F373748

General Info

Members Datasets Scaffolds Average Seq Length
266 173 232 347

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10000486|JGI24737J22298_100004866
Length 404
Sequence MFIPTASCTILIEGSLIVTNSSLYLFWLLIKLPRLTHAKGGRLIKPNLINFKFLPVASSIVMKSSRFLEYIYIDYYSSTPKYIQLANSIIKSVREGKLIINETLPSINELNCNFEISRDTAEKAYKHLKSIGLLGSVPGKGYYIKNTEAGQQFKVFLIFNKLSTHKKLVYDAIVDGLGHEAAIDFYIYNNDFEFFKKLLQNNSNDYTHYVILPHFMHGGENVHDIINTLPKEKLIILDKLVPGIKGDFAAVYENFEKDIYXALEEALPQLRKYHTLKXIFPEYTYFPGEILKGFFSFCIQYAFTYKVVHDIQGEPIHEGDVFINLMENDLVVLIERILATELKIGKDVGVISYNETPLKKIILNGLTTISTDFEQMGKMTAEIIKNGSTGRYEVPFYLTLRASL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
19 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
20 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
21 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
22 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
23 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
24 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
25 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
26 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
27 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
28 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
29 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
30 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
31 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
32 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
33 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
34 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
165 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
166 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
167 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
168 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
173 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.22
Metatranscriptomes 0
Isolates 12.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.89
Nodule 0
Rhizoplane 0.38
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 10.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1214182 2162886007 Bacteria 4939
2 JGI24740J21852_10018664 3300001979 Unclassified 2453
3 JGI24739J22299_10022800 3300001989 Unclassified 2218
4 JGI24737J22298_10000486 3300001990 Bacteria 13796
5 JGI24737J22298_10010086 3300001990 Bacteria 3129
6 JGI24735J21928_10000001 3300002067 Bacteria 650042
7 JGI24735J21928_10000040 3300002067 Bacteria 62364
8 JGI25162J39368_1002645 3300002737 Bacteria 6620
9 JGI25164J39214_1001242 3300002772 Bacteria 6779
10 JGI25165J46597_1001079 3300003214 Bacteria 17498
11 rootH2_10001273 3300003320 Bacteria 179792
12 rootH2_10160524 3300003320 Bacteria 2344
13 rootH2_10301589 3300003320 Bacteria 4090
14 rootH1_10156687 3300003323 Bacteria 2825
15 rootH1_10356556 3300003323 Bacteria 1532
16 Ga0055530_10002315 3300003791 Bacteria 12450
17 Ga0065704_10000769 3300005289 Bacteria 22711
18 Ga0065704_10118604 3300005289 Bacteria 1814
19 Ga0065715_10026982 3300005293 Bacteria 1472
20 Ga0070676_10000015 3300005328 Bacteria 52703
21 Ga0070670_100240469 3300005331 Bacteria 1576
22 Ga0068869_100049007 3300005334 Bacteria 3057
23 Ga0070680_100001527 3300005336 Bacteria 16861
24 Ga0070682_100001986 3300005337 Bacteria 11402
25 Ga0070660_100079228 3300005339 Bacteria 2577
26 Ga0070660_100182801 3300005339 Bacteria 1697
27 Ga0070660_100197772 3300005339 Bacteria 1630
28 Ga0070691_10009319 3300005341 Bacteria 4486
29 Ga0070671_100000813 3300005355 Bacteria 22610
30 Ga0070659_100001837 3300005366 Bacteria 15247
31 Ga0070659_100003795 3300005366 Bacteria 10784
32 Ga0070659_100012780 3300005366 Bacteria 6233
33 Ga0070659_100048236 3300005366 Bacteria 3345
34 Ga0070659_100330193 3300005366 Bacteria 1276
35 Ga0070662_100001108 3300005457 Bacteria 16442
