F373288

General Info

Members Datasets Scaffolds Average Seq Length
265 147 530 226

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10703276|Ga0105243_107032761
Length 245
Sequence MDAAASGGWLRLASRHVAVSVSARTVMQTTLIDSADLSRLVYFFDILAAVVFAVSGALVASRKSLDVMGFMWLAVITGVGGGTVRDLILDVPVFWVQNPVYVSACLVTAVVVHFVAPRVESRYRTLLWFDAFGLALVTVAGTARALDVGAPALVAIAMGAVTGAVGGIIRDTLGHVPSVLLRHEIYITASVLGACTYVGLNGLGVERLAAMIAAFLVTFVVRGLAIKFGWSLPVFRGSAASALDE

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
98 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
101 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
102 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
127 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 1.13
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 15.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10703276 3300009148 Unclassified 985
2 JGI24033J26618_1016785 3300002155 Bacteria 912
3 Ga0065704_10198858 3300005289 Unclassified 1155
4 Ga0065712_10005366 3300005290 Bacteria 3720
5 Ga0065715_10109269 3300005293 Bacteria 2675
6 Ga0065715_10146310 3300005293 Bacteria 1784
7 Ga0065707_10107605 3300005295 Bacteria 2547
8 Ga0070676_10205959 3300005328 Bacteria 1292
9 Ga0070683_100008430 3300005329 Bacteria 8755
10 Ga0070670_100017469 3300005331 Bacteria 6154
11 Ga0070670_100064651 3300005331 Bacteria 3139
12 Ga0070677_10033580 3300005333 Bacteria 1977
13 Ga0070677_10114018 3300005333 Bacteria 1211
14 Ga0070689_100208133 3300005340 Unclassified 1600
15 Ga0070668_100194724 3300005347 Bacteria 1661
16 Ga0070669_100003212 3300005353 Bacteria 11743
17 Ga0070669_100027871 3300005353 Bacteria 4066
18 Ga0070669_100071280 3300005353 Bacteria 2571
19 Ga0070669_100667483 3300005353 Unclassified 876
20 Ga0070669_100726956 3300005353 Bacteria 840
21 Ga0070675_100045268 3300005354 Bacteria 3600
22 Ga0070675_100077604 3300005354 Bacteria 2765
23 Ga0070675_100623114 3300005354 Unclassified 979
24 Ga0070671_100016982 3300005355 Bacteria 5885
25 Ga0070674_100006397 3300005356 Bacteria 6870
26 Ga0070674_100034623 3300005356 Bacteria 3375
27 Ga0070674_100070644 3300005356 Bacteria 2468
28 Ga0070674_100712567 3300005356 Bacteria 859
29 Ga0070673_100018748 3300005364 Bacteria 4954
30 Ga0070673_100020489 3300005364 Bacteria 4771
31 Ga0070673_100063465 3300005364 Bacteria 2939
32 Ga0070688_100224601 3300005365 Bacteria 1325
33 Ga0070688_100327909 3300005365 Unclassified 1114
34 Ga0070667_100278612 3300005367 Unclassified 1501
35 Ga0070667_100446816 3300005367 Bacteria 1181
36 Ga0070694_100062450 3300005444 Bacteria 2545
37 Ga0070678_100110585 3300005456 Bacteria 2149
38 Ga0070678_100300478 3300005456 Bacteria 1364
39 Ga0070678_100320056 3300005456 Bacteria 1324
40 Ga0070678_100394849 3300005456 Bacteria 1200
41 Ga0070678_100461986 3300005456 Unclassified 1114
42 Ga0070662_100039194 3300005457 Bacteria 3370
43 Ga0070662_100134796 3300005457 Bacteria 1908
44 Ga0068867_100373967 3300005459 Bacteria 1195
45 Ga0068867_100434465 3300005459 Bacteria 1115
46 Ga0070672_100050808 3300005543 Bacteria 3231
47 Ga0070672_100098401 3300005543 Bacteria 2369
48 Ga0070695_100000355 3300005545 Bacteria 23470
49 Ga0070695_100087009 3300005545 Unclassified 2078
50 Ga0070664_100108662 3300005564 Bacteria 2419
51 Ga0070664_100342002 3300005564 Unclassified 1359
52 Ga0068857_100034415 3300005577 Bacteria 4482
