223_002851 | 3300049663 | Bacteria | 3793 |
| 223 | Ga0501223_009029 | 3300049663 | Unclassified | 2025 |
| 224 | Ga0501249_000004 | 3300049679 | Bacteria | 226777 |
| 225 | Ga0501219_000022 | 3300049703 | Bacteria | 24237 |
| 226 | Ga0501221_024265 | 3300049704 | Bacteria | 1216 |
| 227 | Ga0501284_00068 | 3300050005 | Bacteria | 31369 |
| 228 | nmdc:mga0k408_1183_c1 | 3300050493 | Bacteria | 14280 |
| 229 | nmdc:mga0k408_522_c1 | 3300050493 | Bacteria | 21138 |
| 230 | Ga0500641_0001869 | 3300053096 | Bacteria | 7469 |
| 231 | Ga0500622_0000281 | 3300053156 | Bacteria | 51900 |
| 232 | Ga0500624_000630 | 3300053157 | Bacteria | 9398 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221716 | 2644641344 | 328 |
| 2 | iso_pu_bacteria | 2919191525 | 2919192458 | 328 |
| 3 | iso_pu_bacteria | 2965320100 | 2965321448 | 328 |
| 4 | 3300053096 | Ga0500641_0001869 | Ga0500641_0001869_859_1902 | 329 |
| 5 | 3300031548 | Ga0307408_100002479 | Ga0307408_1000024792 | 330 |
| 6 | 3300032002 | Ga0307416_100035152 | Ga0307416_1000351522 | 330 |
| 7 | 3300005293 | Ga0065715_10026982 | Ga0065715_100269822 | 332 |
| 8 | 3300013102 | Ga0157371_10024422 | Ga0157371_100244221 | 332 |
| 9 | 3300025250 | Ga0209026_1008917 | Ga0209026_10089172 | 332 |
| 10 | 3300042876 | Ga0451577_0315214 | Ga0451577_0315214_193_1194 | 332 |
| 11 | 3300044712 | Ga0453684_0058238 | Ga0453684_0058238_1134_2135 | 332 |
| 12 | 3300044712 | Ga0453684_0184231 | Ga0453684_0184231_1158_2159 | 332 |
| 13 | 3300045051 | Ga0451576_0000828 | Ga0451576_0000828_56585_57586 | 332 |
| 14 | 3300005339 | Ga0070660_100182801 | Ga0070660_1001828012 | 333 |
| 15 | 3300005366 | Ga0070659_100012780 | Ga0070659_1000127805 | 333 |
| 16 | 3300005366 | Ga0070659_100048236 | Ga0070659_1000482362 | 333 |
| 17 | 3300005530 | Ga0070679_100009588 | Ga0070679_1000095885 | 333 |
| 18 | 3300005563 | Ga0068855_100035459 | Ga0068855_1000354595 | 333 |
| 19 | 3300013104 | Ga0157370_10005312 | Ga0157370_100053126 | 333 |
| 20 | 3300013307 | Ga0157372_10055428 | Ga0157372_100554283 | 333 |
| 21 | 3300025921 | Ga0207652_10000016 | Ga0207652_1000001650 | 333 |
| 22 | 3300025949 | Ga0207667_10172426 | Ga0207667_101724262 | 333 |
| 23 | 3300037312 | Ga0395899_0013151 | Ga0395899_0013151_4358_5383 | 333 |
| 24 | 3300037418 | Ga0395900_0099243 | Ga0395900_0099243_757_1782 | 333 |
| 25 | 3300037466 | Ga0395898_0003621 | Ga0395898_0003621_8787_9812 | 333 |
| 26 | 3300038443 | Ga0395901_0054180 | Ga0395901_0054180_3090_4115 | 333 |
| 27 | iso_pu_bacteria | 2513020052 | 2513233584 | 333 |
| 28 | 3300013105 | Ga0157369_10118769 | Ga0157369_101187692 | 337 |
| 29 | 3300049661 | Ga0501217_002732 | Ga0501217_002732_822_1841 | 337 |
| 30 | 3300049663 | Ga0501223_009029 | Ga0501223_009029_712_1731 | 337 |
| 31 | 3300049679 | Ga0501249_000004 | Ga0501249_000004_50512_51555 | 337 |
| 32 | 3300049704 | Ga0501221_024265 | Ga0501221_024265_66_1085 | 337 |
| 33 | iso_pu_bacteria | 2643221600 | 2644012078 | 337 |
