F373344

General Info

Members Datasets Scaffolds Average Seq Length
265 191 257 281

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10036439|Ga0213871_100364392
Length 332
Sequence MATTSAHSETTLAGRIDPDASVGTVRLTVTDLDRSRAFYERAIGLPSTECEDGTLALGVAGERPLIELRGDSVAPRLNRRAPGLYHLAILVPTRLDLAFALARLAEARYPLDGASDHLVSEALYLSDPDGNGIEIYRDRPRAEWPYADDQLQMSTLALDLNDVLGELQAASELQTHVPSGTKIGHVHLQVSDLGEAETFYHGVLGFDVVVRGYPGALFVSAGGYHHHIGLNTWESLGGQPPPRGTTGLYHLAVLYPSRSALADGLRRLLAAGIHLDGASDHGVSEALYLRDPDENGVELYRDRPPAEWPRTPDGKLAMYTRRLDIDDLLREP

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2738541295 Bacillus sp. OK085 Isolate Unclassified
3 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
4 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
5 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
6 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
7 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
120 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0.38
Isolates 3.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 0
Rhizoplane 2.64
Rhizosphere 81.89
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000001 3300002987 Bacteria 303489
2 JGI25160J50197_1000002 3300003354 Bacteria 561707
3 Ga0055526_1001202 3300003771 Bacteria 18643
4 Ga0055524_1015277 3300003775 Bacteria 2807
5 Ga0055536_1036639 3300003781 Bacteria 1211
6 Ga0055531_10004945 3300003794 Bacteria 7923
7 Ga0055543_1000137 3300004625 Bacteria 60651
8 Ga0065165_1000004 3300005262 Bacteria 377081
9 Ga0070670_100166351 3300005331 Bacteria 1912
10 Ga0070666_10101013 3300005335 Bacteria 1988
11 Ga0070680_100553647 3300005336 Archaea 986
12 Ga0070689_100102163 3300005340 Bacteria 2271
13 Ga0070687_100100823 3300005343 Bacteria 1616
14 Ga0070692_10270822 3300005345 Bacteria 1025
15 Ga0070668_100134721 3300005347 Bacteria 1985
16 Ga0070669_100007254 3300005353 Bacteria 7955
17 Ga0070671_100009088 3300005355 Bacteria 7975
18 Ga0070673_100108485 3300005364 Bacteria 2299
19 Ga0070673_100469744 3300005364 Bacteria 1134
20 Ga0070688_100028364 3300005365 Bacteria 3341
21 Ga0070700_100494709 3300005441 Unclassified 939
22 Ga0070681_10130002 3300005458 Bacteria 2450
23 Ga0070698_100017279 3300005471 Bacteria 7602
24 Ga0070698_100399213 3300005471 Bacteria 1308
25 Ga0070699_100024080 3300005518 Bacteria 5247
26 Ga0070679_100025916 3300005530 Bacteria 5753
27 Ga0070684_100005927 3300005535 Bacteria 9410
28 Ga0070684_100189870 3300005535 Bacteria 1869
29 Ga0070697_100165467 3300005536 Bacteria 1870
30 Ga0070672_100186781 3300005543 Bacteria 1729
31 Ga0070672_100195803 3300005543 Bacteria 1689
32 Ga0070686_100058450 3300005544 Bacteria 2481
33 Ga0070695_100071850 3300005545 Archaea 2267
34 Ga0070665_100562128 3300005548 Bacteria 1153
35 Ga0070704_100015559 3300005549 Bacteria 4782
36 Ga0068854_100121377 3300005578 Bacteria 1984
37 Ga0070702_100139118 3300005615 Bacteria 1544
38 Ga0068859_100360080 3300005617 Bacteria 1550
39 Ga0068864_100140749 3300005618 Bacteria 2176
40 Ga0068863_100013519 3300005841 Bacteria 7874
41 Ga0068858_100275497 3300005842 Bacteria 1601
42 Ga0068860_100046753 3300005843 Bacteria 4127
43 Ga0068862_100025466 3300005844 Bacteria 4967
44 Ga0068862_100136858 3300005844 Bacteria 2171
45 Ga0081455_10104602 3300005937 Bacteria 2264
46 Ga0081538_10000058 3300005981 Bacteria 102121
47 Ga0081538_10002406 3300005981 Bacteria 18373
48 Ga0081540_1003574 3300005983 Bacteria 12220
49 Ga0075365_10170322 3300006038 Bacteria 1520
50 Ga0075428_100105053 3300006844 Bacteria 3080
51 Ga0075428_100171320 3300006844 Bacteria 2353
52 Ga0075431_100273281 3300006847 Bacteria 1712
53 Ga0075433_10202397 3300006852 Bacteria 1765
54 Ga0075433_10250522 3300006852 Bacteria 1571
55 Ga0075434_100025549 3300006871 Bacteria 5778
56 Ga0075434_100053292 3300006871 Bacteria 4020
57 Ga0075434_100525471 3300006871 Bacteria 1204
58 Ga0075434_100673361 3300006871 Bacteria 1052