53 Ga0068857_100384794 3300005577 Bacteria 1303
54 Ga0070702_100470610 3300005615 Bacteria 916
55 Ga0068859_100028052 3300005617 Bacteria 5645
56 Ga0068859_100047135 3300005617 Bacteria 4330
57 Ga0068859_100487385 3300005617 Unclassified 1328
58 Ga0068864_100082748 3300005618 Bacteria 2817
59 Ga0068866_10184206 3300005718 Bacteria 1236
60 Ga0068861_100368543 3300005719 Bacteria 1265
61 Ga0068861_100426637 3300005719 Bacteria 1183
62 Ga0068870_10005934 3300005840 Bacteria 5366
63 Ga0068863_100260418 3300005841 Bacteria 1677
64 Ga0068858_100561859 3300005842 Bacteria 1105
65 Ga0068862_100002473 3300005844 Bacteria 16357
66 Ga0068862_100020661 3300005844 Bacteria 5501
67 Ga0075367_10022770 3300006178 Bacteria 3517
68 Ga0075366_10016146 3300006195 Bacteria 4288
69 Ga0075431_100010427 3300006847 Bacteria 9340
70 Ga0075431_100168598 3300006847 Bacteria 2250
71 Ga0075431_100187104 3300006847 Bacteria 2123
72 Ga0075431_100223038 3300006847 Bacteria 1922
73 Ga0075429_100085313 3300006880 Bacteria 2753
74 Ga0075429_100085751 3300006880 Bacteria 2745
75 Ga0068865_100088557 3300006881 Bacteria 2240
76 Ga0097620_100028052 3300006931 Bacteria 5645
77 Ga0097620_100047134 3300006931 Bacteria 4330
78 Ga0097620_100487482 3300006931 Unclassified 1328
79 Ga0111539_10000435 3300009094 Bacteria 52742
80 Ga0111539_10001064 3300009094 Bacteria 36182
81 Ga0111539_10201338 3300009094 Unclassified 2322
82 Ga0111539_10427151 3300009094 Bacteria 1543
83 Ga0114129_10057980 3300009147 Bacteria 5418
84 Ga0105249_10007016 3300009553 Bacteria 9833
85 Ga0105249_10238200 3300009553 Bacteria 1798
86 Ga0105249_10282940 3300009553 Bacteria 1657
87 Ga0105249_10381455 3300009553 Bacteria 1435
88 Ga0157378_11345660 3300013297 Unclassified 756
89 Ga0157375_10016930 3300013308 Bacteria 6568
90 Ga0157375_10182421 3300013308 Bacteria 2251
91 Ga0163163_10031346 3300014325 Bacteria 5130
92 Ga0163163_10191019 3300014325 Bacteria 2096
93 Ga0163163_10645951 3300014325 Bacteria 1121
94 Ga0157380_10011630 3300014326 Bacteria 6362
95 Ga0157380_10060488 3300014326 Bacteria 3027
96 Ga0157380_10190144 3300014326 Bacteria 1811
97 Ga0157380_11008330 3300014326 Bacteria 866
98 Ga0157377_10142897 3300014745 Unclassified 1472
99 Ga0157377_10396055 3300014745 Bacteria 939
100 Ga0207666_1005468 3300025271 Unclassified 1624
101 Ga0207682_10009941 3300025893 Bacteria 3737
102 Ga0207682_10116280 3300025893 Bacteria 1182
103 Ga0207688_10160534 3300025901 Bacteria 1332
104 Ga0207688_10218638 3300025901 Bacteria 1147
105 Ga0207680_10397955 3300025903 Bacteria 973
106 Ga0207645_10113008 3300025907 Bacteria 1759
107 Ga0207643_10009688 3300025908 Bacteria 5170
108 Ga0207643_10074532 3300025908 Bacteria 1958
109 Ga0207657_10239240 3300025919 Bacteria 1450
110 Ga0207681_10017910 3300025923 Bacteria 4454
111 Ga0207681_10068473 3300025923 Bacteria 2465
112 Ga0207681_10156745 3300025923 Bacteria 1712
113 Ga0207681_10331201 3300025923 Unclassified 1214
114 Ga0207650_10013778 3300025925 Bacteria 5606
115 Ga0207650_10035260 3300025925 Bacteria 3631
116 Ga0207650_10102848 3300025925 Bacteria 2202
117 Ga0207650_10287877 3300025925 Bacteria 1339
118 Ga0207659_10001139 3300025926 Bacteria 15793
119 Ga0207659_10018516 3300025926 Bacteria 4566
120 Ga0207659_10050147 3300025926 Bacteria 2964
121 Ga0207659_10099062 3300025926 Bacteria 2193