| 34 | iso_pu_bacteria | 8054307821 | 8054310813 | 337 |
| 35 | iso_pu_bacteria | 2775506987 | 2776614773 | 338 |
| 36 | iso_pu_bacteria | 2585427687 | 2586208983 | 339 |
| 37 | iso_pu_bacteria | 2738541302 | 2738851992 | 339 |
| 38 | iso_pu_bacteria | 2739367651 | 2739590872 | 339 |
| 39 | iso_pu_bacteria | 2818991437 | 2819546541 | 339 |
| 40 | iso_pu_bacteria | 2840677318 | 2840679311 | 339 |
| 41 | iso_pu_bacteria | 2842722452 | 2842725233 | 339 |
| 42 | iso_pu_bacteria | 2842909656 | 2842912508 | 339 |
| 43 | iso_pu_bacteria | 2849281842 | 2849286814 | 339 |
| 44 | iso_pu_bacteria | 2852627209 | 2852629842 | 339 |
| 45 | iso_pu_bacteria | 2857627736 | 2857629698 | 339 |
| 46 | iso_pu_bacteria | 2896085136 | 2896087122 | 339 |
| 47 | iso_pu_bacteria | 2896109856 | 2896114092 | 339 |
| 48 | iso_pu_bacteria | 2919437846 | 2919440689 | 339 |
| 49 | iso_pu_bacteria | 2928078545 | 2928079348 | 339 |
| 50 | iso_pu_bacteria | 2928147474 | 2928148171 | 339 |
| 51 | iso_pu_bacteria | 2929177148 | 2929180847 | 339 |
| 52 | iso_pu_bacteria | 2945977869 | 2945983246 | 339 |
| 53 | iso_pu_bacteria | 2945997725 | 2946002155 | 339 |
| 54 | iso_pu_bacteria | 2946013367 | 2946017363 | 339 |
| 55 | iso_pu_bacteria | 2954016120 | 2954019053 | 339 |
| 56 | iso_pu_bacteria | 2977232053 | 2977233934 | 339 |
| 57 | iso_pu_bacteria | 2721755487 | 2722730693 | 340 |
| 58 | iso_pu_bacteria | 2890737413 | 2890739371 | 340 |
| 59 | 3300001989 | JGI24739J22299_10022800 | JGI24739J22299_100228002 | 341 |
| 60 | 3300001990 | JGI24737J22298_10010086 | JGI24737J22298_100100863 | 341 |
| 61 | 3300002067 | JGI24735J21928_10000040 | JGI24735J21928_100000406 | 341 |
| 62 | 3300002737 | JGI25162J39368_1002645 | JGI25162J39368_10026452 | 341 |
| 63 | 3300002772 | JGI25164J39214_1001242 | JGI25164J39214_10012427 | 341 |
| 64 | 3300003214 | JGI25165J46597_1001079 | JGI25165J46597_100107912 | 341 |
| 65 | 3300003320 | rootH2_10001273 | rootH2_10001273138 | 341 |
| 66 | 3300003323 | rootH1_10156687 | rootH1_101566873 | 341 |
| 67 | 3300005328 | Ga0070676_10000015 | Ga0070676_1000001512 | 341 |
| 68 | 3300005339 | Ga0070660_100197772 | Ga0070660_1001977722 | 341 |
| 69 | 3300005355 | Ga0070671_100000813 | Ga0070671_1000008135 | 341 |
| 70 | 3300005366 | Ga0070659_100001837 | Ga0070659_1000018377 | 341 |
| 71 | 3300005366 | Ga0070659_100330193 | Ga0070659_1003301931 | 341 |
| 72 | 3300005457 | Ga0070662_100001108 | Ga0070662_1000011084 | 341 |
| 73 | 3300005459 | Ga0068867_100000210 | Ga0068867_1000002103 | 341 |
| 74 | 3300005539 | Ga0068853_100017039 | Ga0068853_1000170394 | 341 |
| 75 | 3300005548 | Ga0070665_100000017 | Ga0070665_100000017120 | 341 |
| 76 | 3300005563 | Ga0068855_100543656 | Ga0068855_1005436561 | 341 |
| 77 | 3300005842 | Ga0068858_100032875 | Ga0068858_1000328753 | 341 |
| 78 | 3300006237 | Ga0097621_100000308 | Ga0097621_10000030832 | 341 |
| 79 | 3300006358 | Ga0068871_100000046 | Ga0068871_10000004643 | 341 |
| 80 | 3300006881 | Ga0068865_100000041 | Ga0068865_10000004161 | 341 |