59 Ga0068865_100207310 3300006881 Bacteria 1525
60 Ga0097620_100360074 3300006931 Bacteria 1550
61 Ga0075435_100003450 3300007076 Bacteria 10729
62 Ga0105240_10070820 3300009093 Bacteria 4313
63 Ga0111539_10180022 3300009094 Archaea 2469
64 Ga0114129_10002435 3300009147 Bacteria 25826
65 Ga0114129_10052771 3300009147 Bacteria 5705
66 Ga0114129_10128454 3300009147 Bacteria 3483
67 Ga0114129_10145231 3300009147 Bacteria 3250
68 Ga0114129_10287264 3300009147 Bacteria 2196
69 Ga0114129_10322662 3300009147 Bacteria 2053
70 Ga0105242_10358638 3300009176 Bacteria 1349
71 Ga0105248_10005561 3300009177 Bacteria 13850
72 Ga0105248_10027180 3300009177 Bacteria 6365
73 Ga0157373_10283948 3300013100 Bacteria 1173
74 Ga0157370_10123426 3300013104 Bacteria 2418
75 Ga0157370_10145803 3300013104 Bacteria 2205
76 Ga0157369_10377080 3300013105 Bacteria 1472
77 Ga0171463_1001 3300013249 Bacteria 1406070
78 Ga0163162_10177291 3300013306 Bacteria 2257
79 Ga0157372_10478325 3300013307 Bacteria 1452
80 Ga0157375_10066210 3300013308 Bacteria 3605
81 Ga0163163_10604721 3300014325 Bacteria 1160
82 Ga0157380_10101329 3300014326 Bacteria 2399
83 Ga0157379_10049170 3300014968 Bacteria 3764
84 Ga0213876_10038229 3300021384 Bacteria 2532
85 Ga0213876_10116637 3300021384 Bacteria 1417
86 Ga0213875_10087231 3300021388 Bacteria 1455
87 Ga0213871_10036439 3300021441 Bacteria 1305
88 Ga0224712_10007569 3300022467 Bacteria 3169
89 Ga0209436_100270 3300025208 Bacteria 23759
90 Ga0209130_1000008 3300025284 Bacteria 581232
91 Ga0209676_1005535 3300025292 Bacteria 6549
92 Ga0209025_1000100 3300025294 Bacteria 229182
93 Ga0209564_1000104 3300025295 Bacteria 219017
94 Ga0209256_1000723 3300025299 Bacteria 43638
95 Ga0207426_1000016 3300025302 Bacteria 581232
96 Ga0209051_1039817 3300025303 Bacteria 1692
97 Ga0209257_1002305 3300025304 Bacteria 19326
98 Ga0207680_10018128 3300025903 Bacteria 3735
99 Ga0207645_10092627 3300025907 Bacteria 1944
100 Ga0207695_10012398 3300025913 Bacteria 10237
101 Ga0207695_10127978 3300025913 Bacteria 2500
102 Ga0207660_10342100 3300025917 Archaea 1198
103 Ga0207662_10139975 3300025918 Bacteria 1532
104 Ga0207652_10155523 3300025921 Bacteria 2048
105 Ga0207652_10474324 3300025921 Bacteria 1127
106 Ga0207681_10032835 3300025923 Bacteria 3401
107 Ga0207659_10311455 3300025926 Bacteria 1296
108 Ga0207664_10148074 3300025929 Bacteria 1992
109 Ga0207644_10021338 3300025931 Bacteria 4411
110 Ga0207670_10081529 3300025936 Bacteria 2265
111 Ga0207669_10420388 3300025937 Bacteria 1052
112 Ga0207691_10042620 3300025940 Bacteria 4183
113 Ga0207691_10157400 3300025940 Bacteria 1994
114 Ga0207711_10582225 3300025941 Bacteria 1044
115 Ga0207661_10017089 3300025944 Bacteria 5360
116 Ga0207667_10103918 3300025949 Bacteria 2930
117 Ga0207651_10517186 3300025960 Bacteria 1034
118 Ga0207668_10017109 3300025972 Bacteria 4537
119 Ga0207658_10003721 3300025986 Bacteria 10740
120 Ga0207708_10042330 3300026075 Bacteria 3472
121 Ga0207641_10012385 3300026088 Bacteria 6996
122 Ga0207675_100034057 3300026118 Bacteria 4747
123 Ga0207675_100229854 3300026118 Bacteria 1789
124 Ga0268265_10007982 3300028380 Bacteria 7145
125 Ga0268265_10146058 3300028380 Bacteria 1987
126 Ga0268265_10274301 3300028380 Bacteria 1506
127 Ga0268264_10013934 3300028381 Bacteria 6609
128 Ga0265338_10183962 3300028800 Bacteria 1590
129 Ga0316576_10061510 3300031727 Bacteria 2752
130 Ga0316576_10210128 3300031727 Bacteria 1465
131 Ga0316578_10003763 3300031728 Bacteria 7018
132 Ga0307410_10154705 3300031852 Bacteria 1711
133 Ga0307406_10087462 3300031901 Unclassified 2089
134 Ga0307409_100145939 3300031995 Bacteria 2046
135 Ga0307416_100147962 3300032002 Bacteria 2148
136 Ga0307416_100291380 3300032002 Unclassified 1616
137 Ga0307416_100433275 3300032002 Bacteria 1363
138 Ga0307414_10678796 3300032004 Bacteria 931