122 Ga0207659_10185115 3300025926 Bacteria 1653
123 Ga0207644_10140000 3300025931 Bacteria 1862
124 Ga0207706_10274619 3300025933 Unclassified 1470
125 Ga0207670_10306265 3300025936 Bacteria 1246
126 Ga0207669_10039753 3300025937 Bacteria 2722
127 Ga0207669_10136407 3300025937 Bacteria 1695
128 Ga0207669_10367451 3300025937 Bacteria 1117
129 Ga0207669_10396209 3300025937 Bacteria 1080
130 Ga0207704_10114172 3300025938 Bacteria 1833
131 Ga0207691_10008839 3300025940 Bacteria 9665
132 Ga0207691_10042046 3300025940 Bacteria 4215
133 Ga0207691_10126262 3300025940 Bacteria 2263
134 Ga0207661_10021226 3300025944 Bacteria 4866
135 Ga0207679_10138562 3300025945 Bacteria 1963
136 Ga0207651_10122435 3300025960 Bacteria 1975
137 Ga0207651_10572446 3300025960 Unclassified 984
138 Ga0207712_10210226 3300025961 Bacteria 1549
139 Ga0207658_10390032 3300025986 Unclassified 1222
140 Ga0207708_10053705 3300026075 Bacteria 3071
141 Ga0207708_10454313 3300026075 Unclassified 1067
142 Ga0207708_10731755 3300026075 Bacteria 848
143 Ga0207641_11097040 3300026088 Unclassified 794
144 Ga0207676_10059092 3300026095 Bacteria 3027
145 Ga0207674_10043970 3300026116 Bacteria 4603
146 Ga0207674_10628936 3300026116 Bacteria 1037
147 Ga0207675_100021085 3300026118 Bacteria 6072
148 Ga0207675_100419427 3300026118 Bacteria 1321
149 Ga0207675_100467775 3300026118 Bacteria 1251
150 Ga0207683_10065980 3300026121 Bacteria 3191
151 Ga0207683_10120393 3300026121 Bacteria 2356
152 Ga0207683_10257742 3300026121 Bacteria 1592
153 Ga0207683_10383908 3300026121 Bacteria 1291
154 Ga0207683_10532810 3300026121 Bacteria 1085
155 Ga0209971_1011615 3300027682 Bacteria 2086
156 Ga0209813_10142983 3300027866 Unclassified 851
157 Ga0209974_10048087 3300027876 Unclassified 1429
158 Ga0207428_10000298 3300027907 Bacteria 65387
159 Ga0207428_10009357 3300027907 Bacteria 8791
160 Ga0307408_100083101 3300031548 Bacteria 2399
161 Ga0307408_100278414 3300031548 Unclassified 1392
162 Ga0307410_10015475 3300031852 Bacteria 4526
163 Ga0307406_10225863 3300031901 Unclassified 1395
164 Ga0307406_10509399 3300031901 Unclassified 977
165 Ga0307412_10201334 3300031911 Bacteria 1512
166 Ga0307409_100006003 3300031995 Bacteria 7081
167 Ga0307409_100153665 3300031995 Bacteria 2002
168 Ga0307409_100245314 3300031995 Bacteria 1634
169 Ga0307416_100247021 3300032002 Unclassified 1734
170 Ga0307416_100457144 3300032002 Bacteria 1331
171 Ga0307414_10852699 3300032004 Unclassified 833
172 Ga0307411_10171621 3300032005 Bacteria 1636
173 Ga0307411_10238704 3300032005 Bacteria 1421
174 Ga0307411_10253498 3300032005 Unclassified 1385
175 Ga0451800_0561753 3300041459 Bacteria 983
176 Ga0451807_0782074 3300041486 Bacteria 1258
177 Ga0451807_2256874 3300041486 Bacteria 2205
178 Ga0451849_1321590 3300041505 Bacteria 713
179 Ga0451853_0191802 3300041512 Bacteria 1094
180 Ga0439433_0002757 3300041999 Bacteria 3742
181 Ga0439433_0057806 3300041999 Bacteria 922
182 Ga0439449_0045029 3300042007 Bacteria 1636
183 Ga0439462_0079058 3300042015 Bacteria 897
184 Ga0450894_004410 3300042131 Bacteria 1828
185 Ga0450896_000360 3300042133 Bacteria 4469
186 Ga0439446_0001935 3300042156 Bacteria 4878
187 Ga0439435_0007520 3300042436 Bacteria 2495
188 Ga0439435_0133323 3300042436 Unclassified 786
189 Ga0450918_001999 3300042531 Bacteria 3914