| 81 | 3300009093 | Ga0105240_10037052 | Ga0105240_100370523 | 341 |
| 82 | 3300009174 | Ga0105241_10016943 | Ga0105241_100169435 | 341 |
| 83 | 3300009545 | Ga0105237_10208258 | Ga0105237_102082581 | 341 |
| 84 | 3300010375 | Ga0105239_10051186 | Ga0105239_100511861 | 341 |
| 85 | 3300010375 | Ga0105239_10107248 | Ga0105239_101072482 | 341 |
| 86 | 3300013100 | Ga0157373_10000480 | Ga0157373_1000048024 | 341 |
| 87 | 3300013100 | Ga0157373_10258152 | Ga0157373_102581521 | 341 |
| 88 | 3300013102 | Ga0157371_10004483 | Ga0157371_100044835 | 341 |
| 89 | 3300013102 | Ga0157371_10010559 | Ga0157371_100105593 | 341 |
| 90 | 3300013102 | Ga0157371_10141179 | Ga0157371_101411791 | 341 |
| 91 | 3300013104 | Ga0157370_10082990 | Ga0157370_100829901 | 341 |
| 92 | 3300013104 | Ga0157370_10260368 | Ga0157370_102603682 | 341 |
| 93 | 3300013105 | Ga0157369_10018288 | Ga0157369_100182887 | 341 |
| 94 | 3300013296 | Ga0157374_10000137 | Ga0157374_1000013729 | 341 |
| 95 | 3300013297 | Ga0157378_10023504 | Ga0157378_100235043 | 341 |
| 96 | 3300013306 | Ga0163162_10000026 | Ga0163162_1000002633 | 341 |
| 97 | 3300013306 | Ga0163162_10004457 | Ga0163162_100044572 | 341 |
| 98 | 3300013307 | Ga0157372_10000228 | Ga0157372_1000022850 | 341 |
| 99 | 3300013307 | Ga0157372_10000296 | Ga0157372_1000029619 | 341 |
| 100 | 3300013307 | Ga0157372_10039367 | Ga0157372_100393673 | 341 |
| 101 | 3300013307 | Ga0157372_10074458 | Ga0157372_100744583 | 341 |
| 102 | 3300013308 | Ga0157375_10021830 | Ga0157375_100218303 | 341 |
| 103 | 3300021361 | Ga0213872_10009434 | Ga0213872_100094343 | 341 |
| 104 | 3300025231 | Ga0207427_100159 | Ga0207427_10015967 | 341 |
| 105 | 3300025233 | Ga0209437_100021 | Ga0209437_10002187 | 341 |
| 106 | 3300025250 | Ga0209026_1010986 | Ga0209026_10109862 | 341 |
| 107 | 3300025254 | Ga0209148_1016117 | Ga0209148_10161171 | 341 |
| 108 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035550 | 341 |
| 109 | 3300025261 | Ga0209233_1001666 | Ga0209233_10016662 | 341 |
| 110 | 3300025272 | Ga0209455_1004652 | Ga0209455_10046522 | 341 |
| 111 | 3300025904 | Ga0207647_10000049 | Ga0207647_1000004951 | 341 |
| 112 | 3300025904 | Ga0207647_10000368 | Ga0207647_100003686 | 341 |
| 113 | 3300025907 | Ga0207645_10000058 | Ga0207645_1000005862 | 341 |
| 114 | 3300025913 | Ga0207695_10003843 | Ga0207695_1000384316 | 341 |
| 115 | 3300025919 | Ga0207657_10007096 | Ga0207657_100070966 | 341 |
| 116 | 3300025919 | Ga0207657_10039808 | Ga0207657_100398084 | 341 |
| 117 | 3300025931 | Ga0207644_10008722 | Ga0207644_100087225 | 341 |
| 118 | 3300025932 | Ga0207690_10002357 | Ga0207690_100023571 | 341 |
| 119 | 3300025932 | Ga0207690_10293034 | Ga0207690_102930341 | 341 |
| 120 | 3300025933 | Ga0207706_10000111 | Ga0207706_1000011150 | 341 |
| 121 | 3300025938 | Ga0207704_10000152 | Ga0207704_1000015220 | 341 |
| 122 | 3300026035 | Ga0207703_10069276 | Ga0207703_100692762 | 341 |
| 123 | 3300028379 | Ga0268266_10000037 | Ga0268266_10000037197 | 341 |