36 Ga0070681_10009603 3300005458 Bacteria 9513
37 Ga0068867_100000210 3300005459 Bacteria 39145
38 Ga0070679_100009588 3300005530 Bacteria 9156
39 Ga0070679_100125660 3300005530 Bacteria 2547
40 Ga0068853_100017039 3300005539 Bacteria 5992
41 Ga0068853_100243082 3300005539 Bacteria 1650
42 Ga0068853_100357256 3300005539 Bacteria 1360
43 Ga0070693_100003359 3300005547 Bacteria 7440
44 Ga0070693_100227688 3300005547 Bacteria 1225
45 Ga0070665_100000017 3300005548 Bacteria 448013
46 Ga0068855_100035459 3300005563 Bacteria 5941
47 Ga0068855_100328814 3300005563 Bacteria 1688
48 Ga0068855_100543656 3300005563 Unclassified 1258
49 Ga0068857_100034693 3300005577 Bacteria 4462
50 Ga0068857_100063356 3300005577 Bacteria 3287
51 Ga0068857_100101474 3300005577 Bacteria 2582
52 Ga0068852_100236281 3300005616 Bacteria 1744
53 Ga0068859_100495253 3300005617 Bacteria 1317
54 Ga0068866_10013871 3300005718 Bacteria 3545
55 Ga0068858_100032875 3300005842 Bacteria 4817
56 Ga0068860_100069780 3300005843 Bacteria 3341
57 Ga0075432_10061477 3300006058 Bacteria 1338
58 Ga0075366_10000387 3300006195 Bacteria 20440
59 Ga0075366_10003776 3300006195 Bacteria 8052
60 Ga0097621_100000308 3300006237 Bacteria 33071
61 Ga0068871_100000046 3300006358 Bacteria 66964
62 Ga0068865_100000041 3300006881 Bacteria 72569
63 Ga0097620_100495258 3300006931 Bacteria 1317
64 Ga0105240_10037052 3300009093 Bacteria 6269
65 Ga0105240_10044397 3300009093 Bacteria 5647
66 Ga0105240_10072391 3300009093 Bacteria 4260
67 Ga0105241_10002777 3300009174 Bacteria 13113
68 Ga0105241_10016943 3300009174 Bacteria 5348
69 Ga0105242_10034989 3300009176 Bacteria 4028
70 Ga0105237_10000287 3300009545 Bacteria 69624
71 Ga0105237_10039774 3300009545 Bacteria 4745
72 Ga0105237_10167449 3300009545 Unclassified 2197
73 Ga0105237_10208258 3300009545 Bacteria 1956
74 Ga0105239_10000619 3300010375 Bacteria 50485
75 Ga0105239_10006457 3300010375 Bacteria 13603
76 Ga0105239_10051186 3300010375 Bacteria 4528
77 Ga0105239_10061262 3300010375 Bacteria 4129
78 Ga0105239_10107248 3300010375 Bacteria 3094
79 Ga0105239_10423443 3300010375 Bacteria 1508
80 Ga0157373_10000480 3300013100 Bacteria 31713
81 Ga0157373_10258152 3300013100 Bacteria 1233
82 Ga0157371_10000276 3300013102 Bacteria 69547
83 Ga0157371_10000998 3300013102 Bacteria 31279
84 Ga0157371_10004483 3300013102 Bacteria 12178
85 Ga0157371_10009933 3300013102 Bacteria 7451
86 Ga0157371_10010559 3300013102 Bacteria 7177
87 Ga0157371_10024422 3300013102 Bacteria 4413
88 Ga0157371_10047446 3300013102 Bacteria 3054
89 Ga0157371_10141179 3300013102 Unclassified 1715
90 Ga0157370_10002270 3300013104 Bacteria 23330
91 Ga0157370_10002639 3300013104 Bacteria 21536
92 Ga0157370_10005312 3300013104 Bacteria 14472
93 Ga0157370_10082990 3300013104 Unclassified 3014
94 Ga0157370_10172102 3300013104 Bacteria 2013
95 Ga0157370_10260368 3300013104 Bacteria 1603
96 Ga0157369_10000040 3300013105 Bacteria 183469
97 Ga0157369_10018288 3300013105 Bacteria 7860
98 Ga0157369_10098378 3300013105 Bacteria 3120
99 Ga0157369_10118769 3300013105 Unclassified 2806
100 Ga0157374_10000137 3300013296 Bacteria 66006
101 Ga0157378_10023504 3300013297 Bacteria 5423
102 Ga0157378_10281634 3300013297 Bacteria 1603
103 Ga0163162_10000026 3300013306 Bacteria 178701
104 Ga0163162_10004457 3300013306 Bacteria 13490
105 Ga0163162_10021695 3300013306 Bacteria 6325
106 Ga0157372_10000228 3300013307 Bacteria 62408
107 Ga0157372_10000296 3300013307 Bacteria 55447
108 Ga0157372_10002785 3300013307 Bacteria 18895
109 Ga0157372_10039367 3300013307 Bacteria 5217
110 Ga0157372_10055428 3300013307 Bacteria 4427
111 Ga0157372_10071543 3300013307 Bacteria 3906
112 Ga0157372_10074458 3300013307 Bacteria 3829
113 Ga0157372_10290577 3300013307 Bacteria 1901
114 Ga0157372_10416229 3300013307 Bacteria 1566
115 Ga0157375_10009717 3300013308 Bacteria 8458
116 Ga0157375_10021830 3300013308 Bacteria 5881
117 Ga0182006_1000302 3300015261 Bacteria 43116
118 Ga0182006_1001597 3300015261 Bacteria 13410
119 Ga0182006_1003223 3300015261 Bacteria 8475
120 Ga0182007_10000003 3300015262 Bacteria 548244
121 Ga0183373_1001 3300015682 Bacteria 1410374
122 Ga0163161_10000284 3300017792 Bacteria 44309
123 Ga0163161_10001539 3300017792 Bacteria 17026
124 Ga0213872_10009434 3300021361 Bacteria 4679
125 Ga0209436_106935 3300025208 Bacteria 2421
126 Ga0207427_100159 3300025231 Bacteria 76256
127 Ga0209437_100021 3300025233 Bacteria 646400
128 Ga0209026_1008917 3300025250 Bacteria 2032
129 Ga0209026_1010986 3300025250 Bacteria 1658
130 Ga0209148_1016117 3300025254 Bacteria 1292
131 Ga0209233_1000035 3300025261 Bacteria 568478
132 Ga0209233_1001666 3300025261 Bacteria 8650
133 Ga0209455_1004652 3300025272 Bacteria 4423
134 Ga0209676_1000008 3300025292 Bacteria 991778
135 Ga0209050_1000055 3300025298 Bacteria 339254
136 Ga0207426_1000135 3300025302 Bacteria 202216
137 Ga0207647_10000049 3300025904 Bacteria 88392
138 Ga0207647_10000368 3300025904 Bacteria 36725
139 Ga0207645_10000058 3300025907 Bacteria 78487
140 Ga0207654_10010359 3300025911 Bacteria 4747
141 Ga0207707_10003937 3300025912 Bacteria 13190
142 Ga0207695_10003843 3300025913 Bacteria 20795
143 Ga0207695_10056707 3300025913 Bacteria 4075
144 Ga0207695_10228228 3300025913 Bacteria 1767
145 Ga0207671_10001256 3300025914 Bacteria 29879
146 Ga0207671_10072031 3300025914 Bacteria 2578
147 Ga0207660_10069123 3300025917 Bacteria 2563
148 Ga0207657_10007096 3300025919 Bacteria 11513
149 Ga0207657_10039808 3300025919 Bacteria 4172
150 Ga0207657_10080308 3300025919 Bacteria 2742
151 Ga0207652_10000016 3300025921 Bacteria 188815
152 Ga0207652_10005245 3300025921 Bacteria 10532
153 Ga0207644_10008722 3300025931 Bacteria 6637
154 Ga0207690_10000302 3300025932 Bacteria 34397
155 Ga0207690_10002357 3300025932 Bacteria 11464
156 Ga0207690_10293034 3300025932 Bacteria 1271
157 Ga0207706_10000111 3300025933 Bacteria 87282
158 Ga0207686_10049374 3300025934 Bacteria 2612
159 Ga0207704_10000152 3300025938 Bacteria 37143
160 Ga0207691_10087873 3300025940 Bacteria 2788
161 Ga0207689_10067487 3300025942 Bacteria 2939
162 Ga0207667_10172426 3300025949 Bacteria 2223
163 Ga0207667_10174486 3300025949 Bacteria 2209
164 Ga0207703_10069276 3300026035 Bacteria 2909
165 Ga0207648_10002875 3300026089 Bacteria 18229
166 Ga0207674_10038635 3300026116 Bacteria 4951
167 Ga0207674_10046923 3300026116 Bacteria 4432
168 Ga0207698_10091370 3300026142 Unclassified 2492
169 Ga0268266_10000037 3300028379 Bacteria 342368
170 Ga0307515_10074920 3300028794 Bacteria 4518
171 Ga0307509_10049621 3300031507 Bacteria 4499
172 Ga0307408_100000340 3300031548 Bacteria 44104
173 Ga0307408_100002479 3300031548 Bacteria 12928
174 Ga0307408_100003293 3300031548 Bacteria 11109
175 Ga0307408_100007348 3300031548 Bacteria 7290
176 Ga0307405_10000003 3300031731 Bacteria 569064
177 Ga0307412_10002965 3300031911 Bacteria 9418
178 Ga0307412_10255154 3300031911 Bacteria 1364
179 Ga0307409_100430415 3300031995 Bacteria 1268
180 Ga0307416_100000014 3300032002 Bacteria 249053
181 Ga0307416_100035152 3300032002 Bacteria 3823
182 Ga0307414_10004388 3300032004 Bacteria 7660
183 Ga0307414_10276534 3300032004 Bacteria 1409
184 Ga0395899_0013151 3300037312 Bacteria 6328
185 Ga0395900_0099243 3300037418 Bacteria 2991
186 Ga0395900_0444319 3300037418 Bacteria 1254
187 Ga0395898_0003621 3300037466 Bacteria 17202
188 Ga0395901_0054180 3300038443 Bacteria 4168
189 Ga0436361_0137765 3300039447 Bacteria 20400
190 Ga0439431_0000333 3300041997 Bacteria 9831
191 Ga0451577_0315214 3300042876 Bacteria 1418
192 Ga0453684_0058238 3300044712 Bacteria 4991
193 Ga0453684_0184231 3300044712 Bacteria 2448
194 Ga0451576_0000828 3300045051 Bacteria 60328
195 Ga0495585_0000290 3300046492 Bacteria 50496
196 Ga0495610_0000062 3300046512 Bacteria 128923
197 Ga0495610_0000889 3300046512 Bacteria 27794
198 Ga0495610_0001152 3300046512 Bacteria 24038
199 Ga0495616_0013733 3300046513 Bacteria 4559
200 Ga0495616_0019402 3300046513 Bacteria 3711
201 Ga0495648_0002877 3300046524 Bacteria 15501
202 Ga0495648_0047607 3300046524 Bacteria 2648
203 Ga0495652_0110203 3300046529 Bacteria 2215
204 Ga0495654_0082386 3300046530 Bacteria 1506
205 Ga0495609_0021998 3300046538 Bacteria 2940
206 Ga0495633_0001742 3300046558 Bacteria 16209
207 Ga0495668_0000021 3300046616 Bacteria 381308
208 Ga0495625_0000008 3300046660 Bacteria 536165
209 Ga0495625_0001186 3300046660 Bacteria 33408
210 Ga0495625_0177104 3300046660 Bacteria 1420
211 Ga0495661_0007042 3300046665 Bacteria 7859
212 Ga0495658_0089842 3300046683 Bacteria 1817
213 Ga0495649_0000006 3300046694 Bacteria 542188
214 Ga0495686_0034004 3300047472 Bacteria 3286
215 Ga0496117_0003230 3300048920 Bacteria 19233
216 Ga0496122_0023576 3300048925 Bacteria 5417
217 Ga0496123_0032954 3300048926 Bacteria 3737
218 Ga0495678_019323 3300049459 Bacteria 3042
219 Ga0501043_0246764 3300049579 Unclassified 1376
220 Ga0501217_002732 3300049661 Bacteria 3502
221 Ga0501223_002238 3300049663 Bacteria 4327
222 Ga0501223_002851 3300049663 Bacteria 3793
223 Ga0501223_009029 3300049663 Unclassified 2025
224 Ga0501249_000004 3300049679 Bacteria 226777
225 Ga0501219_000022 3300049703 Bacteria 24237
226 Ga0501221_024265 3300049704 Bacteria 1216
227 Ga0501284_00068 3300050005 Bacteria 31369
228 nmdc:mga0k408_1183_c1 3300050493 Bacteria 14280
229 nmdc:mga0k408_522_c1 3300050493 Bacteria 21138
230 Ga0500641_0001869 3300053096 Bacteria 7469
231 Ga0500622_0000281 3300053156 Bacteria 51900
232 Ga0500624_000630 3300053157 Bacteria 9398

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221716 2644641344 328
2 iso_pu_bacteria 2919191525 2919192458 328
3 iso_pu_bacteria 2965320100 2965321448 328
4 3300053096 Ga0500641_0001869 Ga0500641_0001869_859_1902 329
5 3300031548 Ga0307408_100002479 Ga0307408_1000024792 330
6 3300032002 Ga0307416_100035152 Ga0307416_1000351522 330
7 3300005293 Ga0065715_10026982 Ga0065715_100269822 332
8 3300013102 Ga0157371_10024422 Ga0157371_100244221 332
9 3300025250 Ga0209026_1008917 Ga0209026_10089172 332
10 3300042876 Ga0451577_0315214 Ga0451577_0315214_193_1194 332
11 3300044712 Ga0453684_0058238 Ga0453684_0058238_1134_2135 332
12 3300044712 Ga0453684_0184231 Ga0453684_0184231_1158_2159 332
13 3300045051 Ga0451576_0000828 Ga0451576_0000828_56585_57586 332
14 3300005339 Ga0070660_100182801 Ga0070660_1001828012 333
15 3300005366 Ga0070659_100012780 Ga0070659_1000127805 333
16 3300005366 Ga0070659_100048236 Ga0070659_1000482362 333
17 3300005530 Ga0070679_100009588 Ga0070679_1000095885 333
18 3300005563 Ga0068855_100035459 Ga0068855_1000354595 333
19 3300013104 Ga0157370_10005312 Ga0157370_100053126 333
20 3300013307 Ga0157372_10055428 Ga0157372_100554283 333
21 3300025921 Ga0207652_10000016 Ga0207652_1000001650 333
22 3300025949 Ga0207667_10172426 Ga0207667_101724262 333
23 3300037312 Ga0395899_0013151 Ga0395899_0013151_4358_5383 333
24 3300037418 Ga0395900_0099243 Ga0395900_0099243_757_1782 333
25 3300037466 Ga0395898_0003621 Ga0395898_0003621_8787_9812 333
26 3300038443 Ga0395901_0054180 Ga0395901_0054180_3090_4115 333
27 iso_pu_bacteria 2513020052 2513233584 333
28 3300013105 Ga0157369_10118769 Ga0157369_101187692 337
29 3300049661 Ga0501217_002732 Ga0501217_002732_822_1841 337
30 3300049663 Ga0501223_009029 Ga0501223_009029_712_1731 337
31 3300049679 Ga0501249_000004 Ga0501249_000004_50512_51555 337
32 3300049704 Ga0501221_024265 Ga0501221_024265_66_1085 337
33 iso_pu_bacteria 2643221600 2644012078 337
34 iso_pu_bacteria 8054307821 8054310813 337
35 iso_pu_bacteria 2775506987 2776614773 338
36 iso_pu_bacteria 2585427687 2586208983 339
37 iso_pu_bacteria 2738541302 2738851992 339
38 iso_pu_bacteria 2739367651 2739590872 339
39 iso_pu_bacteria 2818991437 2819546541 339
40 iso_pu_bacteria 2840677318 2840679311 339
41 iso_pu_bacteria 2842722452 2842725233 339
42 iso_pu_bacteria 2842909656 2842912508 339
43 iso_pu_bacteria 2849281842 2849286814 339
44 iso_pu_bacteria 2852627209 2852629842 339
45 iso_pu_bacteria 2857627736 2857629698 339
46 iso_pu_bacteria 2896085136 2896087122 339
47 iso_pu_bacteria 2896109856 2896114092 339
48 iso_pu_bacteria 2919437846 2919440689 339
49 iso_pu_bacteria 2928078545 2928079348 339
50 iso_pu_bacteria 2928147474 2928148171 339
51 iso_pu_bacteria 2929177148 2929180847 339
52 iso_pu_bacteria 2945977869 2945983246 339
53 iso_pu_bacteria 2945997725 2946002155 339
54 iso_pu_bacteria 2946013367 2946017363 339
55 iso_pu_bacteria 2954016120 2954019053 339
56 iso_pu_bacteria 2977232053 2977233934 339
57 iso_pu_bacteria 2721755487 2722730693 340
58 iso_pu_bacteria 2890737413 2890739371 340
59 3300001989 JGI24739J22299_10022800 JGI24739J22299_100228002 341
60 3300001990 JGI24737J22298_10010086 JGI24737J22298_100100863 341
61 3300002067 JGI24735J21928_10000040 JGI24735J21928_100000406 341
62 3300002737 JGI25162J39368_1002645 JGI25162J39368_10026452 341
63 3300002772 JGI25164J39214_1001242 JGI25164J39214_10012427 341
64 3300003214 JGI25165J46597_1001079 JGI25165J46597_100107912 341
65 3300003320 rootH2_10001273 rootH2_10001273138 341
66 3300003323 rootH1_10156687 rootH1_101566873 341
67 3300005328 Ga0070676_10000015 Ga0070676_1000001512 341
68 3300005339 Ga0070660_100197772 Ga0070660_1001977722 341
69 3300005355 Ga0070671_100000813 Ga0070671_1000008135 341
70 3300005366 Ga0070659_100001837 Ga0070659_1000018377 341
71 3300005366 Ga0070659_100330193 Ga0070659_1003301931 341
72 3300005457 Ga0070662_100001108 Ga0070662_1000011084 341
73 3300005459 Ga0068867_100000210 Ga0068867_1000002103 341
74 3300005539 Ga0068853_100017039 Ga0068853_1000170394 341
75 3300005548 Ga0070665_100000017 Ga0070665_100000017120 341
76 3300005563 Ga0068855_100543656 Ga0068855_1005436561 341
77 3300005842 Ga0068858_100032875 Ga0068858_1000328753 341
78 3300006237 Ga0097621_100000308 Ga0097621_10000030832 341
79 3300006358 Ga0068871_100000046 Ga0068871_10000004643 341
80 3300006881 Ga0068865_100000041 Ga0068865_10000004161 341
81 3300009093 Ga0105240_10037052 Ga0105240_100370523 341
82 3300009174 Ga0105241_10016943 Ga0105241_100169435 341
83 3300009545 Ga0105237_10208258 Ga0105237_102082581 341
84 3300010375 Ga0105239_10051186 Ga0105239_100511861 341
85 3300010375 Ga0105239_10107248 Ga0105239_101072482 341
86 3300013100 Ga0157373_10000480 Ga0157373_1000048024 341
87 3300013100 Ga0157373_10258152 Ga0157373_102581521 341
88 3300013102 Ga0157371_10004483 Ga0157371_100044835 341
89 3300013102 Ga0157371_10010559 Ga0157371_100105593 341
90 3300013102 Ga0157371_10141179 Ga0157371_101411791 341
91 3300013104 Ga0157370_10082990 Ga0157370_100829901 341
92 3300013104 Ga0157370_10260368 Ga0157370_102603682 341
93 3300013105 Ga0157369_10018288 Ga0157369_100182887 341
94 3300013296 Ga0157374_10000137 Ga0157374_1000013729 341
95 3300013297 Ga0157378_10023504 Ga0157378_100235043 341
96 3300013306 Ga0163162_10000026 Ga0163162_1000002633 341
97 3300013306 Ga0163162_10004457 Ga0163162_100044572 341
98 3300013307 Ga0157372_10000228 Ga0157372_1000022850 341
99 3300013307 Ga0157372_10000296 Ga0157372_1000029619 341
100 3300013307 Ga0157372_10039367 Ga0157372_100393673 341
101 3300013307 Ga0157372_10074458 Ga0157372_100744583 341
102 3300013308 Ga0157375_10021830 Ga0157375_100218303 341
103 3300021361 Ga0213872_10009434 Ga0213872_100094343 341
104 3300025231 Ga0207427_100159 Ga0207427_10015967 341
105 3300025233 Ga0209437_100021 Ga0209437_10002187 341
106 3300025250 Ga0209026_1010986 Ga0209026_10109862 341
107 3300025254 Ga0209148_1016117 Ga0209148_10161171 341
108 3300025261 Ga0209233_1000035 Ga0209233_1000035550 341
109 3300025261 Ga0209233_1001666 Ga0209233_10016662 341
110 3300025272 Ga0209455_1004652 Ga0209455_10046522 341
111 3300025904 Ga0207647_10000049 Ga0207647_1000004951 341
112 3300025904 Ga0207647_10000368 Ga0207647_100003686 341
113 3300025907 Ga0207645_10000058 Ga0207645_1000005862 341
114 3300025913 Ga0207695_10003843 Ga0207695_1000384316 341
115 3300025919 Ga0207657_10007096 Ga0207657_100070966 341
116 3300025919 Ga0207657_10039808 Ga0207657_100398084 341
117 3300025931 Ga0207644_10008722 Ga0207644_100087225 341
118 3300025932 Ga0207690_10002357 Ga0207690_100023571 341
119 3300025932 Ga0207690_10293034 Ga0207690_102930341 341
120 3300025933 Ga0207706_10000111 Ga0207706_1000011150 341
121 3300025938 Ga0207704_10000152 Ga0207704_1000015220 341
122 3300026035 Ga0207703_10069276 Ga0207703_100692762 341
123 3300028379 Ga0268266_10000037 Ga0268266_10000037197 341
124 3300031548 Ga0307408_100000340 Ga0307408_10000034025 341
125 3300031548 Ga0307408_100003293 Ga0307408_1000032934 341
126 3300031995 Ga0307409_100430415 Ga0307409_1004304152 341
127 3300037418 Ga0395900_0444319 Ga0395900_0444319_25_1050 341
128 3300039447 Ga0436361_0137765 Ga0436361_0137765_5707_6732 341
129 3300046512 Ga0495610_0000062 Ga0495610_0000062_53168_54193 341
130 3300046558 Ga0495633_0001742 Ga0495633_0001742_11052_12077 341
131 3300046665 Ga0495661_0007042 Ga0495661_0007042_4198_5223 341
132 3300049663 Ga0501223_002238 Ga0501223_002238_592_1641 341
133 iso_pu_bacteria 2896317667 2896319201 341
134 iso_pu_bacteria 3003233435 3003236093 341
135 2162886007 SwRhRL2b_contig_1214182 SwRhRL2b_0492.00007110 342
136 3300001979 JGI24740J21852_10018664 JGI24740J21852_100186642 342
137 3300001990 JGI24737J22298_10000486 JGI24737J22298_100004866 342
138 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001173 342
139 3300003320 rootH2_10160524 rootH2_101605243 342
140 3300003320 rootH2_10301589 rootH2_103015892 342
141 3300003323 rootH1_10356556 rootH1_103565562 342
142 3300003791 Ga0055530_10002315 Ga0055530_100023155 342
143 3300005289 Ga0065704_10000769 Ga0065704_100007695 342
144 3300005289 Ga0065704_10118604 Ga0065704_101186042 342
145 3300005331 Ga0070670_100240469 Ga0070670_1002404692 342
146 3300005334 Ga0068869_100049007 Ga0068869_1000490072 342
147 3300005336 Ga0070680_100001527 Ga0070680_1000015276 342
148 3300005337 Ga0070682_100001986 Ga0070682_1000019865 342
149 3300005339 Ga0070660_100079228 Ga0070660_1000792282 342
150 3300005341 Ga0070691_10009319 Ga0070691_100093192 342
151 3300005366 Ga0070659_100003795 Ga0070659_1000037957 342
152 3300005458 Ga0070681_10009603 Ga0070681_100096035 342
153 3300005530 Ga0070679_100125660 Ga0070679_1001256601 342
154 3300005539 Ga0068853_100243082 Ga0068853_1002430821 342
155 3300005539 Ga0068853_100357256 Ga0068853_1003572562 342
156 3300005547 Ga0070693_100003359 Ga0070693_1000033593 342
157 3300005547 Ga0070693_100227688 Ga0070693_1002276882 342
158 3300005563 Ga0068855_100328814 Ga0068855_1003288142 342
159 3300005577 Ga0068857_100034693 Ga0068857_1000346933 342
160 3300005577 Ga0068857_100063356 Ga0068857_1000633563 342
161 3300005577 Ga0068857_100101474 Ga0068857_1001014742 342
162 3300005616 Ga0068852_100236281 Ga0068852_1002362812 342
163 3300005617 Ga0068859_100495253 Ga0068859_1004952532 342
164 3300005718 Ga0068866_10013871 Ga0068866_100138712 342
165 3300005843 Ga0068860_100069780 Ga0068860_1000697802 342
166 3300006058 Ga0075432_10061477 Ga0075432_100614772 342
167 3300006195 Ga0075366_10000387 Ga0075366_1000038712 342
168 3300006195 Ga0075366_10003776 Ga0075366_100037763 342
169 3300006931 Ga0097620_100495258 Ga0097620_1004952582 342
170 3300009093 Ga0105240_10044397 Ga0105240_100443974 342
171 3300009093 Ga0105240_10072391 Ga0105240_100723912 342
172 3300009174 Ga0105241_10002777 Ga0105241_100027777 342
173 3300009176 Ga0105242_10034989 Ga0105242_100349892 342
174 3300009545 Ga0105237_10000287 Ga0105237_1000028726 342
175 3300009545 Ga0105237_10039774 Ga0105237_100397742 342
176 3300009545 Ga0105237_10167449 Ga0105237_101674492 342
177 3300010375 Ga0105239_10000619 Ga0105239_1000061923 342
178 3300010375 Ga0105239_10006457 Ga0105239_100064574 342
179 3300010375 Ga0105239_10061262 Ga0105239_100612623 342
180 3300010375 Ga0105239_10423443 Ga0105239_104234432 342
181 3300013102 Ga0157371_10000276 Ga0157371_1000027620 342
182 3300013102 Ga0157371_10000998 Ga0157371_1000099814 342
183 3300013102 Ga0157371_10009933 Ga0157371_100099333 342
184 3300013102 Ga0157371_10047446 Ga0157371_100474462 342
185 3300013104 Ga0157370_10002270 Ga0157370_100022707 342
186 3300013104 Ga0157370_10002639 Ga0157370_100026394 342
187 3300013104 Ga0157370_10172102 Ga0157370_101721022 342
188 3300013105 Ga0157369_10000040 Ga0157369_10000040124 342
189 3300013105 Ga0157369_10098378 Ga0157369_100983783 342
190 3300013297 Ga0157378_10281634 Ga0157378_102816342 342
191 3300013306 Ga0163162_10021695 Ga0163162_100216952 342
192 3300013307 Ga0157372_10002785 Ga0157372_100027859 342
193 3300013307 Ga0157372_10071543 Ga0157372_100715432 342
194 3300013307 Ga0157372_10290577 Ga0157372_102905772 342
195 3300013307 Ga0157372_10416229 Ga0157372_104162292 342
196 3300013308 Ga0157375_10009717 Ga0157375_100097174 342
197 3300015261 Ga0182006_1000302 Ga0182006_100030216 342
198 3300015261 Ga0182006_1001597 Ga0182006_10015972 342
199 3300015261 Ga0182006_1003223 Ga0182006_10032234 342
200 3300015262 Ga0182007_10000003 Ga0182007_10000003492 342
201 3300015682 Ga0183373_1001 Ga0183373_1001487 342
202 3300017792 Ga0163161_10000284 Ga0163161_1000028410 342
203 3300017792 Ga0163161_10001539 Ga0163161_100015399 342
204 3300025208 Ga0209436_106935 Ga0209436_1069354 342
205 3300025292 Ga0209676_1000008 Ga0209676_1000008380 342
206 3300025298 Ga0209050_1000055 Ga0209050_100005532 342
207 3300025302 Ga0207426_1000135 Ga0207426_100013519 342
208 3300025911 Ga0207654_10010359 Ga0207654_100103593 342
209 3300025912 Ga0207707_10003937 Ga0207707_100039372 342
210 3300025913 Ga0207695_10056707 Ga0207695_100567073 342
211 3300025913 Ga0207695_10228228 Ga0207695_102282281 342
212 3300025914 Ga0207671_10001256 Ga0207671_1000125612 342
213 3300025914 Ga0207671_10072031 Ga0207671_100720312 342
214 3300025917 Ga0207660_10069123 Ga0207660_100691232 342
215 3300025919 Ga0207657_10080308 Ga0207657_100803083 342
216 3300025921 Ga0207652_10005245 Ga0207652_100052455 342
217 3300025932 Ga0207690_10000302 Ga0207690_100003025 342
218 3300025934 Ga0207686_10049374 Ga0207686_100493743 342
219 3300025940 Ga0207691_10087873 Ga0207691_100878732 342
220 3300025942 Ga0207689_10067487 Ga0207689_100674872 342
221 3300025949 Ga0207667_10174486 Ga0207667_101744861 342
222 3300026089 Ga0207648_10002875 Ga0207648_100028756 342
223 3300026116 Ga0207674_10038635 Ga0207674_100386354 342
224 3300026116 Ga0207674_10046923 Ga0207674_100469232 342
225 3300026142 Ga0207698_10091370 Ga0207698_100913702 342
226 3300028794 Ga0307515_10074920 Ga0307515_100749201 342
227 3300031507 Ga0307509_10049621 Ga0307509_100496213 342
228 3300031548 Ga0307408_100007348 Ga0307408_1000073488 342
229 3300031731 Ga0307405_10000003 Ga0307405_10000003275 342
230 3300031911 Ga0307412_10002965 Ga0307412_100029651 342
231 3300031911 Ga0307412_10255154 Ga0307412_102551541 342
232 3300032002 Ga0307416_100000014 Ga0307416_10000001484 342
233 3300032004 Ga0307414_10004388 Ga0307414_100043882 342
234 3300032004 Ga0307414_10276534 Ga0307414_102765341 342
235 3300041997 Ga0439431_0000333 Ga0439431_0000333_7982_9013 342
236 3300046492 Ga0495585_0000290 Ga0495585_0000290_15683_16714 342
237 3300046512 Ga0495610_0000889 Ga0495610_0000889_12729_13760 342
238 3300046512 Ga0495610_0001152 Ga0495610_0001152_10442_11473 342
239 3300046513 Ga0495616_0013733 Ga0495616_0013733_1488_2519 342
240 3300046513 Ga0495616_0019402 Ga0495616_0019402_249_1352 342
241 3300046524 Ga0495648_0002877 Ga0495648_0002877_14315_15346 342
242 3300046524 Ga0495648_0047607 Ga0495648_0047607_297_1328 342
243 3300046529 Ga0495652_0110203 Ga0495652_0110203_722_1753 342
244 3300046530 Ga0495654_0082386 Ga0495654_0082386_289_1320 342
245 3300046538 Ga0495609_0021998 Ga0495609_0021998_922_2025 342
246 3300046616 Ga0495668_0000021 Ga0495668_0000021_280493_281524 342
247 3300046660 Ga0495625_0000008 Ga0495625_0000008_22488_23591 342
248 3300046660 Ga0495625_0001186 Ga0495625_0001186_3921_4952 342
249 3300046660 Ga0495625_0177104 Ga0495625_0177104_343_1374 342
250 3300046683 Ga0495658_0089842 Ga0495658_0089842_531_1562 342
251 3300046694 Ga0495649_0000006 Ga0495649_0000006_247988_249091 342
252 3300047472 Ga0495686_0034004 Ga0495686_0034004_549_1580 342
253 3300048920 Ga0496117_0003230 Ga0496117_0003230_17503_18540 342
254 3300048925 Ga0496122_0023576 Ga0496122_0023576_3155_4192 342
255 3300048926 Ga0496123_0032954 Ga0496123_0032954_216_1253 342
256 3300049459 Ga0495678_019323 Ga0495678_019323_211_1242 342
257 3300049579 Ga0501043_0246764 Ga0501043_0246764_334_1365 342
258 3300049663 Ga0501223_002851 Ga0501223_002851_1777_2823 342
259 3300049703 Ga0501219_000022 Ga0501219_000022_19477_20508 342
260 3300050005 Ga0501284_00068 Ga0501284_00068_27477_28508 342
261 3300050493 nmdc:mga0k408_1183_c1 nmdc:mga0k408_1183_c1_4359_5390 342
262 3300050493 nmdc:mga0k408_522_c1 nmdc:mga0k408_522_c1_2719_3750 342
263 3300053156 Ga0500622_0000281 Ga0500622_0000281_40248_41279 342
264 3300053157 Ga0500624_000630 Ga0500624_000630_148_1179 342
265 iso_pu_bacteria 2599185184 2599477435 342
266 iso_pu_bacteria 2932082852 2932084061 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

81

144

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3by6-assembly3.cif.gz_C crystal structure of a transcriptional regulator from oenococcus oeni 0.9823 17 83
2du9-assembly1.cif.gz_A crystal structure of the transcriptional factor from c.glutamicum 0.9755 17 83
5d4s-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orx1 0.9416 17 83
3neu-assembly1.cif.gz_A-2 the crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262 0.9401 12 84
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9394 17 83
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9855 40 82 1.10.10.10
af_P0ACM5_16_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.981 16 84 1.10.10.10
af_Q2FWW6_10_126_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9739 17 84 1.10.10.10
af_O06550_14_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9716 16 86 1.10.10.10
3by6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9687 17 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A520IBS5-F1-model_v4 Transcriptional regulator 0.9936 99 342
AF-A0A258JMW4-F1-model_v4 Transcriptional regulator 0.9927 160 342
AF-A0A1H0CND2-F1-model_v4 Transcriptional regulator, GntR family 0.9908 9 83 GO:0003677
GO:0003700
AF-A0A520IBS5-F1-model_v4 Transcriptional regulator 0.9895 99 342
AF-A0A2Z4GGE8-F1-model_v4 Transcriptional regulator 0.986 7 342 GO:0003677
GO:0003700
GO:0005737

Feature Viewer

pLDDT pTM Quality
92.15 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map