190 Ga0439440_0115994 3300042993 Bacteria 741
191 Ga0453684_0133982 3300044712 Unclassified 2969
192 Ga0495672_0116417 3300047320 Bacteria 1427
193 Ga0501291_032967 3300049514 Unclassified 881
194 Ga0501031_0214886 3300049568 Bacteria 1253
195 Ga0501031_0282325 3300049568 Bacteria 1077
196 Ga0501036_0132060 3300049572 Bacteria 2108
197 Ga0501038_0187521 3300049574 Bacteria 1666
198 Ga0501039_0161309 3300049575 Bacteria 1762
199 Ga0501039_0320527 3300049575 Bacteria 1218
200 Ga0501042_0110373 3300049578 Bacteria 1981
201 Ga0501042_0210387 3300049578 Bacteria 1403
202 Ga0501046_0398172 3300049580 Bacteria 995
203 Ga0501047_0133698 3300049581 Bacteria 2361
204 Ga0501048_0152972 3300049582 Bacteria 1632
205 Ga0501048_0559892 3300049582 Bacteria 820
206 Ga0501067_0098846 3300049583 Bacteria 1621
207 Ga0501067_0184699 3300049583 Bacteria 1161
208 Ga0501068_0139344 3300049584 Bacteria 1520
209 Ga0501071_0163381 3300049587 Bacteria 1665
210 Ga0501071_0230653 3300049587 Unclassified 1395
211 Ga0501071_0406360 3300049587 Bacteria 1040
212 Ga0501072_0065590 3300049588 Bacteria 2863
213 Ga0501072_0167212 3300049588 Bacteria 1755
214 Ga0501073_0384429 3300049589 Bacteria 970
215 Ga0501074_0059634 3300049590 Bacteria 2749
216 Ga0501075_0232831 3300049591 Bacteria 1404
217 Ga0501076_0829989 3300049592 Unclassified 762
218 Ga0501077_0044532 3300049593 Bacteria 2819
219 Ga0501077_0125943 3300049593 Bacteria 1624
220 Ga0501077_0333664 3300049593 Bacteria 967
221 Ga0501077_0433124 3300049593 Unclassified 842
222 Ga0501209_040757 3300049656 Bacteria 1227
223 Ga0501079_0321820 3300049741 Bacteria 1211
224 Ga0501080_0093129 3300049742 Bacteria 2798
225 Ga0501080_0149755 3300049742 Unclassified 2157
226 Ga0501080_0360078 3300049742 Bacteria 1313
227 Ga0501280_008489 3300049776 Bacteria 1431
228 Ga0501283_005785 3300049779 Bacteria 1710
229 Ga0501045_0185350 3300049824 Unclassified 1551
230 Ga0501045_0196988 3300049824 Bacteria 1501
231 Ga0501045_0316106 3300049824 Bacteria 1162
232 nmdc:mga03683_239077_c1 3300050489 Unclassified 841
233 nmdc:mga0k408_24267_c1 3300050493 Bacteria 3427
234 nmdc:mga06z11_272133_c1 3300050494 Bacteria 1002
235 nmdc:mga04h51_157910_c1 3300050495 Unclassified 871
236 nmdc:mga05p37_107808_c1 3300050507 Bacteria 3427
237 nmdc:mga09592_133155_c1 3300050508 Bacteria 2140
238 nmdc:mga09592_31753_c1 3300050508 Bacteria 4401
239 nmdc:mga0qj67_1854_c1 3300050509 Bacteria 14979
240 nmdc:mga0qj67_357666_c1 3300050509 Unclassified 1180
241 nmdc:mga0qj67_6114_c1 3300050509 Bacteria 8826
242 nmdc:mga06r32_258862_c1 3300050510 Bacteria 1728
243 nmdc:mga06r32_413825_c1 3300050510 Bacteria 1330
244 nmdc:mga06r32_4698_c1 3300050510 Bacteria 12270
245 nmdc:mga06r32_8269_c1 3300050510 Bacteria 9366
246 nmdc:mga08y16_144645_c1 3300050511 Unclassified 2471
247 nmdc:mga08y16_15198_c1 3300050511 Bacteria 8096
248 nmdc:mga08y16_178_c1 3300050511 Bacteria 56109
249 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
250 nmdc:mga08y16_252445_c1 3300050511 Bacteria 1822
251 nmdc:mga0n895_76202_c1 3300050512 Bacteria 3335
252 nmdc:mga0rr50_196406_c1 3300050513 Bacteria 1656
253 nmdc:mga0a205_153082_c1 3300050515 Bacteria 2205
254 Ga0500568_0004770 3300053139 Bacteria 7176
255 Ga0501084_0149438 3300054114 Bacteria 1968
256 Ga0501084_0191739 3300054114 Bacteria 1724
257 Ga0590071_000682 3300059421 Bacteria 9636
258 Ga0590075_001216 3300059424 Bacteria 6519
259 Ga0590077_000371 3300059426 Bacteria 12609
260 Ga0501082_0000023 3300060353 Bacteria 104756
261 Ga0501082_0129943 3300060353 Bacteria 2185
262 Ga0501082_0414331 3300060353 Bacteria 1176
263 Ga0501082_0768428 3300060353 Bacteria 843
264 Ga0530510_0316487 3300061734 Bacteria 1169
265 Ga0530510_0792934 3300061734 Bacteria 723
266 Ga0105243_10703276
267 JGI24033J26618_1016785
268 Ga0065704_10198858
269 Ga0065712_10005366
270 Ga0065715_10109269
271 Ga0065715_10146310
272 Ga0065707_10107605
273 Ga0070676_10205959
274 Ga0070683_100008430
275 Ga0070670_100017469
276 Ga0070670_100064651
277 Ga0070677_10033580
278 Ga0070677_10114018
279 Ga0070689_100208133
280 Ga0070668_100194724
281 Ga0070669_100003212
282 Ga0070669_100027871
283 Ga0070669_100071280
284 Ga0070669_100667483
285 Ga0070669_100726956
286 Ga0070675_100045268
287 Ga0070675_100077604
288 Ga0070675_100623114
289 Ga0070671_100016982
290 Ga0070674_100006397
291 Ga0070674_100034623
292 Ga0070674_100070644
293 Ga0070674_100712567
294 Ga0070673_100018748
295 Ga0070673_100020489
296 Ga0070673_100063465
297 Ga0070688_100224601
298 Ga0070688_100327909
299 Ga0070667_100278612
300 Ga0070667_100446816
301 Ga0070694_100062450
302 Ga0070678_100110585
303 Ga0070678_100300478
304 Ga0070678_100320056
305 Ga0070678_100394849
306 Ga0070678_100461986
307 Ga0070662_100039194
308 Ga0070662_100134796
309 Ga0068867_100373967
310 Ga0068867_100434465
311 Ga0070672_100050808
312 Ga0070672_100098401
313 Ga0070695_100000355
314 Ga0070695_100087009
315 Ga0070664_100108662
316 Ga0070664_100342002
317 Ga0068857_100034415
318 Ga0068857_100384794
319 Ga0070702_100470610
320 Ga0068859_100028052
321 Ga0068859_100047135
322 Ga0068859_100487385
323 Ga0068864_100082748
324 Ga0068866_10184206
325 Ga0068861_100368543
326 Ga0068861_100426637
327 Ga0068870_10005934
328 Ga0068863_100260418
329 Ga0068858_100561859
330 Ga0068862_100002473
331 Ga0068862_100020661
332 Ga0075367_10022770
333 Ga0075366_10016146
334 Ga0075431_100010427
335 Ga0075431_100168598
336 Ga0075431_100187104
337 Ga0075431_100223038
338 Ga0075429_100085313
339 Ga0075429_100085751
340 Ga0068865_100088557
341 Ga0097620_100028052
342 Ga0097620_100047134
343 Ga0097620_100487482
344 Ga0111539_10000435
345 Ga0111539_10001064
346 Ga0111539_10201338
347 Ga0111539_10427151
348 Ga0114129_10057980
349 Ga0105249_10007016
350 Ga0105249_10238200
351 Ga0105249_10282940
352 Ga0105249_10381455
353 Ga0157378_11345660
354 Ga0157375_10016930
355 Ga0157375_10182421
356 Ga0163163_10031346
357 Ga0163163_10191019
358 Ga0163163_10645951
359 Ga0157380_10011630
360 Ga0157380_10060488
361 Ga0157380_10190144
362 Ga0157380_11008330
363 Ga0157377_10142897
364 Ga0157377_10396055
365 Ga0207666_1005468
366 Ga0207682_10009941
367 Ga0207682_10116280
368 Ga0207688_10160534
369 Ga0207688_10218638
370 Ga0207680_10397955
371 Ga0207645_10113008
372 Ga0207643_10009688
373 Ga0207643_10074532
374 Ga0207657_10239240
375 Ga0207681_10017910
376 Ga0207681_10068473
377 Ga0207681_10156745
378 Ga0207681_10331201
379 Ga0207650_10013778
380 Ga0207650_10035260
381 Ga0207650_10102848
382 Ga0207650_10287877
383 Ga0207659_10001139
384 Ga0207659_10018516
385 Ga0207659_10050147
386 Ga0207659_10099062
387 Ga0207659_10185115
388 Ga0207644_10140000
389 Ga0207706_10274619
390 Ga0207670_10306265
391 Ga0207669_10039753
392 Ga0207669_10136407
393 Ga0207669_10367451
394 Ga0207669_10396209
395 Ga0207704_10114172
396 Ga0207691_10008839
397 Ga0207691_10042046
398 Ga0207691_10126262
399 Ga0207661_10021226
400 Ga0207679_10138562
401 Ga0207651_10122435
402 Ga0207651_10572446
403 Ga0207712_10210226
404 Ga0207658_10390032
405 Ga0207708_10053705
406 Ga0207708_10454313
407 Ga0207708_10731755
408 Ga0207641_11097040
409 Ga0207676_10059092
410 Ga0207674_10043970
411 Ga0207674_10628936
412 Ga0207675_100021085
413 Ga0207675_100419427
414 Ga0207675_100467775
415 Ga0207683_10065980
416 Ga0207683_10120393
417 Ga0207683_10257742
418 Ga0207683_10383908
419 Ga0207683_10532810
420 Ga0209971_1011615
421 Ga0209813_10142983
422 Ga0209974_10048087
423 Ga0207428_10000298
424 Ga0207428_10009357
425 Ga0307408_100083101
426 Ga0307408_100278414
427 Ga0307410_10015475
428 Ga0307406_10225863
429 Ga0307406_10509399
430 Ga0307412_10201334
431 Ga0307409_100006003
432 Ga0307409_100153665
433 Ga0307409_100245314
434 Ga0307416_100247021
435 Ga0307416_100457144
436 Ga0307414_10852699
437 Ga0307411_10171621
438 Ga0307411_10238704
439 Ga0307411_10253498
440 Ga0451800_0561753
441 Ga0451807_0782074
442 Ga0451807_2256874
443 Ga0451849_1321590
444 Ga0451853_0191802
445 Ga0439433_0002757
446 Ga0439433_0057806
447 Ga0439449_0045029
448 Ga0439462_0079058
449 Ga0450894_004410
450 Ga0450896_000360
451 Ga0439446_0001935
452 Ga0439435_0007520
453 Ga0439435_0133323
454 Ga0450918_001999
455 Ga0439440_0115994
456 Ga0453684_0133982
457 Ga0495672_0116417
458 Ga0501291_032967
459 Ga0501031_0214886
460 Ga0501031_0282325
461 Ga0501036_0132060
462 Ga0501038_0187521
463 Ga0501039_0161309
464 Ga0501039_0320527
465 Ga0501042_0110373
466 Ga0501042_0210387
467 Ga0501046_0398172
468 Ga0501047_0133698
469 Ga0501048_0152972
470 Ga0501048_0559892
471 Ga0501067_0098846
472 Ga0501067_0184699
473 Ga0501068_0139344
474 Ga0501071_0163381
475 Ga0501071_0230653
476 Ga0501071_0406360
477 Ga0501072_0065590
478 Ga0501072_0167212
479 Ga0501073_0384429
480 Ga0501074_0059634
481 Ga0501075_0232831
482 Ga0501076_0829989
483 Ga0501077_0044532
484 Ga0501077_0125943
485 Ga0501077_0333664
486 Ga0501077_0433124
487 Ga0501209_040757
488 Ga0501079_0321820
489 Ga0501080_0093129
490 Ga0501080_0149755
491 Ga0501080_0360078
492 Ga0501280_008489
493 Ga0501283_005785
494 Ga0501045_0185350
495 Ga0501045_0196988
496 Ga0501045_0316106
497 nmdc:mga03683_239077_c1
498 nmdc:mga0k408_24267_c1
499 nmdc:mga06z11_272133_c1
500 nmdc:mga04h51_157910_c1
501 nmdc:mga05p37_107808_c1
502 nmdc:mga09592_133155_c1
503 nmdc:mga09592_31753_c1
504 nmdc:mga0qj67_1854_c1
505 nmdc:mga0qj67_357666_c1
506 nmdc:mga0qj67_6114_c1
507 nmdc:mga06r32_258862_c1
508 nmdc:mga06r32_413825_c1
509 nmdc:mga06r32_4698_c1
510 nmdc:mga06r32_8269_c1
511 nmdc:mga08y16_144645_c1
512 nmdc:mga08y16_15198_c1
513 nmdc:mga08y16_178_c1
514 nmdc:mga08y16_195_c1
515 nmdc:mga08y16_252445_c1
516 nmdc:mga0n895_76202_c1
517 nmdc:mga0rr50_196406_c1
518 nmdc:mga0a205_153082_c1
519 Ga0500568_0004770
520 Ga0501084_0149438
521 Ga0501084_0191739
522 Ga0590071_000682
523 Ga0590075_001216
524 Ga0590077_000371
525 Ga0501082_0000023
526 Ga0501082_0129943
527 Ga0501082_0414331
528 Ga0501082_0768428
529 Ga0530510_0316487
530 Ga0530510_0792934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03458

Gly_transporter

Glycine transporter

42

117

0.96

PF03458

Gly_transporter

Glycine transporter

127

201

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.9087 14 204
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.8913 14 204
5wtr-assembly2.cif.gz_F crystal structure of a prokaryotic tric channel in 0.5 m kcl 0.8863 12 206
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.881 16 207
5wtr-assembly2.cif.gz_F crystal structure of a prokaryotic tric channel in 0.5 m kcl 0.8738 12 206
ID Description Score Start End Superfamily
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8991 17 89 1.10.10.1740
af_P0AFP0_91_166_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8821 19 89 1.10.10.1740
af_P0AGM2_90_165_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.855 19 89 1.10.10.1740
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8459 17 89 1.10.10.1740
af_P0AGM2_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8395 16 91 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A2S6QZ66-F1-model_v4 Glycine transporter domain-containing protein 0.9389 14 207 GO:0005886
AF-A0A2A4LVH5-F1-model_v4 Glycine transporter domain-containing protein 0.9331 9 210 GO:0005886
AF-A0A251WVW1-F1-model_v4 Glycine transporter domain-containing protein 0.9273 15 210 GO:0005886
AF-V7ELQ8-F1-model_v4 Membrane protein 0.9268 8 210 GO:0005886
AF-A0A848Z4X3-F1-model_v4 Trimeric intracellular cation channel family protein 0.9243 15 125 GO:0005886

Map