| 124 | 3300031548 | Ga0307408_100000340 | Ga0307408_10000034025 | 341 |
| 125 | 3300031548 | Ga0307408_100003293 | Ga0307408_1000032934 | 341 |
| 126 | 3300031995 | Ga0307409_100430415 | Ga0307409_1004304152 | 341 |
| 127 | 3300037418 | Ga0395900_0444319 | Ga0395900_0444319_25_1050 | 341 |
| 128 | 3300039447 | Ga0436361_0137765 | Ga0436361_0137765_5707_6732 | 341 |
| 129 | 3300046512 | Ga0495610_0000062 | Ga0495610_0000062_53168_54193 | 341 |
| 130 | 3300046558 | Ga0495633_0001742 | Ga0495633_0001742_11052_12077 | 341 |
| 131 | 3300046665 | Ga0495661_0007042 | Ga0495661_0007042_4198_5223 | 341 |
| 132 | 3300049663 | Ga0501223_002238 | Ga0501223_002238_592_1641 | 341 |
| 133 | iso_pu_bacteria | 2896317667 | 2896319201 | 341 |
| 134 | iso_pu_bacteria | 3003233435 | 3003236093 | 341 |
| 135 | 2162886007 | SwRhRL2b_contig_1214182 | SwRhRL2b_0492.00007110 | 342 |
| 136 | 3300001979 | JGI24740J21852_10018664 | JGI24740J21852_100186642 | 342 |
| 137 | 3300001990 | JGI24737J22298_10000486 | JGI24737J22298_100004866 | 342 |
| 138 | 3300002067 | JGI24735J21928_10000001 | JGI24735J21928_10000001173 | 342 |
| 139 | 3300003320 | rootH2_10160524 | rootH2_101605243 | 342 |
| 140 | 3300003320 | rootH2_10301589 | rootH2_103015892 | 342 |
| 141 | 3300003323 | rootH1_10356556 | rootH1_103565562 | 342 |
| 142 | 3300003791 | Ga0055530_10002315 | Ga0055530_100023155 | 342 |
| 143 | 3300005289 | Ga0065704_10000769 | Ga0065704_100007695 | 342 |
| 144 | 3300005289 | Ga0065704_10118604 | Ga0065704_101186042 | 342 |
| 145 | 3300005331 | Ga0070670_100240469 | Ga0070670_1002404692 | 342 |
| 146 | 3300005334 | Ga0068869_100049007 | Ga0068869_1000490072 | 342 |
| 147 | 3300005336 | Ga0070680_100001527 | Ga0070680_1000015276 | 342 |
| 148 | 3300005337 | Ga0070682_100001986 | Ga0070682_1000019865 | 342 |
| 149 | 3300005339 | Ga0070660_100079228 | Ga0070660_1000792282 | 342 |
| 150 | 3300005341 | Ga0070691_10009319 | Ga0070691_100093192 | 342 |
| 151 | 3300005366 | Ga0070659_100003795 | Ga0070659_1000037957 | 342 |
| 152 | 3300005458 | Ga0070681_10009603 | Ga0070681_100096035 | 342 |
| 153 | 3300005530 | Ga0070679_100125660 | Ga0070679_1001256601 | 342 |
| 154 | 3300005539 | Ga0068853_100243082 | Ga0068853_1002430821 | 342 |
| 155 | 3300005539 | Ga0068853_100357256 | Ga0068853_1003572562 | 342 |
| 156 | 3300005547 | Ga0070693_100003359 | Ga0070693_1000033593 | 342 |
| 157 | 3300005547 | Ga0070693_100227688 | Ga0070693_1002276882 | 342 |
| 158 | 3300005563 | Ga0068855_100328814 | Ga0068855_1003288142 | 342 |
| 159 | 3300005577 | Ga0068857_100034693 | Ga0068857_1000346933 | 342 |
| 160 | 3300005577 | Ga0068857_100063356 | Ga0068857_1000633563 | 342 |
| 161 | 3300005577 | Ga0068857_100101474 | Ga0068857_1001014742 | 342 |
| 162 | 3300005616 | Ga0068852_100236281 | Ga0068852_1002362812 | 342 |
| 163 | 3300005617 | Ga0068859_100495253 | Ga0068859_1004952532 | 342 |
| 164 | 3300005718 | Ga0068866_10013871 | Ga0068866_100138712 | 342 |
| 165 | 3300005843 | Ga0068860_100069780 | Ga0068860_1000697802 | 342 |