139 Ga0307411_10117473 3300032005 Unclassified 1917
140 Ga0316585_10008395 3300032137 Bacteria 2998
141 Ga0316580_10004439 3300032139 Bacteria 4069
142 Ga0373941_0004351 3300035115 Bacteria 3265
143 Ga0316574_0004650 3300035398 Bacteria 7227
144 Ga0373931_0025795 3300035691 Bacteria 2986
145 Ga0373937_0089469 3300036401 Bacteria 2851
146 Ga0316582_0009100 3300036647 Bacteria 5374
147 Ga0316582_0072730 3300036647 Bacteria 2229
148 Ga0316584_0046536 3300036712 Bacteria 3241
149 Ga0316584_0385209 3300036712 Bacteria 1001
150 Ga0395898_0051766 3300037466 Bacteria 4014
151 Ga0436364_0286170 3300037853 Bacteria 9832
152 Ga0436364_0679275 3300037853 Bacteria 6069
153 Ga0436365_0139065 3300039437 Bacteria 6181
154 Ga0436365_0973085 3300039437 Bacteria 6600
155 Ga0436365_1122890 3300039437 Bacteria 13860
156 Ga0436365_1307463 3300039437 Bacteria 3653
157 Ga0436365_1408956 3300039437 Bacteria 6385
158 Ga0436365_1700333 3300039437 Bacteria 6253
159 Ga0436363_0320074 3300039450 Bacteria 2081
160 Ga0436362_0047855 3300039453 Bacteria 4214
161 Ga0436362_0394040 3300039453 Bacteria 1219
162 Ga0466969_0006254 3300044656 Bacteria 6335
163 Ga0466969_0021205 3300044656 Bacteria 3360
164 Ga0466966_0066411 3300044684 Bacteria 2267
165 Ga0466961_0020320 3300044693 Bacteria 4271
166 Ga0466963_0017572 3300044694 Bacteria 4460
167 Ga0466963_0026891 3300044694 Bacteria 3680
168 Ga0466963_0162824 3300044694 Bacteria 1553
169 Ga0466968_0015408 3300044735 Bacteria 3030
170 Ga0466968_0047338 3300044735 Bacteria 1828
171 Ga0466957_0117987 3300044842 Bacteria 1689
172 Ga0466957_0161258 3300044842 Bacteria 1456
173 Ga0466959_0000495 3300045049 Bacteria 22922
174 Ga0466959_0029134 3300045049 Bacteria 4091
175 Ga0466959_0037136 3300045049 Bacteria 3599
176 Ga0466959_0134245 3300045049 Bacteria 1753
177 Ga0466959_0174420 3300045049 Bacteria 1507
178 Ga0466958_0002170 3300045836 Bacteria 9782
179 Ga0466958_0062413 3300045836 Bacteria 2272
180 Ga0466967_0049316 3300045976 Bacteria 3681
181 Ga0466967_0216967 3300045976 Bacteria 1816
182 Ga0466967_0809698 3300045976 Bacteria 930
183 Ga0495584_0181490 3300046491 Unclassified 1070
184 Ga0495642_0136657 3300046528 Bacteria 1057
185 Ga0495656_0106874 3300046615 Bacteria 1303
186 Ga0495674_0046945 3300047319 Bacteria 3832
187 Ga0495672_0025451 3300047320 Bacteria 3787
188 Ga0496101_0031100 3300048904 Bacteria 3750
189 Ga0496102_0469635 3300048905 Bacteria 1179
190 Ga0496105_0154411 3300048908 Bacteria 1886
191 Ga0496106_0167904 3300048909 Bacteria 1738
192 Ga0496107_0051805 3300048910 Bacteria 2961
193 Ga0496108_0174949 3300048911 Bacteria 1858
194 Ga0496110_0122041 3300048913 Bacteria 2348
195 Ga0496119_0000664 3300048922 Bacteria 46081
196 Ga0496122_0011134 3300048925 Bacteria 9161
197 Ga0496123_0001292 3300048926 Bacteria 35699
198 Ga0496124_0055114 3300048927 Bacteria 3362
199 Ga0501031_0300626 3300049568 Bacteria 1040
200 Ga0501039_0226681 3300049575 Bacteria 1469
201 Ga0501040_0022034 3300049576 Bacteria 4261
202 Ga0501040_0069260 3300049576 Bacteria 2434
203 Ga0501041_0026631 3300049577 Bacteria 3479
204 Ga0501041_0041824 3300049577 Bacteria 2784
205 Ga0501041_0204069 3300049577 Bacteria 1240
206 Ga0501042_0015805 3300049578 Bacteria 5173
207 Ga0501043_0204000 3300049579 Bacteria 1534
208 Ga0501046_0156850 3300049580 Bacteria 1714
209 Ga0501048_0395828 3300049582 Bacteria 987
210 Ga0501068_0070942 3300049584 Bacteria 2126
211 Ga0501069_0060662 3300049585 Bacteria 2112
212 Ga0501070_0362075 3300049586 Bacteria 1176
213 Ga0501071_0065199 3300049587 Bacteria 2644
214 Ga0501071_0165611 3300049587 Bacteria 1654
215 Ga0501071_0165781 3300049587 Unclassified 1653
216 Ga0501072_0032030 3300049588 Bacteria 4116
217 Ga0501072_0052245 3300049588 Bacteria 3218
218 Ga0501072_0216302 3300049588 Bacteria 1527
219 Ga0501075_0173604 3300049591 Bacteria 1645
220 Ga0501075_0214489 3300049591 Bacteria 1468
