F373596

General Info

Members Datasets Scaffolds Average Seq Length
265 220 188 259

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0022068|Ga0496125_0022068_4580_5461
Length 293
Sequence MRFRKCHCVRYILVITFDYRPIFNDERGYFLMALIKCEFYSDTLGLSTSMHVILPQQTHNQIGMNNVTGSGLHPTLYLLHGLSDDDSIWLRRTSIERYVASLGIAVVMPQVHRSFYTDMAEGGRYWTFISEELPALARSFFPLSPQREDNFVAGLSMGGYGAFKLALRKPDQYAAAASLSGALDMAAHMNNEVPSALQRAELLRIFGPEFAGSDNDLIHLLKESKNSQGPRPLLYQCCGTEDFLYEENQTFRKACAETDFELTYEEEPGEHEWGYWDMKIQDVLKWLPLPKQG

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
3 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
4 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
5 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
6 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
7 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
8 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
9 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
10 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
11 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
12 2643221731 Bacillus sp. Root147 Isolate Unclassified
13 2643221732 Bacillus sp. Root239 Isolate Unclassified
14 2671180694 Paenibacillus sp. A3 Isolate Unclassified
15 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
16 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
17 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
18 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
19 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
20 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
21 2818991459 Paenibacillus sp. 597 Isolate Unclassified
22 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
23 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
24 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
25 2842882022 Bacillus sp. R-71893 Isolate Unclassified
26 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
27 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
28 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
29 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
30 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
31 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
32 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
33 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
34 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
35 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
36 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
37 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
38 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
39 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
40 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
41 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
42 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
43 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
44 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
45 2919720352 Priestia megaterium 4340 Isolate Unclassified
46 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
47 2929004312 Priestia megaterium 1104 Isolate Unclassified
48 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
49 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
50 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
51 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
52 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
53 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
54 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
55 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
56 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
57 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
58 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
59 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
60 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
61 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
62 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
63 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
64 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
65 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
66 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
67 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
68 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
69 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
70 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
71 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
74 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
148 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
213 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
214 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
215 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
216 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
217 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
218 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
219 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
220 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.57
Metatranscriptomes 0
Isolates 29.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 4.91
Nodule 1.51
Rhizoplane 9.06
Rhizosphere 59.62
Stem 0
Stem Tuber 0
Unclassified 24.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1010633 3300002737 Bacteria 1153
2 rootH1_10001632 3300003316 Bacteria 6152
3 rootH2_10214427 3300003320 Bacteria 1364
4 rootH2_10263735 3300003320 Bacteria 2389
5 rootL2_10013117 3300003322 Bacteria 8119
6 rootH1_10079282 3300003316 Bacteria 3839
7 rootH1_10079282 3300003323 Bacteria 4303
8 Ga0055538_1000384 3300003751 Bacteria 18126
9 Ga0055532_1010381 3300003758 Bacteria 1115
10 Ga0055528_1012116 3300003790 Bacteria 3371
11 Ga0070658_10202737 3300005327 Bacteria 1674
12 Ga0070683_100005611 3300005329 Bacteria 10486
13 Ga0070683_100079599 3300005329 Bacteria 3067
14 Ga0070670_100145037 3300005331 Bacteria 2054
15 Ga0070670_100445753 3300005331 Bacteria 1147
16 Ga0068869_100012935 3300005334 Bacteria 5529
17 Ga0068868_100037145 3300005338 Bacteria 3775
18 Ga0070668_100274252 3300005347 Bacteria 1407
19 Ga0070675_100001238 3300005354 Bacteria 18609
20 Ga0070671_100024101 3300005355 Bacteria 4980
21 Ga0070659_100184508 3300005366 Bacteria 1713
22 Ga0070701_10090396 3300005438 Bacteria 1676
23 Ga0070700_100004526 3300005441 Bacteria 7271
24 Ga0070663_100007124 3300005455 Bacteria 6786
25 Ga0070679_100179825 3300005530 Bacteria 2088
26 Ga0070684_100141728 3300005535 Bacteria 2174
27 Ga0068853_100000004 3300005539 Bacteria 405732
28 Ga0070672_100210232 3300005543 Bacteria 1629
29 Ga0070686_100541833 3300005544 Bacteria 909
30 Ga0068855_100002085 3300005563 Bacteria 24758
31 Ga0070664_100006551 3300005564 Bacteria 9390
32 Ga0068852_100110062 3300005616 Bacteria 2502
33 Ga0068861_100024176 3300005719 Bacteria 4391
34 Ga0068860_100565373 3300005843 Bacteria 1140
35 Ga0081538_10028076 3300005981 Bacteria 3882
36 Ga0075427_10022603 3300006194 Bacteria 1005
37 Ga0075431_100211159 3300006847 Bacteria 1982
38 Ga0079104_1002875 3300006946 Bacteria 8599
39 Ga0105244_10023732 3300009036 Bacteria 3359
40 Ga0105240_10024060 3300009093 Bacteria 8042
41 Ga0111539_10022131 3300009094 Bacteria 7814
42 Ga0111539_10206450 3300009094 Bacteria 2290
43 Ga0111539_11122528 3300009094 Unclassified 913
44 Ga0105245_10052863 3300009098 Bacteria 3645
45 Ga0105247_10070399 3300009101 Bacteria 2185
46 Ga0105243_10003753 3300009148 Bacteria 12176
47 Ga0105242_10019403 3300009176 Bacteria 5327
48 Ga0105239_10170594 3300010375 Bacteria 2433
49 Ga0105246_10006483 3300011119 Bacteria 7149
50 Ga0105246_10328280 3300011119 Unclassified 1246
51 Ga0157371_10178897 3300013102 Bacteria 1517
52 Ga0157369_10170405 3300013105 Bacteria 2294
53 Ga0157378_10024940 3300013297 Bacteria 5266
54 Ga0157372_10942529 3300013307 Bacteria 1001
55 Ga0157375_10379320 3300013308 Bacteria 1580
56 Ga0163163_10048268 3300014325 Unclassified 4186
57 Ga0157377_10047510 3300014745 Bacteria 2405
58 Ga0157376_10006446 3300014969 Bacteria 8290
59 Ga0213873_10003408 3300021358 Bacteria 2860
60 Ga0213872_10037791 3300021361 Bacteria 2205
61 Ga0209784_100075 3300025224 Bacteria 139902
62 Ga0209566_100124 3300025225 Bacteria 97556
63 Ga0209147_100396 3300025229 Bacteria 29877
64 Ga0209437_101882 3300025233 Bacteria 4414
65 Ga0209675_1015708 3300025291 Bacteria 2235
66 Ga0209025_1005144 3300025294 Bacteria 10850
67 Ga0207655_1028456 3300025728 Bacteria 2636
68 Ga0207655_1041649 3300025728 Bacteria 1966
69 Ga0207713_1007136 3300025735 Bacteria 6676
70 Ga0207688_10106267 3300025901 Bacteria 1626
71 Ga0207705_10274484 3300025909 Bacteria 1289
72 Ga0207695_10119812 3300025913 Bacteria 2601
73 Ga0207659_10003418 3300025926 Bacteria 9513
74 Ga0207659_10387377 3300025926 Bacteria 1167
75 Ga0207690_10107683 3300025932 Bacteria 2002
76 Ga0207690_10388408 3300025932 Bacteria 1111
77 Ga0207686_10013021 3300025934 Bacteria 4592
78 Ga0207709_10015218 3300025935 Bacteria 4264
79 Ga0207691_10614193 3300025940 Bacteria 920
80 Ga0207689_10003583 3300025942 Bacteria 14192
81 Ga0207661_10179028 3300025944 Bacteria 1851
82 Ga0207661_10234824 3300025944 Bacteria 1625
83 Ga0207679_10061059 3300025945 Bacteria 2804
84 Ga0207677_10324834 3300026023 Bacteria 1280
85 Ga0207639_10000029 3300026041 Bacteria 195764
86 Ga0207678_10130726 3300026067 Bacteria 2142
87 Ga0207678_10291647 3300026067 Bacteria 1401
88 Ga0207708_10009061 3300026075 Bacteria 7363
89 Ga0207702_10112406 3300026078 Bacteria 2424
90 Ga0207675_100198168 3300026118 Bacteria 1928
91 Ga0207698_10233473 3300026142 Bacteria 1671
92 Ga0209281_1000930 3300027111 Bacteria 24079
93 Ga0209371_1009535 3300027312 Bacteria 3074
94 Ga0268264_10123066 3300028381 Bacteria 2289
95 Ga0268256_1011524 3300030500 Bacteria 2790
96 Ga0307405_10158839 3300031731 Bacteria 1599
97 Ga0307409_100220284 3300031995 Bacteria 1713
98 Ga0307409_100487409 3300031995 Bacteria 1197
99 Ga0307416_100080564 3300032002 Bacteria 2749
100 Ga0307415_100057454 3300032126 Bacteria 2674
101 Ga0307415_100060764 3300032126 Bacteria 2613
102 Ga0395898_0269171 3300037466 Bacteria 1625
103 Ga0395901_0027443 3300038443 Bacteria 5850
104 Ga0395901_0380101 3300038443 Unclassified 1454
105 Ga0400483_087864 3300039062 Bacteria 4009
106 Ga0436360_0569782 3300039438 Bacteria 6164
107 Ga0436361_1159651 3300039447 Bacteria 4963
108 Ga0436362_1013572 3300039453 Bacteria 4105
109 Ga0439449_0007432 3300042007 Bacteria 4166
110 Ga0439462_0039635 3300042015 Bacteria 1256
111 Ga0451577_0106641 3300042876 Bacteria 2504
112 Ga0451577_0407133 3300042876 Unclassified 1235
113 Ga0453683_0237029 3300044673 Unclassified 1162
114 Ga0453683_0283440 3300044673 Bacteria 1058
115 Ga0466964_0126969 3300044706 Bacteria 1156
116 Ga0453684_0001339 3300044712 Bacteria 72274
117 Ga0453684_0003603 3300044712 Bacteria 34550
118 Ga0453684_0038388 3300044712 Bacteria 6548
119 Ga0466967_0126017 3300045976 Bacteria 2372
120 Ga0466967_0274015 3300045976 Bacteria 1618
121 Ga0495653_0043154 3300046463 Bacteria 3508
122 Ga0495585_0037521 3300046492 Bacteria 2729
123 Ga0495643_0000111 3300046522 Bacteria 135372
124 Ga0495645_0113936 3300046543 Bacteria 1911
125 Ga0495633_0155480 3300046558 Bacteria 1056
126 Ga0495661_0081842 3300046665 Bacteria 1860
127 Ga0495636_0148348 3300047318 Bacteria 1051
128 Ga0495683_0199193 3300047323 Bacteria 904
129 Ga0496100_0013397 3300048903 Bacteria 4727
130 Ga0496101_0056473 3300048904 Bacteria 2838
131 Ga0496101_0298359 3300048904 Bacteria 1262
132 Ga0496102_0118629 3300048905 Bacteria 2469
133 Ga0496103_0017067 3300048906 Bacteria 4340
134 Ga0496104_0053747 3300048907 Bacteria 3806
135 Ga0496105_0014499 3300048908 Bacteria 6274
136 Ga0496105_0129808 3300048908 Bacteria 2078
137 Ga0496105_0151515 3300048908 Bacteria 1906
138 Ga0496106_0001030 3300048909 Bacteria 20521
139 Ga0496108_0002659 3300048911 Bacteria 14319
140 Ga0496108_0477988 3300048911 Bacteria 1089
141 Ga0496109_0018684 3300048912 Bacteria 6093
142 Ga0496110_0037906 3300048913 Bacteria 4191
143 Ga0496110_0408405 3300048913 Bacteria 1238
144 Ga0496111_0056546 3300048914 Bacteria 2838
145 Ga0496112_0006022 3300048915 Bacteria 10583
146 Ga0496113_0073946 3300048916 Bacteria 2597
147 Ga0496114_0020619 3300048917 Bacteria 5351
148 Ga0496114_0023599 3300048917 Bacteria 5021
149 Ga0496114_0104165 3300048917 Bacteria 2426
150 Ga0496114_0186364 3300048917 Bacteria 1814
151 Ga0496114_0362582 3300048917 Bacteria 1282
152 Ga0496116_0004597 3300048919 Bacteria 13089
153 Ga0496116_0023205 3300048919 Bacteria 4626
154 Ga0496116_0025696 3300048919 Bacteria 4324
155 Ga0496116_0026232 3300048919 Bacteria 4266
156 Ga0496117_0067100 3300048920 Bacteria 2429
157 Ga0496118_0044066 3300048921 Bacteria 3497
158 Ga0496119_0002706 3300048922 Bacteria 19138
159 Ga0496119_0066503 3300048922 Bacteria 2129
160 Ga0496119_0232884 3300048922 Bacteria 936
161 Ga0496120_0004192 3300048923 Bacteria 12321
162 Ga0496121_0045602 3300048924 Bacteria 3764
163 Ga0496121_0125878 3300048924 Bacteria 1926
164 Ga0496122_0004997 3300048925 Bacteria 16045
165 Ga0496122_0020047 3300048925 Bacteria 6071
166 Ga0496122_0098911 3300048925 Bacteria 1957
167 Ga0496122_0115470 3300048925 Bacteria 1749
168 Ga0496122_0179541 3300048925 Bacteria 1265
169 Ga0496123_0083444 3300048926 Bacteria 1932
170 Ga0496123_0254457 3300048926 Bacteria 864
171 Ga0496124_0076479 3300048927 Bacteria 2763
172 Ga0496125_0001783 3300048928 Bacteria 29745
173 Ga0496125_0019553 3300048928 Bacteria 6382
174 Ga0496125_0022068 3300048928 Bacteria 5919
175 Ga0496125_0302188 3300048928 Bacteria 980
176 Ga0496126_0015561 3300048929 Bacteria 7645
177 Ga0496126_0051837 3300048929 Bacteria 3734
178 Ga0501033_0114678 3300049570 Bacteria 1958
179 Ga0501042_0572991 3300049578 Bacteria 821
180 Ga0501043_0387815 3300049579 Bacteria 1057
181 Ga0501083_0000919 3300049744 Bacteria 19524
182 Ga0501035_0358848 3300049822 Bacteria 1218
183 Ga0501044_0096108 3300049823 Bacteria 2985
184 nmdc:mga09592_15614_c1 3300050508 Bacteria 6204
185 nmdc:mga08y16_10875_c1 3300050511 Bacteria 9558
186 Ga0500643_024220 3300053087 Bacteria 1930
187 Ga0500555_000029 3300053103 Bacteria 103966
188 Ga0500616_0015581 3300053153 Bacteria 4343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_10047510 Ga0157377_100475102 220
2 3300048917 Ga0496114_0104165 Ga0496114_0104165_557_1339 231
3 3300039062 Ga0400483_087864 Ga0400483_087864_2490_3278 234
4 3300050511 nmdc:mga08y16_10875_c1 nmdc:mga08y16_10875_c1_37_771 234
5 3300047318 Ga0495636_0148348 Ga0495636_0148348_280_1002 235
6 iso_pu_bacteria 2889049205 2889049880 235
7 3300021358 Ga0213873_10003408 Ga0213873_100034083 236
8 3300021361 Ga0213872_10037791 Ga0213872_100377911 236
9 3300025728 Ga0207655_1041649 Ga0207655_10416491 236
10 3300039438 Ga0436360_0569782 Ga0436360_0569782_3062_3820 236
11 3300039447 Ga0436361_1159651 Ga0436361_1159651_2927_3685 236
12 3300039453 Ga0436362_1013572 Ga0436362_1013572_3117_3875 236
13 3300046665 Ga0495661_0081842 Ga0495661_0081842_237_959 236
14 3300048926 Ga0496123_0254457 Ga0496123_0254457_101_823 236
15 3300049578 Ga0501042_0572991 Ga0501042_0572991_42_764 236
16 3300050508 nmdc:mga09592_15614_c1 nmdc:mga09592_15614_c1_1101_1838 236
17 3300048919 Ga0496116_0023205 Ga0496116_0023205_733_1479 237
18 3300009093 Ga0105240_10024060 Ga0105240_100240606 239
19 3300025913 Ga0207695_10119812 Ga0207695_101198122 239
20 3300048919 Ga0496116_0026232 Ga0496116_0026232_3491_4225 240
21 3300005530 Ga0070679_100179825 Ga0070679_1001798252 241
22 3300048925 Ga0496122_0115470 Ga0496122_0115470_816_1550 241
23 iso_pu_bacteria 2821111986 2821115970 241
24 iso_pu_bacteria 3006988479 3006989947 242
25 3300005329 Ga0070683_100079599 Ga0070683_1000795992 243
26 3300005366 Ga0070659_100184508 Ga0070659_1001845082 243
27 3300013105 Ga0157369_10170405 Ga0157369_101704052 243
28 3300025909 Ga0207705_10274484 Ga0207705_102744842 243
29 3300025932 Ga0207690_10388408 Ga0207690_103884081 243
30 3300025944 Ga0207661_10179028 Ga0207661_101790282 243
31 3300026067 Ga0207678_10291647 Ga0207678_102916472 243
32 3300026078 Ga0207702_10112406 Ga0207702_101124063 243
33 iso_pu_bacteria 2675903058 2676477668 243
34 iso_pu_bacteria 2811994880 2812363500 243
35 iso_pu_bacteria 2827628540 2827634415 243
36 iso_pu_bacteria 8002317523 8002321346 243
37 3300048917 Ga0496114_0186364 Ga0496114_0186364_659_1423 244
38 3300049570 Ga0501033_0114678 Ga0501033_0114678_271_1032 244
39 3300049579 Ga0501043_0387815 Ga0501043_0387815_81_842 244
40 3300049822 Ga0501035_0358848 Ga0501035_0358848_188_949 244
41 3300049823 Ga0501044_0096108 Ga0501044_0096108_418_1179 244
42 3300025225 Ga0209566_100124 Ga0209566_10012415 247
43 3300053087 Ga0500643_024220 Ga0500643_024220_55_843 247
44 iso_pu_bacteria 2512564039 2512730361 247
45 iso_pu_bacteria 2857604169 2857606914 247
46 iso_pu_bacteria 2865002811 2865004598 247
47 iso_pu_bacteria 2889049205 2889055331 247
48 iso_pu_bacteria 8054795415 8054801872 247
49 3300025291 Ga0209675_1015708 Ga0209675_10157082 248
50 3300031731 Ga0307405_10158839 Ga0307405_101588392 248
51 3300032126 Ga0307415_100060764 Ga0307415_1000607642 248
52 iso_pu_bacteria 2888578766 2888582416 248
53 3300009094 Ga0111539_10206450 Ga0111539_102064502 249
54 3300025294 Ga0209025_1005144 Ga0209025_100514412 249
55 iso_pu_bacteria 2593339198 2595320474 249
56 iso_pu_bacteria 2643221676 2644423236 249
57 iso_pu_bacteria 2818991459 2819670650 249
58 iso_pu_bacteria 2857453340 2857458517 249
59 iso_pu_bacteria 2904755435 2904759967 249
60 iso_pu_bacteria 2919425241 2919427035 249
61 iso_pu_bacteria 2929206907 2929210164 249
62 iso_pu_bacteria 2971410472 2971417434 249
63 iso_pu_bacteria 8056533031 8056540119 249
64 3300009094 Ga0111539_10022131 Ga0111539_100221317 250
65 3300044712 Ga0453684_0001339 Ga0453684_0001339_59542_60318 250
66 3300044712 Ga0453684_0003603 Ga0453684_0003603_110_883 250
67 3300044712 Ga0453684_0038388 Ga0453684_0038388_4103_4876 250
68 iso_pu_bacteria 2643221731 2644720520 250
69 iso_pu_bacteria 2643221732 2644726395 250
70 iso_pu_bacteria 2818991465 2819710981 250
71 iso_pu_bacteria 2842882022 2842886460 250
72 iso_pu_bacteria 2904524088 2904528873 250
73 iso_pu_bacteria 2919143609 2919148503 250
74 iso_pu_bacteria 2919517244 2919521728 250
75 iso_pu_bacteria 2919720352 2919724857 250
76 iso_pu_bacteria 2928093941 2928098151 250
77 iso_pu_bacteria 2929004312 2929007592 250
78 iso_pu_bacteria 2960375949 2960378331 250
79 iso_pu_bacteria 2980176882 2980180617 250
80 iso_pu_bacteria 8022893055 8022894490 250
81 iso_pu_bacteria 8022914991 8022918398 250
82 3300006946 Ga0079104_1002875 Ga0079104_100287511 251
83 3300027111 Ga0209281_1000930 Ga0209281_100093011 251
84 3300027312 Ga0209371_1009535 Ga0209371_10095352 251
85 3300030500 Ga0268256_1011524 Ga0268256_10115242 251
86 3300046463 Ga0495653_0043154 Ga0495653_0043154_1896_2666 251
87 iso_pu_bacteria 2563366752 2563929539 251
88 iso_pu_bacteria 2571042588 2573037339 251
89 iso_pu_bacteria 2671180694 2673820359 251
90 iso_pu_bacteria 8007371054 8007374954 251
91 3300005327 Ga0070658_10202737 Ga0070658_102027372 252
92 3300005329 Ga0070683_100005611 Ga0070683_1000056115 252
93 3300005331 Ga0070670_100145037 Ga0070670_1001450372 252
94 3300005334 Ga0068869_100012935 Ga0068869_1000129355 252
95 3300005338 Ga0068868_100037145 Ga0068868_1000371454 252
96 3300005354 Ga0070675_100001238 Ga0070675_10000123810 252
97 3300005438 Ga0070701_10090396 Ga0070701_100903962 252
98 3300005441 Ga0070700_100004526 Ga0070700_1000045263 252
99 3300005455 Ga0070663_100007124 Ga0070663_1000071247 252
100 3300005535 Ga0070684_100141728 Ga0070684_1001417283 252
101 3300005543 Ga0070672_100210232 Ga0070672_1002102322 252
102 3300005564 Ga0070664_100006551 Ga0070664_1000065518 252
103 3300005616 Ga0068852_100110062 Ga0068852_1001100622 252
104 3300005719 Ga0068861_100024176 Ga0068861_1000241761 252
105 3300005843 Ga0068860_100565373 Ga0068860_1005653731 252
106 3300010375 Ga0105239_10170594 Ga0105239_101705943 252
107 3300025926 Ga0207659_10003418 Ga0207659_100034186 252
108 3300025932 Ga0207690_10107683 Ga0207690_101076833 252
109 3300025940 Ga0207691_10614193 Ga0207691_106141931 252
110 3300025942 Ga0207689_10003583 Ga0207689_100035837 252
111 3300025944 Ga0207661_10234824 Ga0207661_102348242 252
112 3300025945 Ga0207679_10061059 Ga0207679_100610594 252
113 3300026023 Ga0207677_10324834 Ga0207677_103248341 252
114 3300026067 Ga0207678_10130726 Ga0207678_101307263 252
115 3300026075 Ga0207708_10009061 Ga0207708_100090613 252
116 3300026118 Ga0207675_100198168 Ga0207675_1001981682 252
117 3300026142 Ga0207698_10233473 Ga0207698_102334732 252
118 3300031995 Ga0307409_100487409 Ga0307409_1004874092 252
119 3300032126 Ga0307415_100057454 Ga0307415_1000574542 252
120 3300042007 Ga0439449_0007432 Ga0439449_0007432_1560_2336 252
121 3300042015 Ga0439462_0039635 Ga0439462_0039635_108_884 252
122 iso_pu_bacteria 2576861424 2578339003 252
123 iso_pu_bacteria 2881636855 2881638051 252
124 iso_pu_bacteria 2960319331 2960321442 252
125 iso_pu_bacteria 2971511577 2971514403 252
126 iso_pu_bacteria 2984527788 2984530587 252
127 iso_pu_bacteria 2984532647 2984536695 252
128 iso_pu_bacteria 8057733483 8057735562 252
129 3300003751 Ga0055538_1000384 Ga0055538_100038417 253
130 3300025224 Ga0209784_100075 Ga0209784_10007567 253
131 3300037466 Ga0395898_0269171 Ga0395898_0269171_123_899 253
132 3300038443 Ga0395901_0027443 Ga0395901_0027443_2262_3038 253
133 3300044706 Ga0466964_0126969 Ga0466964_0126969_170_1036 253
134 3300045976 Ga0466967_0126017 Ga0466967_0126017_340_1206 253
135 3300048908 Ga0496105_0151515 Ga0496105_0151515_227_1006 253
136 3300048913 Ga0496110_0408405 Ga0496110_0408405_414_1190 253
137 3300048917 Ga0496114_0023599 Ga0496114_0023599_3182_3961 253
138 iso_pu_bacteria 2548877040 2550904448 253
139 iso_pu_bacteria 2571042143 2571530749 253
140 iso_pu_bacteria 2585428059 2587737672 253
141 iso_pu_bacteria 2600255286 2601640456 253
142 iso_pu_bacteria 2728368933 2728531431 253
143 iso_pu_bacteria 2938649242 2938652533 253
144 iso_pu_bacteria 2968558590 2968559303 253
145 iso_pu_bacteria 2971403814 2971410381 253
146 iso_pu_bacteria 2988225383 2988227426 253
147 iso_pu_bacteria 2996632988 2996637766 253
148 iso_pu_bacteria 8055412473 8055413017 253
149 3300003316 rootH1_10001632 rootH1_100016322 254
150 3300003320 rootH2_10263735 rootH2_102637352 254
151 3300003322 rootL2_10013117 rootL2_100131177 254
152 3300003323 rootH1_10079282 rootH1_100792823 254
153 3300003758 Ga0055532_1010381 Ga0055532_10103811 254
154 3300003790 Ga0055528_1012116 Ga0055528_10121161 254
155 3300005331 Ga0070670_100445753 Ga0070670_1004457531 254
156 3300005355 Ga0070671_100024101 Ga0070671_1000241011 254
157 3300006194 Ga0075427_10022603 Ga0075427_100226032 254
158 3300006847 Ga0075431_100211159 Ga0075431_1002111592 254
159 3300009098 Ga0105245_10052863 Ga0105245_100528632 254
160 3300009148 Ga0105243_10003753 Ga0105243_100037538 254
161 3300009176 Ga0105242_10019403 Ga0105242_100194035 254
162 3300011119 Ga0105246_10006483 Ga0105246_100064834 254
163 3300013102 Ga0157371_10178897 Ga0157371_101788972 254
164 3300013297 Ga0157378_10024940 Ga0157378_100249404 254
165 3300014969 Ga0157376_10006446 Ga0157376_100064467 254
166 3300025229 Ga0209147_100396 Ga0209147_10039615 254
167 3300025735 Ga0207713_1007136 Ga0207713_10071367 254
168 3300025926 Ga0207659_10387377 Ga0207659_103873772 254
169 3300025934 Ga0207686_10013021 Ga0207686_100130215 254
170 3300025935 Ga0207709_10015218 Ga0207709_100152184 254
171 3300032002 Ga0307416_100080564 Ga0307416_1000805642 254
172 3300045976 Ga0466967_0274015 Ga0466967_0274015_740_1570 254
173 3300046492 Ga0495585_0037521 Ga0495585_0037521_1038_1814 254
174 3300046558 Ga0495633_0155480 Ga0495633_0155480_214_990 254
175 3300047323 Ga0495683_0199193 Ga0495683_0199193_42_818 254
176 3300048903 Ga0496100_0013397 Ga0496100_0013397_1670_2500 254
177 3300048904 Ga0496101_0056473 Ga0496101_0056473_1177_2007 254
178 3300048905 Ga0496102_0118629 Ga0496102_0118629_591_1421 254
179 3300048906 Ga0496103_0017067 Ga0496103_0017067_2334_3164 254
180 3300048907 Ga0496104_0053747 Ga0496104_0053747_2841_3671 254
181 3300048908 Ga0496105_0014499 Ga0496105_0014499_2749_3579 254
182 3300048909 Ga0496106_0001030 Ga0496106_0001030_18687_19517 254
183 3300048911 Ga0496108_0002659 Ga0496108_0002659_5922_6752 254
184 3300048912 Ga0496109_0018684 Ga0496109_0018684_2930_3760 254
185 3300048913 Ga0496110_0037906 Ga0496110_0037906_2899_3729 254
186 3300048914 Ga0496111_0056546 Ga0496111_0056546_1049_1879 254
187 3300048915 Ga0496112_0006022 Ga0496112_0006022_6921_7751 254
188 3300048916 Ga0496113_0073946 Ga0496113_0073946_591_1421 254
189 3300048917 Ga0496114_0362582 Ga0496114_0362582_342_1118 254
190 3300048919 Ga0496116_0004597 Ga0496116_0004597_2707_3537 254
191 3300048919 Ga0496116_0025696 Ga0496116_0025696_112_894 254
192 3300048922 Ga0496119_0002706 Ga0496119_0002706_3058_3888 254
193 3300048925 Ga0496122_0004997 Ga0496122_0004997_6922_7701 254
194 3300048925 Ga0496122_0020047 Ga0496122_0020047_1535_2317 254
195 3300048925 Ga0496122_0098911 Ga0496122_0098911_832_1662 254
196 3300048928 Ga0496125_0019553 Ga0496125_0019553_3453_4283 254
197 3300048929 Ga0496126_0051837 Ga0496126_0051837_2833_3663 254
198 iso_pu_bacteria 2721755693 2723606289 254
199 iso_pu_bacteria 2728369359 2730136904 254
200 iso_pu_bacteria 2802428803 2802438096 254
201 iso_pu_bacteria 2889276214 2889276840 254
202 iso_pu_bacteria 2904595352 2904596468 254
203 iso_pu_bacteria 2939702853 2939706792 254
204 iso_pu_bacteria 2996706504 2996709823 254
205 iso_pu_bacteria 648028048 648172284 254
206 3300013307 Ga0157372_10942529 Ga0157372_109425291 255
207 3300031995 Ga0307409_100220284 Ga0307409_1002202842 255
208 3300042876 Ga0451577_0106641 Ga0451577_0106641_54_836 255
209 3300044673 Ga0453683_0283440 Ga0453683_0283440_46_828 255
210 3300046543 Ga0495645_0113936 Ga0495645_0113936_677_1489 255
211 3300048904 Ga0496101_0298359 Ga0496101_0298359_306_1091 255
212 3300048908 Ga0496105_0129808 Ga0496105_0129808_1062_1847 255
213 3300048917 Ga0496114_0020619 Ga0496114_0020619_2378_3163 255
214 iso_pu_bacteria 2643221543 2643736900 255
215 iso_pu_bacteria 2821111986 2821118196 255
216 iso_pu_bacteria 2864733723 2864736452 255
217 iso_pu_bacteria 2885526491 2885529843 255
218 iso_pu_bacteria 2889042446 2889048089 255
219 iso_pu_bacteria 2904162308 2904168071 255
220 iso_pu_bacteria 2904490793 2904494357 255
221 iso_pu_bacteria 2919160200 2919165125 255
222 iso_pu_bacteria 2931384279 2931385195 255
223 iso_pu_bacteria 2939679117 2939680638 255
224 iso_pu_bacteria 2945991243 2945996163 255
225 iso_pu_bacteria 2946053406 2946058853 255
226 3300005563 Ga0068855_100002085 Ga0068855_10000208510 256
227 3300042876 Ga0451577_0407133 Ga0451577_0407133_293_1096 256
228 3300048925 Ga0496122_0179541 Ga0496122_0179541_172_954 256
229 3300048928 Ga0496125_0302188 Ga0496125_0302188_102_896 256
230 3300049744 Ga0501083_0000919 Ga0501083_0000919_2936_3730 256
231 3300003320 rootH2_10214427 rootH2_102144271 257
232 3300005347 Ga0070668_100274252 Ga0070668_1002742521 257
233 3300005544 Ga0070686_100541833 Ga0070686_1005418331 257
234 3300009094 Ga0111539_11122528 Ga0111539_111225281 257
235 3300009101 Ga0105247_10070399 Ga0105247_100703993 257
236 3300011119 Ga0105246_10328280 Ga0105246_103282801 257
237 3300013308 Ga0157375_10379320 Ga0157375_103793201 257
238 3300014325 Ga0163163_10048268 Ga0163163_100482682 257
239 3300028381 Ga0268264_10123066 Ga0268264_101230662 257
240 3300044673 Ga0453683_0237029 Ga0453683_0237029_148_936 257
241 3300048911 Ga0496108_0477988 Ga0496108_0477988_224_1012 257
242 3300048922 Ga0496119_0232884 Ga0496119_0232884_44_862 257
243 3300005981 Ga0081538_10028076 Ga0081538_100280764 258
244 3300025901 Ga0207688_10106267 Ga0207688_101062672 258
245 3300038443 Ga0395901_0380101 Ga0395901_0380101_409_1206 258
246 3300046522 Ga0495643_0000111 Ga0495643_0000111_4255_5046 258
247 3300048920 Ga0496117_0067100 Ga0496117_0067100_978_1766 258
248 3300048921 Ga0496118_0044066 Ga0496118_0044066_1669_2457 258
249 3300048922 Ga0496119_0066503 Ga0496119_0066503_1255_2043 258
250 3300048923 Ga0496120_0004192 Ga0496120_0004192_10241_11029 258
251 3300048924 Ga0496121_0045602 Ga0496121_0045602_2280_3068 258
252 3300048924 Ga0496121_0125878 Ga0496121_0125878_922_1710 258
253 3300048926 Ga0496123_0083444 Ga0496123_0083444_38_826 258
254 3300048927 Ga0496124_0076479 Ga0496124_0076479_945_1733 258
255 3300048928 Ga0496125_0001783 Ga0496125_0001783_9500_10288 258
256 3300048929 Ga0496126_0015561 Ga0496126_0015561_3100_3888 258
257 3300002737 JGI25162J39368_1010633 JGI25162J39368_10106331 259
258 3300005539 Ga0068853_100000004 Ga0068853_10000000411 259
259 3300009036 Ga0105244_10023732 Ga0105244_100237321 259
260 3300025233 Ga0209437_101882 Ga0209437_1018825 259
261 3300025728 Ga0207655_1028456 Ga0207655_10284562 259
262 3300026041 Ga0207639_10000029 Ga0207639_10000029186 259
263 3300048928 Ga0496125_0022068 Ga0496125_0022068_4580_5461 259
264 3300053103 Ga0500555_000029 Ga0500555_000029_78480_79286 259
265 3300053153 Ga0500616_0015581 Ga0500616_0015581_197_1003 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

41

287

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rgy-assembly1.cif.gz_A-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.9625 2 255
4rgy-assembly1.cif.gz_B-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.958 2 255
4rgy-assembly1.cif.gz_A-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.9505 2 255
4rgy-assembly1.cif.gz_B-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.946 2 255
2uz0-assembly1.cif.gz_D the crystal crystal structure of the esta protein, a virulence factor esta protein from streptococcus pneumonia 0.9206 2 259
ID Description Score Start End Superfamily
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.958 2 255 3.40.50.1820
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.946 2 255 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8929 1 253 3.40.50.1820
2uz0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8881 2 259 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8826 1 253 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1F9YA67-F1-model_v4 Esterase 0.9766 1 257 GO:0016747
AF-A0A3D0RZ02-F1-model_v4 Esterase 0.9725 1 257 GO:0016747
AF-A0A060BZ48-F1-model_v4 Esterase 0.9714 39 147 GO:0016747
AF-A0A3D0RZ02-F1-model_v4 Esterase 0.9687 1 257 GO:0016747
AF-A0A1C5JES6-F1-model_v4 S-formylglutathione hydrolase FrmB 0.9678 1 259 GO:0016747
GO:0016787

Feature Viewer

pLDDT pTM Quality
93.22 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map