| 166 | 3300006058 | Ga0075432_10061477 | Ga0075432_100614772 | 342 |
| 167 | 3300006195 | Ga0075366_10000387 | Ga0075366_1000038712 | 342 |
| 168 | 3300006195 | Ga0075366_10003776 | Ga0075366_100037763 | 342 |
| 169 | 3300006931 | Ga0097620_100495258 | Ga0097620_1004952582 | 342 |
| 170 | 3300009093 | Ga0105240_10044397 | Ga0105240_100443974 | 342 |
| 171 | 3300009093 | Ga0105240_10072391 | Ga0105240_100723912 | 342 |
| 172 | 3300009174 | Ga0105241_10002777 | Ga0105241_100027777 | 342 |
| 173 | 3300009176 | Ga0105242_10034989 | Ga0105242_100349892 | 342 |
| 174 | 3300009545 | Ga0105237_10000287 | Ga0105237_1000028726 | 342 |
| 175 | 3300009545 | Ga0105237_10039774 | Ga0105237_100397742 | 342 |
| 176 | 3300009545 | Ga0105237_10167449 | Ga0105237_101674492 | 342 |
| 177 | 3300010375 | Ga0105239_10000619 | Ga0105239_1000061923 | 342 |
| 178 | 3300010375 | Ga0105239_10006457 | Ga0105239_100064574 | 342 |
| 179 | 3300010375 | Ga0105239_10061262 | Ga0105239_100612623 | 342 |
| 180 | 3300010375 | Ga0105239_10423443 | Ga0105239_104234432 | 342 |
| 181 | 3300013102 | Ga0157371_10000276 | Ga0157371_1000027620 | 342 |
| 182 | 3300013102 | Ga0157371_10000998 | Ga0157371_1000099814 | 342 |
| 183 | 3300013102 | Ga0157371_10009933 | Ga0157371_100099333 | 342 |
| 184 | 3300013102 | Ga0157371_10047446 | Ga0157371_100474462 | 342 |
| 185 | 3300013104 | Ga0157370_10002270 | Ga0157370_100022707 | 342 |
| 186 | 3300013104 | Ga0157370_10002639 | Ga0157370_100026394 | 342 |
| 187 | 3300013104 | Ga0157370_10172102 | Ga0157370_101721022 | 342 |
| 188 | 3300013105 | Ga0157369_10000040 | Ga0157369_10000040124 | 342 |
| 189 | 3300013105 | Ga0157369_10098378 | Ga0157369_100983783 | 342 |
| 190 | 3300013297 | Ga0157378_10281634 | Ga0157378_102816342 | 342 |
| 191 | 3300013306 | Ga0163162_10021695 | Ga0163162_100216952 | 342 |
| 192 | 3300013307 | Ga0157372_10002785 | Ga0157372_100027859 | 342 |
| 193 | 3300013307 | Ga0157372_10071543 | Ga0157372_100715432 | 342 |
| 194 | 3300013307 | Ga0157372_10290577 | Ga0157372_102905772 | 342 |
| 195 | 3300013307 | Ga0157372_10416229 | Ga0157372_104162292 | 342 |
| 196 | 3300013308 | Ga0157375_10009717 | Ga0157375_100097174 | 342 |
| 197 | 3300015261 | Ga0182006_1000302 | Ga0182006_100030216 | 342 |
| 198 | 3300015261 | Ga0182006_1001597 | Ga0182006_10015972 | 342 |
| 199 | 3300015261 | Ga0182006_1003223 | Ga0182006_10032234 | 342 |
| 200 | 3300015262 | Ga0182007_10000003 | Ga0182007_10000003492 | 342 |
| 201 | 3300015682 | Ga0183373_1001 | Ga0183373_1001487 | 342 |
| 202 | 3300017792 | Ga0163161_10000284 | Ga0163161_1000028410 | 342 |
| 203 | 3300017792 | Ga0163161_10001539 | Ga0163161_100015399 | 342 |
| 204 | 3300025208 | Ga0209436_106935 | Ga0209436_1069354 | 342 |
| 205 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008380 | 342 |
| 206 | 3300025298 | Ga0209050_1000055 | Ga0209050_100005532 | 342 |
| 207 | 3300025302 | Ga0207426_1000135 | Ga0207426_100013519 | 342 |