221 Ga0501075_0285222 3300049591 Unclassified 1258
222 Ga0501076_0036852 3300049592 Bacteria 3834
223 Ga0501077_0025079 3300049593 Bacteria 3787
224 Ga0501077_0110894 3300049593 Bacteria 1739
225 Ga0501079_0081010 3300049741 Bacteria 2510
226 Ga0501079_0113736 3300049741 Bacteria 2104
227 Ga0501079_0468789 3300049741 Unclassified 989
228 Ga0501080_0080158 3300049742 Bacteria 3035
229 Ga0501045_0012520 3300049824 Bacteria 5975
230 Ga0501045_0141019 3300049824 Bacteria 1792
231 nmdc:mga05p37_216888_c1 3300050507 Bacteria 2311
232 nmdc:mga05p37_308681_c1 3300050507 Bacteria 1876
233 nmdc:mga05p37_52261_c1 3300050507 Bacteria 5025
234 nmdc:mga05p37_562474_c1 3300050507 Unclassified 1295
235 nmdc:mga05p37_591_c1 3300050507 Bacteria 39971
236 nmdc:mga09592_113668_c1 3300050508 Bacteria 2323
237 nmdc:mga09592_208378_c1 3300050508 Bacteria 1693
238 nmdc:mga08y16_45278_c1 3300050511 Bacteria 4610
239 nmdc:mga0n895_156460_c1 3300050512 Bacteria 2310
240 nmdc:mga0n895_20597_c1 3300050512 Bacteria 6153
241 nmdc:mga0rr50_146588_c1 3300050513 Bacteria 1904
242 nmdc:mga08x19_24825_c1 3300050514 Bacteria 3729
243 nmdc:mga0a205_221457_c1 3300050515 Bacteria 1777
244 nmdc:mga0a205_297223_c1 3300050515 Bacteria 1488
245 nmdc:mga0a205_29753_c1 3300050515 Bacteria 3544
246 Ga0495612_0061256 3300053078 Bacteria 1559
247 Ga0500556_0000367 3300053104 Bacteria 33149
248 Ga0500616_0012820 3300053153 Bacteria 4892
249 Ga0500645_002787 3300053730 Bacteria 7540
250 Ga0501084_0038400 3300054114 Bacteria 4003
251 Ga0501084_0127478 3300054114 Bacteria 2142
252 Ga0501082_0080430 3300060353 Bacteria 2812
253 Ga0501082_0080682 3300060353 Bacteria 2808
254 Ga0466962_0074586 3300061719 Bacteria 1621
255 Ga0530510_0003421 3300061734 Bacteria 10913
256 Ga0530510_0123979 3300061734 Bacteria 1898
257 Ga0530510_0178823 3300061734 Bacteria 1573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0285222 Ga0501075_0285222_529_1242 208
2 3300049586 Ga0501070_0362075 Ga0501070_0362075_458_1153 209
3 3300049568 Ga0501031_0300626 Ga0501031_0300626_29_751 215
4 3300049584 Ga0501068_0070942 Ga0501068_0070942_1376_2098 215
5 3300009094 Ga0111539_10180022 Ga0111539_101800222 229
6 3300013306 Ga0163162_10177291 Ga0163162_101772912 237
7 3300005471 Ga0070698_100399213 Ga0070698_1003992132 242
8 3300005536 Ga0070697_100165467 Ga0070697_1001654672 242
9 3300009147 Ga0114129_10002435 Ga0114129_100024354 242
10 3300050507 nmdc:mga05p37_591_c1 nmdc:mga05p37_591_c1_19406_20245 242
11 3300005345 Ga0070692_10270822 Ga0070692_102708222 245
12 3300006038 Ga0075365_10170322 Ga0075365_101703221 246
13 3300049576 Ga0501040_0069260 Ga0501040_0069260_133_936 247
14 3300049577 Ga0501041_0026631 Ga0501041_0026631_2657_3460 247
15 3300049582 Ga0501048_0395828 Ga0501048_0395828_115_918 247
16 3300049585 Ga0501069_0060662 Ga0501069_0060662_724_1554 247
17 3300049587 Ga0501071_0165781 Ga0501071_0165781_296_1126 247
18 3300049591 Ga0501075_0173604 Ga0501075_0173604_435_1238 247
19 3300049741 Ga0501079_0468789 Ga0501079_0468789_40_870 247
20 3300049824 Ga0501045_0141019 Ga0501045_0141019_937_1767 247
21 3300061734 Ga0530510_0123979 Ga0530510_0123979_240_1070 247
22 3300061734 Ga0530510_0178823 Ga0530510_0178823_169_972 247
23 3300046491 Ga0495584_0181490 Ga0495584_0181490_11_820 249
24 3300005347 Ga0070668_100134721 Ga0070668_1001347212 250
25 3300005844 Ga0068862_100136858 Ga0068862_1001368582 250
26 3300025907 Ga0207645_10092627 Ga0207645_100926272 250
27 3300025923 Ga0207681_10032835 Ga0207681_100328353 250
28 3300025926 Ga0207659_10311455 Ga0207659_103114552 250
29 3300025972 Ga0207668_10017109 Ga0207668_100171094 250
30 3300026118 Ga0207675_100034057 Ga0207675_1000340573 250
31 3300028380 Ga0268265_10007982 Ga0268265_100079823 250
32 3300005335 Ga0070666_10101013 Ga0070666_101010132 253
33 3300005340 Ga0070689_100102163 Ga0070689_1001021633 253
34 3300005343 Ga0070687_100100823 Ga0070687_1001008232 253
35 3300005355 Ga0070671_100009088 Ga0070671_1000090883 253
36 3300005364 Ga0070673_100108485 Ga0070673_1001084851 253
37 3300005543 Ga0070672_100186781 Ga0070672_1001867812 253
38 3300005544 Ga0070686_100058450 Ga0070686_1000584502 253
39 3300005548 Ga0070665_100562128 Ga0070665_1005621282 253
40 3300005615 Ga0070702_100139118 Ga0070702_1001391182 253
41 3300005617 Ga0068859_100360080 Ga0068859_1003600802 253
42 3300005843 Ga0068860_100046753 Ga0068860_1000467532 253
43 3300006931 Ga0097620_100360074 Ga0097620_1003600742 253
44 3300009177 Ga0105248_10005561 Ga0105248_100055616 253
45 3300013308 Ga0157375_10066210 Ga0157375_100662105 253
46 3300014968 Ga0157379_10049170 Ga0157379_100491703 253
47 3300025903 Ga0207680_10018128 Ga0207680_100181282 253
48 3300025918 Ga0207662_10139975 Ga0207662_101399751 253
49 3300025931 Ga0207644_10021338 Ga0207644_100213383 253
50 3300025936 Ga0207670_10081529 Ga0207670_100815292 253
51 3300025940 Ga0207691_10042620 Ga0207691_100426205 253
52 3300025986 Ga0207658_10003721 Ga0207658_100037215 253
53 3300028381 Ga0268264_10013934 Ga0268264_100139343 253
54 3300005841 Ga0068863_100013519 Ga0068863_1000135193 254
55 3300026088 Ga0207641_10012385 Ga0207641_100123853 254
56 3300005353 Ga0070669_100007254 Ga0070669_1000072545 255
57 3300005364 Ga0070673_100469744 Ga0070673_1004697442 255
58 3300005543 Ga0070672_100195803 Ga0070672_1001958032 255
59 3300005844 Ga0068862_100025466 Ga0068862_1000254663 255
60 3300006844 Ga0075428_100105053 Ga0075428_1001050532 255
61 3300006852 Ga0075433_10202397 Ga0075433_102023972 255
62 3300006852 Ga0075433_10250522 Ga0075433_102505223 255
63 3300006871 Ga0075434_100025549 Ga0075434_1000255496 255
64 3300006871 Ga0075434_100525471 Ga0075434_1005254712 255
65 3300006871 Ga0075434_100673361 Ga0075434_1006733611 255
66 3300007076 Ga0075435_100003450 Ga0075435_1000034506 255
67 3300009147 Ga0114129_10052771 Ga0114129_100527713 255
68 3300009147 Ga0114129_10287264 Ga0114129_102872643 255
69 3300014326 Ga0157380_10101329 Ga0157380_101013292 255
70 3300025940 Ga0207691_10157400 Ga0207691_101574002 255
71 3300025960 Ga0207651_10517186 Ga0207651_105171861 255
72 3300026075 Ga0207708_10042330 Ga0207708_100423303 255
73 3300028380 Ga0268265_10146058 Ga0268265_101460582 255
74 3300035691 Ga0373931_0025795 Ga0373931_0025795_2125_2964 255
75 3300045976 Ga0466967_0809698 Ga0466967_0809698_69_905 255
76 3300049576 Ga0501040_0022034 Ga0501040_0022034_3058_3903 255
77 3300049577 Ga0501041_0041824 Ga0501041_0041824_1608_2453 255
78 3300049578 Ga0501042_0015805 Ga0501042_0015805_2924_3769 255
79 3300049580 Ga0501046_0156850 Ga0501046_0156850_620_1465 255
80 3300049588 Ga0501072_0052245 Ga0501072_0052245_1285_2130 255
81 3300049593 Ga0501077_0025079 Ga0501077_0025079_2240_3085 255
82 3300049741 Ga0501079_0081010 Ga0501079_0081010_1094_1939 255
83 3300049742 Ga0501080_0080158 Ga0501080_0080158_1829_2674 255
84 3300050507 nmdc:mga05p37_216888_c1 nmdc:mga05p37_216888_c1_567_1406 255
85 3300050507 nmdc:mga05p37_308681_c1 nmdc:mga05p37_308681_c1_177_1016 255
86 3300050508 nmdc:mga09592_113668_c1 nmdc:mga09592_113668_c1_428_1267 255
87 3300050511 nmdc:mga08y16_45278_c1 nmdc:mga08y16_45278_c1_31_888 255
88 3300050512 nmdc:mga0n895_156460_c1 nmdc:mga0n895_156460_c1_586_1425 255
89 3300050513 nmdc:mga0rr50_146588_c1 nmdc:mga0rr50_146588_c1_464_1303 255
90 3300050514 nmdc:mga08x19_24825_c1 nmdc:mga08x19_24825_c1_1229_2068 255
91 3300050515 nmdc:mga0a205_221457_c1 nmdc:mga0a205_221457_c1_808_1647 255
92 3300050515 nmdc:mga0a205_297223_c1 nmdc:mga0a205_297223_c1_99_938 255
93 3300050515 nmdc:mga0a205_29753_c1 nmdc:mga0a205_29753_c1_28_867 255
94 3300054114 Ga0501084_0038400 Ga0501084_0038400_1902_2747 255
95 3300060353 Ga0501082_0080430 Ga0501082_0080430_504_1349 255
96 3300061734 Ga0530510_0003421 Ga0530510_0003421_7678_8523 255
97 3300028380 Ga0268265_10274301 Ga0268265_102743012 256
98 3300009176 Ga0105242_10358638 Ga0105242_103586382 257
99 3300026118 Ga0207675_100229854 Ga0207675_1002298542 257
100 3300031727 Ga0316576_10061510 Ga0316576_100615103 257
101 3300032137 Ga0316585_10008395 Ga0316585_100083953 257
102 3300036647 Ga0316582_0072730 Ga0316582_0072730_82_924 257
103 3300036712 Ga0316584_0046536 Ga0316584_0046536_27_869 257
104 3300046528 Ga0495642_0136657 Ga0495642_0136657_169_1032 257
105 3300048909 Ga0496106_0167904 Ga0496106_0167904_702_1535 257
106 3300048910 Ga0496107_0051805 Ga0496107_0051805_418_1251 257
107 3300050508 nmdc:mga09592_208378_c1 nmdc:mga09592_208378_c1_408_1256 257
108 iso_pu_bacteria 2857609550 2857609869 257
109 3300044656 Ga0466969_0021205 Ga0466969_0021205_2413_3270 258
110 3300044693 Ga0466961_0020320 Ga0466961_0020320_2881_3738 258
111 3300044694 Ga0466963_0017572 Ga0466963_0017572_94_951 258
112 3300044735 Ga0466968_0047338 Ga0466968_0047338_496_1353 258
113 3300044842 Ga0466957_0161258 Ga0466957_0161258_496_1353 258
114 3300045049 Ga0466959_0000495 Ga0466959_0000495_18466_19323 258
115 3300049587 Ga0501071_0065199 Ga0501071_0065199_604_1446 258
116 3300049588 Ga0501072_0032030 Ga0501072_0032030_616_1458 258
117 3300049591 Ga0501075_0214489 Ga0501075_0214489_460_1302 258
118 3300049592 Ga0501076_0036852 Ga0501076_0036852_2011_2853 258
119 3300049741 Ga0501079_0113736 Ga0501079_0113736_490_1332 258
120 3300049824 Ga0501045_0012520 Ga0501045_0012520_1463_2305 258
121 3300005336 Ga0070680_100553647 Ga0070680_1005536471 259
122 3300005365 Ga0070688_100028364 Ga0070688_1000283642 259
123 3300005545 Ga0070695_100071850 Ga0070695_1000718501 259
124 3300025917 Ga0207660_10342100 Ga0207660_103421002 259
125 3300047319 Ga0495674_0046945 Ga0495674_0046945_604_1461 259
126 iso_pu_bacteria 2554235469 2556065892 260
127 3300006847 Ga0075431_100273281 Ga0075431_1002732813 261
128 3300006871 Ga0075434_100053292 Ga0075434_1000532923 261
129 3300009147 Ga0114129_10128454 Ga0114129_101284542 261
130 3300009177 Ga0105248_10027180 Ga0105248_100271802 261
131 3300025941 Ga0207711_10582225 Ga0207711_105822252 261
132 3300031852 Ga0307410_10154705 Ga0307410_101547052 261
133 3300032004 Ga0307414_10678796 Ga0307414_106787961 261
134 3300035115 Ga0373941_0004351 Ga0373941_0004351_470_1312 261
135 3300050507 nmdc:mga05p37_52261_c1 nmdc:mga05p37_52261_c1_2225_3064 261
136 3300050512 nmdc:mga0n895_20597_c1 nmdc:mga0n895_20597_c1_161_1000 261
137 iso_pu_bacteria 2738541295 2738817790 261
138 iso_pu_bacteria 2990275345 2990276529 261
139 iso_pu_bacteria 3001892409 3001892894 261
140 iso_pu_bacteria 3006978542 3006980337 261
141 iso_pu_bacteria 8054280661 8054282166 261
142 3300031901 Ga0307406_10087462 Ga0307406_100874622 262
143 3300032002 Ga0307416_100291380 Ga0307416_1002913802 262
144 3300032005 Ga0307411_10117473 Ga0307411_101174732 262
145 3300032139 Ga0316580_10004439 Ga0316580_100044392 262
146 3300046615 Ga0495656_0106874 Ga0495656_0106874_424_1281 262
147 3300005981 Ga0081538_10000058 Ga0081538_1000005880 263
148 3300005981 Ga0081538_10002406 Ga0081538_1000240611 263
149 3300025937 Ga0207669_10420388 Ga0207669_104203882 263
150 3300044684 Ga0466966_0066411 Ga0466966_0066411_1375_2250 263
151 3300048904 Ga0496101_0031100 Ga0496101_0031100_805_1659 263
152 3300048908 Ga0496105_0154411 Ga0496105_0154411_302_1156 263
153 3300048911 Ga0496108_0174949 Ga0496108_0174949_323_1177 263
154 3300048913 Ga0496110_0122041 Ga0496110_0122041_1162_2016 263
155 3300005331 Ga0070670_100166351 Ga0070670_1001663512 264
156 3300048925 Ga0496122_0011134 Ga0496122_0011134_8276_9151 264
157 3300048926 Ga0496123_0001292 Ga0496123_0001292_8358_9233 264
158 3300005471 Ga0070698_100017279 Ga0070698_1000172793 265
159 3300005518 Ga0070699_100024080 Ga0070699_1000240802 265
160 3300005535 Ga0070684_100005927 Ga0070684_1000059276 265
161 3300005578 Ga0068854_100121377 Ga0068854_1001213772 265
162 3300013100 Ga0157373_10283948 Ga0157373_102839482 265
163 3300013104 Ga0157370_10123426 Ga0157370_101234261 265
164 3300013105 Ga0157369_10377080 Ga0157369_103770802 265
165 3300025913 Ga0207695_10012398 Ga0207695_1001239811 265
166 3300025921 Ga0207652_10474324 Ga0207652_104743241 265
167 3300025929 Ga0207664_10148074 Ga0207664_101480742 265
168 3300025949 Ga0207667_10103918 Ga0207667_101039182 265
169 3300028800 Ga0265338_10183962 Ga0265338_101839621 265
170 3300032002 Ga0307416_100433275 Ga0307416_1004332751 265
171 3300036401 Ga0373937_0089469 Ga0373937_0089469_1018_1878 265
172 3300045976 Ga0466967_0216967 Ga0466967_0216967_712_1569 265
173 3300049575 Ga0501039_0226681 Ga0501039_0226681_99_950 265
174 3300049577 Ga0501041_0204069 Ga0501041_0204069_195_1046 265
175 3300049587 Ga0501071_0165611 Ga0501071_0165611_435_1286 265
176 3300049588 Ga0501072_0216302 Ga0501072_0216302_451_1302 265
177 3300049593 Ga0501077_0110894 Ga0501077_0110894_870_1721 265
178 3300054114 Ga0501084_0127478 Ga0501084_0127478_1195_2046 265
179 3300060353 Ga0501082_0080682 Ga0501082_0080682_1515_2366 265
180 3300005441 Ga0070700_100494709 Ga0070700_1004947091 266
181 3300005535 Ga0070684_100189870 Ga0070684_1001898702 266
182 3300005618 Ga0068864_100140749 Ga0068864_1001407492 266
183 3300005842 Ga0068858_100275497 Ga0068858_1002754971 266
184 3300006844 Ga0075428_100171320 Ga0075428_1001713202 266
185 3300014325 Ga0163163_10604721 Ga0163163_106047211 266
186 3300031727 Ga0316576_10210128 Ga0316576_102101282 266
187 3300036712 Ga0316584_0385209 Ga0316584_0385209_29_907 266
188 3300047320 Ga0495672_0025451 Ga0495672_0025451_12_896 266
189 3300049579 Ga0501043_0204000 Ga0501043_0204000_662_1519 266
190 3300053153 Ga0500616_0012820 Ga0500616_0012820_986_1840 266
191 iso_pu_bacteria 2828305725 2828308591 266
192 3300005458 Ga0070681_10130002 Ga0070681_101300022 267
193 3300005530 Ga0070679_100025916 Ga0070679_1000259162 267
194 3300005937 Ga0081455_10104602 Ga0081455_101046022 267
195 3300005983 Ga0081540_1003574 Ga0081540_100357411 267
196 3300009093 Ga0105240_10070820 Ga0105240_100708203 267
197 3300009147 Ga0114129_10145231 Ga0114129_101452314 267
198 3300013104 Ga0157370_10145803 Ga0157370_101458032 267
199 3300013307 Ga0157372_10478325 Ga0157372_104783251 267
200 3300021388 Ga0213875_10087231 Ga0213875_100872312 267
201 3300025913 Ga0207695_10127978 Ga0207695_101279782 267
202 3300025921 Ga0207652_10155523 Ga0207652_101555233 267
203 3300025944 Ga0207661_10017089 Ga0207661_100170895 267
204 3300031728 Ga0316578_10003763 Ga0316578_100037633 267
205 3300035398 Ga0316574_0004650 Ga0316574_0004650_4867_5775 267
206 3300036647 Ga0316582_0009100 Ga0316582_0009100_1456_2364 267
207 3300048905 Ga0496102_0469635 Ga0496102_0469635_264_1127 267
208 3300005549 Ga0070704_100015559 Ga0070704_1000155592 268
209 3300044735 Ga0466968_0015408 Ga0466968_0015408_1866_2747 268
210 3300006881 Ga0068865_100207310 Ga0068865_1002073102 269
211 3300021384 Ga0213876_10116637 Ga0213876_101166372 269
212 3300031995 Ga0307409_100145939 Ga0307409_1001459392 269
213 3300032002 Ga0307416_100147962 Ga0307416_1001479622 269
214 3300039437 Ga0436365_0139065 Ga0436365_0139065_4692_5579 269
215 3300039453 Ga0436362_0047855 Ga0436362_0047855_867_1757 269
216 3300045049 Ga0466959_0174420 Ga0466959_0174420_564_1466 269
217 3300048922 Ga0496119_0000664 Ga0496119_0000664_3789_4664 269
218 3300053104 Ga0500556_0000367 Ga0500556_0000367_14646_15521 269
219 3300053730 Ga0500645_002787 Ga0500645_002787_3720_4595 269
220 3300009147 Ga0114129_10322662 Ga0114129_103226622 270
221 3300013249 Ga0171463_1001 Ga0171463_1001367 270
222 3300021384 Ga0213876_10038229 Ga0213876_100382295 270
223 3300021441 Ga0213871_10036439 Ga0213871_100364392 270
224 3300022467 Ga0224712_10007569 Ga0224712_100075693 270
225 3300037853 Ga0436364_0286170 Ga0436364_0286170_3176_4078 270
226 3300037853 Ga0436364_0679275 Ga0436364_0679275_503_1405 270
227 3300039437 Ga0436365_0973085 Ga0436365_0973085_383_1276 270
228 3300039437 Ga0436365_1122890 Ga0436365_1122890_12107_12994 270
229 3300039437 Ga0436365_1307463 Ga0436365_1307463_606_1508 270
230 3300039437 Ga0436365_1408956 Ga0436365_1408956_3143_4048 270
231 3300039437 Ga0436365_1700333 Ga0436365_1700333_3062_3943 270
232 3300039450 Ga0436363_0320074 Ga0436363_0320074_543_1445 270
233 3300039453 Ga0436362_0394040 Ga0436362_0394040_214_1116 270
234 3300044694 Ga0466963_0026891 Ga0466963_0026891_761_1711 270
235 3300044842 Ga0466957_0117987 Ga0466957_0117987_678_1628 270
236 3300045049 Ga0466959_0029134 Ga0466959_0029134_2871_3821 270
237 3300045049 Ga0466959_0037136 Ga0466959_0037136_1924_2823 270
238 3300045836 Ga0466958_0002170 Ga0466958_0002170_2675_3625 270
239 3300045976 Ga0466967_0049316 Ga0466967_0049316_2441_3391 270
240 3300050507 nmdc:mga05p37_562474_c1 nmdc:mga05p37_562474_c1_312_1214 270
241 3300053078 Ga0495612_0061256 Ga0495612_0061256_303_1244 270
242 3300061719 Ga0466962_0074586 Ga0466962_0074586_125_1075 270
243 3300002987 JGI25159J45721_1000001 JGI25159J45721_1000001260 271
244 3300003354 JGI25160J50197_1000002 JGI25160J50197_100000254 271
245 3300003771 Ga0055526_1001202 Ga0055526_10012024 271
246 3300003775 Ga0055524_1015277 Ga0055524_10152774 271
247 3300003781 Ga0055536_1036639 Ga0055536_10366391 271
248 3300003794 Ga0055531_10004945 Ga0055531_100049456 271
249 3300004625 Ga0055543_1000137 Ga0055543_100013733 271
250 3300005262 Ga0065165_1000004 Ga0065165_1000004328 271
251 3300025208 Ga0209436_100270 Ga0209436_10027024 271
252 3300025284 Ga0209130_1000008 Ga0209130_1000008487 271
253 3300025292 Ga0209676_1005535 Ga0209676_10055358 271
254 3300025294 Ga0209025_1000100 Ga0209025_100010073 271
255 3300025295 Ga0209564_1000104 Ga0209564_1000104169 271
256 3300025299 Ga0209256_1000723 Ga0209256_100072315 271
257 3300025302 Ga0207426_1000016 Ga0207426_100001675 271
258 3300025303 Ga0209051_1039817 Ga0209051_10398172 271
259 3300025304 Ga0209257_1002305 Ga0209257_10023052 271
260 3300037466 Ga0395898_0051766 Ga0395898_0051766_3040_3939 271
261 3300044656 Ga0466969_0006254 Ga0466969_0006254_3498_4403 271
262 3300044694 Ga0466963_0162824 Ga0466963_0162824_555_1460 271
263 3300045049 Ga0466959_0134245 Ga0466959_0134245_799_1689 271
264 3300045836 Ga0466958_0062413 Ga0466958_0062413_799_1704 271
265 3300048927 Ga0496124_0055114 Ga0496124_0055114_1439_2329 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

182

299

0.93

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

135

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.8194 14 129
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8008 14 132
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7951 14 134
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7925 13 130
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7843 12 130
ID Description Score Start End Superfamily
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9309 14 139 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9238 14 139 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.915 16 148 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9083 16 148 3.10.180.10
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8379 18 129 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A356I999-F1-model_v4 Glyoxalase 0.9677 14 134
AF-A0A2H5Z0Z5-F1-model_v4 Catechol-2,3-dioxygenase (EC 1.13.11.2) 0.9557 162 270 GO:0018577
AF-A0A436QZA0-F1-model_v4 VOC family protein 0.9504 13 139
AF-A0A430AQ59-F1-model_v4 VOC domain-containing protein 0.9496 12 126
AF-A0A1M2YU79-F1-model_v4 deleted 0.9482 13 155

Feature Viewer

pLDDT pTM Quality
89.96 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map