| 208 | 3300025911 | Ga0207654_10010359 | Ga0207654_100103593 | 342 |
| 209 | 3300025912 | Ga0207707_10003937 | Ga0207707_100039372 | 342 |
| 210 | 3300025913 | Ga0207695_10056707 | Ga0207695_100567073 | 342 |
| 211 | 3300025913 | Ga0207695_10228228 | Ga0207695_102282281 | 342 |
| 212 | 3300025914 | Ga0207671_10001256 | Ga0207671_1000125612 | 342 |
| 213 | 3300025914 | Ga0207671_10072031 | Ga0207671_100720312 | 342 |
| 214 | 3300025917 | Ga0207660_10069123 | Ga0207660_100691232 | 342 |
| 215 | 3300025919 | Ga0207657_10080308 | Ga0207657_100803083 | 342 |
| 216 | 3300025921 | Ga0207652_10005245 | Ga0207652_100052455 | 342 |
| 217 | 3300025932 | Ga0207690_10000302 | Ga0207690_100003025 | 342 |
| 218 | 3300025934 | Ga0207686_10049374 | Ga0207686_100493743 | 342 |
| 219 | 3300025940 | Ga0207691_10087873 | Ga0207691_100878732 | 342 |
| 220 | 3300025942 | Ga0207689_10067487 | Ga0207689_100674872 | 342 |
| 221 | 3300025949 | Ga0207667_10174486 | Ga0207667_101744861 | 342 |
| 222 | 3300026089 | Ga0207648_10002875 | Ga0207648_100028756 | 342 |
| 223 | 3300026116 | Ga0207674_10038635 | Ga0207674_100386354 | 342 |
| 224 | 3300026116 | Ga0207674_10046923 | Ga0207674_100469232 | 342 |
| 225 | 3300026142 | Ga0207698_10091370 | Ga0207698_100913702 | 342 |
| 226 | 3300028794 | Ga0307515_10074920 | Ga0307515_100749201 | 342 |
| 227 | 3300031507 | Ga0307509_10049621 | Ga0307509_100496213 | 342 |
| 228 | 3300031548 | Ga0307408_100007348 | Ga0307408_1000073488 | 342 |
| 229 | 3300031731 | Ga0307405_10000003 | Ga0307405_10000003275 | 342 |
| 230 | 3300031911 | Ga0307412_10002965 | Ga0307412_100029651 | 342 |
| 231 | 3300031911 | Ga0307412_10255154 | Ga0307412_102551541 | 342 |
| 232 | 3300032002 | Ga0307416_100000014 | Ga0307416_10000001484 | 342 |
| 233 | 3300032004 | Ga0307414_10004388 | Ga0307414_100043882 | 342 |
| 234 | 3300032004 | Ga0307414_10276534 | Ga0307414_102765341 | 342 |
| 235 | 3300041997 | Ga0439431_0000333 | Ga0439431_0000333_7982_9013 | 342 |
| 236 | 3300046492 | Ga0495585_0000290 | Ga0495585_0000290_15683_16714 | 342 |
| 237 | 3300046512 | Ga0495610_0000889 | Ga0495610_0000889_12729_13760 | 342 |
| 238 | 3300046512 | Ga0495610_0001152 | Ga0495610_0001152_10442_11473 | 342 |
| 239 | 3300046513 | Ga0495616_0013733 | Ga0495616_0013733_1488_2519 | 342 |
| 240 | 3300046513 | Ga0495616_0019402 | Ga0495616_0019402_249_1352 | 342 |
| 241 | 3300046524 | Ga0495648_0002877 | Ga0495648_0002877_14315_15346 | 342 |
| 242 | 3300046524 | Ga0495648_0047607 | Ga0495648_0047607_297_1328 | 342 |
| 243 | 3300046529 | Ga0495652_0110203 | Ga0495652_0110203_722_1753 | 342 |
| 244 | 3300046530 | Ga0495654_0082386 | Ga0495654_0082386_289_1320 | 342 |
| 245 | 3300046538 | Ga0495609_0021998 | Ga0495609_0021998_922_2025 | 342 |
| 246 | 3300046616 | Ga0495668_0000021 | Ga0495668_0000021_280493_281524 | 342 |
| 247 | 3300046660 | Ga0495625_0000008 | Ga0495625_0000008_22488_23591 | 342 |
| 248 | 3300046660 | Ga0495625_0001186 | Ga0495625_0001186_3921_4952 | 342 |
| 249 | 3300046660 | Ga0495625_0177104 | Ga0495625_0177104_343_1374 | 342 |
| 250 | 3300046683 | Ga0495658_0089842 | Ga0495658_0089842_531_1562 | 342 |
| 251 | 3300046694 | Ga0495649_0000006 | Ga0495649_0000006_247988_249091 | 342 |
| 252 | 3300047472 | Ga0495686_0034004 | Ga0495686_0034004_549_1580 | 342 |
| 253 | 3300048920 | Ga0496117_0003230 | Ga0496117_0003230_17503_18540 | 342 |
| 254 | 3300048925 | Ga0496122_0023576 | Ga0496122_0023576_3155_4192 | 342 |
| 255 | 3300048926 | Ga0496123_0032954 | Ga0496123_0032954_216_1253 | 342 |
| 256 | 3300049459 | Ga0495678_019323 | Ga0495678_019323_211_1242 | 342 |
| 257 | 3300049579 | Ga0501043_0246764 | Ga0501043_0246764_334_1365 | 342 |
| 258 | 3300049663 | Ga0501223_002851 | Ga0501223_002851_1777_2823 | 342 |
| 259 | 3300049703 | Ga0501219_000022 | Ga0501219_000022_19477_20508 | 342 |
| 260 | 3300050005 | Ga0501284_00068 | Ga0501284_00068_27477_28508 | 342 |
| 261 | 3300050493 | nmdc:mga0k408_1183_c1 | nmdc:mga0k408_1183_c1_4359_5390 | 342 |
| 262 | 3300050493 | nmdc:mga0k408_522_c1 | nmdc:mga0k408_522_c1_2719_3750 | 342 |
| 263 | 3300053156 | Ga0500622_0000281 | Ga0500622_0000281_40248_41279 | 342 |
| 264 | 3300053157 | Ga0500624_000630 | Ga0500624_000630_148_1179 | 342 |
| 265 | iso_pu_bacteria | 2599185184 | 2599477435 | 342 |
| 266 | iso_pu_bacteria | 2932082852 | 2932084061 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3by6-assembly3.cif.gz_C | crystal structure of a transcriptional regulator from oenococcus oeni | 0.9823 | 17 | 83 |
| 2du9-assembly1.cif.gz_A | crystal structure of the transcriptional factor from c.glutamicum | 0.9755 | 17 | 83 |
| 5d4s-assembly1.cif.gz_B | crystal structure of arar(dbd) in complex with operator orx1 | 0.9416 | 17 | 83 |
| 3neu-assembly1.cif.gz_A-2 | the crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262 | 0.9401 | 12 | 84 |
| 4h0e-assembly1.cif.gz_A | crystal structure of mutant orr3 in complex with ntd of arar | 0.9394 | 17 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1P1_1_44_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9855 | 40 | 82 | 1.10.10.10 |
| af_P0ACM5_16_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.981 | 16 | 84 | 1.10.10.10 |
| af_Q2FWW6_10_126_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9739 | 17 | 84 | 1.10.10.10 |
| af_O06550_14_120_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9716 | 16 | 86 | 1.10.10.10 |
| 3by6E01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9687 | 17 | 84 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520IBS5-F1-model_v4 | Transcriptional regulator | 0.9936 | 99 | 342 |
|
| AF-A0A258JMW4-F1-model_v4 | Transcriptional regulator | 0.9927 | 160 | 342 |
|
| AF-A0A1H0CND2-F1-model_v4 | Transcriptional regulator, GntR family | 0.9908 | 9 | 83 |
GO:0003677
GO:0003700 |
| AF-A0A520IBS5-F1-model_v4 | Transcriptional regulator | 0.9895 | 99 | 342 |
|
| AF-A0A2Z4GGE8-F1-model_v4 | Transcriptional regulator | 0.986 | 7 | 342 |
GO:0003677
GO:0003700 GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar