F372934

General Info

Members Datasets Scaffolds Average Seq Length
264 192 258 136

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_000799|Ga0500572_000799_6198_6695
Length 165
Sequence MAEWRGGVSHAAGIDQARHCRLERAENVMTKAHWLVKSEPNTYAYADLERDGRTVWDGVRNNAAALHLKAMREGDEVLFYHSQEGLAVVGVAKVVRTAFPDASDPAGRFVAVELAPVRALKRPVTLAQMKAEPALVEMAMLRQGRLSVSPVTDGQWATILRMAGE

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
4 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
5 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
175 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
176 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
179 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
180 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
181 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
184 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
185 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
186 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
189 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
190 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 0.76
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 0
Rhizoplane 1.89
Rhizosphere 79.92
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10368175 3300005295 Bacteria 894
2 Ga0070658_10000001 3300005327 Bacteria 856789
3 Ga0070658_10578697 3300005327 Bacteria 972
4 Ga0068869_100276077 3300005334 Bacteria 1350
5 Ga0068869_100404566 3300005334 Bacteria 1123
6 Ga0070666_10924086 3300005335 Bacteria 645
7 Ga0070680_100003500 3300005336 Bacteria 11714
8 Ga0070680_100011802 3300005336 Bacteria 6777
9 Ga0070680_101163676 3300005336 Bacteria 667
10 Ga0068868_100033582 3300005338 Bacteria 3955
11 Ga0070660_100000362 3300005339 Bacteria 30297
12 Ga0070660_100325089 3300005339 Unclassified 1264
13 Ga0070660_100952982 3300005339 Bacteria 724
14 Ga0070691_10484627 3300005341 Bacteria 712
15 Ga0070661_100125892 3300005344 Bacteria 1922
16 Ga0070661_100806627 3300005344 Bacteria 770
17 Ga0070692_10002035 3300005345 Bacteria 7685
18 Ga0070692_10202853 3300005345 Bacteria 1162
19 Ga0070668_100419365 3300005347 Bacteria 1146
20 Ga0070669_100920027 3300005353 Bacteria 748
21 Ga0070671_100158763 3300005355 Bacteria 1911
22 Ga0070659_100008628 3300005366 Bacteria 7454
23 Ga0070667_100012240 3300005367 Bacteria 7097
24 Ga0070667_101749426 3300005367 Bacteria 585
25 Ga0070714_100235732 3300005435 Bacteria 1687
26 Ga0070662_100051382 3300005457 Bacteria 2976
27 Ga0070681_10082562 3300005458 Bacteria 3169
28 Ga0070681_10418018 3300005458 Bacteria 1253
29 Ga0070679_100014354 3300005530 Bacteria 7608
30 Ga0070679_100061779 3300005530 Bacteria 3734
31 Ga0070684_102278013 3300005535 Bacteria 511
32 Ga0068853_100091720 3300005539 Bacteria 2672
33 Ga0068853_101557808 3300005539 Unclassified 640
34 Ga0070693_100005623 3300005547 Bacteria 6044
35 Ga0070665_100615341 3300005548 Bacteria 1099
36 Ga0068855_100008020 3300005563 Bacteria 12754
37 Ga0068855_100026945 3300005563 Bacteria 6877
38 Ga0068855_100074480 3300005563 Bacteria 3943
39 Ga0068855_100349207 3300005563 Bacteria 1630
40 Ga0068855_102235350 3300005563 Bacteria 548
41 Ga0070664_100179061 3300005564 Bacteria 1883
42 Ga0068857_100180434 3300005577 Bacteria 1921
43 Ga0068854_100090343 3300005578 Bacteria 2277
44 Ga0068854_100640562 3300005578 Bacteria 911
45 Ga0068854_101358750 3300005578 Unclassified 641
46 Ga0068856_100545372 3300005614 Bacteria 1181
47 Ga0068856_101087646 3300005614 Bacteria 817
48 Ga0068852_100113360 3300005616 Bacteria 2469
49 Ga0068852_102380292 3300005616 Archaea 550
50 Ga0068852_102827402 3300005616 Bacteria 503
51 Ga0068859_100091149 3300005617 Bacteria 3099
52 Ga0068864_100758291 3300005618 Bacteria 951
53 Ga0068861_101303711 3300005719 Bacteria 706
54 Ga0068863_100005315 3300005841 Bacteria 12711
55 Ga0068860_100077315 3300005843 Bacteria 3165
56 Ga0068860_100150936 3300005843 Bacteria 2237
57 Ga0068862_100003311 3300005844 Bacteria 13934
58 Ga0068862_101012702 3300005844 Bacteria 822
59 Ga0068862_101793660 3300005844 Bacteria 623
60 Ga0070717_10155538 3300006028 Bacteria 1980
61 Ga0075364_10021290 3300006051 Bacteria 4085
62 Ga0097621_100395015 3300006237 Bacteria 1237
63 Ga0075370_10108314 3300006353 Bacteria 1612
64 Ga0068871_100540579 3300006358 Bacteria 1054
65 Ga0068871_100659490 3300006358 Bacteria 956
66 Ga0075428_100125674 3300006844 Bacteria 2791
67 Ga0075433_10894101 3300006852 Unclassified 775
68 Ga0068865_101298138 3300006881 Bacteria 647
69 Ga0097620_100091148 3300006931 Bacteria 3099
70 Ga0105240_10017650 3300009093 Bacteria 9609
71 Ga0105240_10064736 3300009093 Bacteria 4541
72 Ga0105240_10094922 3300009093 Bacteria 3637
73 Ga0105240_10285864 3300009093 Bacteria 1893
74 Ga0105240_10333147 3300009093 Bacteria 1726
75 Ga0105245_12969336 3300009098 Bacteria 526
76 Ga0105247_10531659 3300009101 Bacteria 862
77 Ga0114129_10618434 3300009147 Unclassified 1401
78 Ga0114129_11607282 3300009147 Bacteria 796
79 Ga0105241_10517191 3300009174 Bacteria 1067
80 Ga0105241_11434560 3300009174 Bacteria 662
81 Ga0105241_12099175 3300009174 Bacteria 558
82 Ga0105242_10244272 3300009176 Bacteria 1615
83 Ga0105242_10636719 3300009176 Bacteria 1035
84 Ga0105248_10005071 3300009177 Bacteria 14536
85 Ga0105248_10008346 3300009177 Bacteria 11377
86 Ga0105248_10046769 3300009177 Bacteria 4852
87 Ga0105237_10899964 3300009545 Unclassified 892
88 Ga0105238_10598988 3300009551 Bacteria 1110
89 Ga0105238_10629068 3300009551 Bacteria 1082
90 Ga0105249_11175508 3300009553 Bacteria 838
91 Ga0105033_110124 3300009986 Bacteria 829
92 Ga0105239_10015099 3300010375 Bacteria 8562
93 Ga0105239_10109810 3300010375 Bacteria 3057
94 Ga0157326_1004632 3300012513 Bacteria 1448
95 Ga0157373_10039992 3300013100 Bacteria 3355
96 Ga0157373_10459352 3300013100 Bacteria 917
97 Ga0157371_11438056 3300013102 Unclassified 536
98 Ga0157370_10399942 3300013104 Bacteria 1264
99 Ga0157372_11372754 3300013307 Bacteria 815
100 Ga0157379_11845610 3300014968 Bacteria 595
101 Ga0157376_11557664 3300014969 Unclassified 695
102 Ga0206354_10464580 3300020081 Bacteria 2121
103 Ga0206353_10189764 3300020082 Bacteria 11010
104 Ga0213875_10142842 3300021388 Unclassified 1121
105 Ga0207705_10000002 3300025909 Bacteria 2046852
106 Ga0207654_11006174 3300025911 Bacteria 606
107 Ga0207707_10145772 3300025912 Bacteria 2070
108 Ga0207695_10020952 3300025913 Bacteria 7470
109 Ga0207695_10024973 3300025913 Bacteria 6705
110 Ga0207695_10125720 3300025913 Bacteria 2526
111 Ga0207695_10447050 3300025913 Bacteria 1176
112 Ga0207660_10108229 3300025917 Bacteria 2087
113 Ga0207660_10119851 3300025917 Bacteria 1991
114 Ga0207660_11690346 3300025917 Bacteria 509
115 Ga0207657_10000084 3300025919 Bacteria 89401
116 Ga0207657_10031150 3300025919 Bacteria 4834
117 Ga0207657_10183923 3300025919 Bacteria 1688
118 Ga0207649_10230165 3300025920 Bacteria 1325
119 Ga0207649_10478245 3300025920 Unclassified 944
120 Ga0207652_10154307 3300025921 Bacteria 2057
121 Ga0207652_10310192 3300025921 Bacteria 1424
122 Ga0207681_10336380 3300025923 Bacteria 1205
123 Ga0207644_10166201 3300025931 Bacteria 1719
124 Ga0207690_10005489 3300025932 Bacteria 7479
125 Ga0207706_10446635 3300025933 Bacteria 1119
126 Ga0207686_10181466 3300025934 Bacteria 1493
127 Ga0207686_10631292 3300025934 Bacteria 846
128 Ga0207711_10005004 3300025941 Bacteria 11240
129 Ga0207711_10043562 3300025941 Bacteria 3829
130 Ga0207711_10067901 3300025941 Bacteria 3087
131 Ga0207689_10156521 3300025942 Bacteria 1878
132 Ga0207667_10000429 3300025949 Bacteria 56506
133 Ga0207667_10033255 3300025949 Bacteria 5546
134 Ga0207667_10175153 3300025949 Bacteria 2204
135 Ga0207667_10303915 3300025949 Bacteria 1630
136 Ga0207668_10051492 3300025972 Bacteria 2844
137 Ga0207640_10292208 3300025981 Bacteria 1285
138 Ga0207640_10891865 3300025981 Bacteria 776
139 Ga0207658_11303955 3300025986 Bacteria 664
140 Ga0207677_11907816 3300026023 Bacteria 552
141 Ga0207678_10588824 3300026067 Bacteria 975
142 Ga0207678_11574040 3300026067 Bacteria 579
143 Ga0207702_10145260 3300026078 Bacteria 2152
144 Ga0207641_10008657 3300026088 Bacteria 8403
145 Ga0207674_10029882 3300026116 Bacteria 5734
146 Ga0207674_10547919 3300026116 Bacteria 1117
147 Ga0207674_10953048 3300026116 Bacteria 827
148 Ga0207675_101562341 3300026118 Bacteria 680
149 Ga0207698_10187212 3300026142 Bacteria 1840
150 Ga0209981_1000142 3300027378 Bacteria 8601
151 Ga0210000_1006148 3300027462 Bacteria 1747
152 Ga0209999_1015477 3300027543 Bacteria 1388
153 Ga0268266_11895261 3300028379 Bacteria 570
154 Ga0268264_10058269 3300028381 Bacteria 3234
155 Ga0307517_10003229 3300028786 Bacteria 25559
156 Ga0265338_10398410 3300028800 Bacteria 982
157 Ga0265328_10009865 3300031239 Bacteria 3864
158 Ga0265331_10000439 3300031250 Bacteria 40937
159 Ga0307513_10018717 3300031456 Bacteria 8270
160 Ga0307408_100273608 3300031548 Bacteria 1403
161 Ga0307508_10063473 3300031616 Bacteria 3259
162 Ga0307405_10189282 3300031731 Bacteria 1485
163 Ga0307406_10821868 3300031901 Bacteria 786
164 Ga0307414_10228550 3300032004 Bacteria 1532
165 Ga0373926_0220511 3300035083 Bacteria 732
166 Ga0373944_0007138 3300035089 Bacteria 2987
167 Ga0373946_0103935 3300035171 Bacteria 1277
168 Ga0373927_0000615 3300035695 Bacteria 27027
169 Ga0373925_0000278 3300037068 Bacteria 53402
170 Ga0395899_0155131 3300037312 Bacteria 1620
171 Ga0395899_0156744 3300037312 Bacteria 1611
172 Ga0395899_0238456 3300037312 Unclassified 1252
173 Ga0395900_0006010 3300037418 Bacteria 12663
174 Ga0395900_0176098 3300037418 Bacteria 2175
175 Ga0395900_0202279 3300037418 Bacteria 2009
176 Ga0395900_0665913 3300037418 Bacteria 976
177 Ga0395898_0092761 3300037466 Bacteria 2903
178 Ga0395905_0438401 3300037471 Bacteria 1203
179 Ga0436364_1261832 3300037853 Unclassified 1595
180 Ga0395901_0000440 3300038443 Bacteria 48641
181 Ga0395901_0068235 3300038443 Bacteria 3704
182 Ga0395901_1149376 3300038443 Unclassified 744
183 Ga0395901_1467982 3300038443 Unclassified 639
184 Ga0436365_0010969 3300039437 Bacteria 175809
185 Ga0436365_1416132 3300039437 Bacteria 1839
186 Ga0451804_0796472 3300041463 Bacteria 549
187 Ga0451855_1186690 3300041511 Bacteria 732
188 Ga0466969_0141190 3300044656 Bacteria 1113
189 Ga0466966_0039580 3300044684 Bacteria 3036
190 Ga0495629_0014588 3300046459 Bacteria 5655
191 Ga0495620_0041169 3300046515 Bacteria 2028
192 Ga0495643_0041390 3300046522 Bacteria 2511
193 Ga0495609_0094171 3300046538 Bacteria 1301
194 Ga0495597_0001177 3300046542 Bacteria 19615
195 Ga0495645_0614691 3300046543 Bacteria 667
196 Ga0495668_0055811 3300046616 Bacteria 2181
197 Ga0495625_0143754 3300046660 Bacteria 1608
198 Ga0495669_0128162 3300046684 Bacteria 1193
199 Ga0495624_0172385 3300046690 Bacteria 1320
200 Ga0496102_0199050 3300048905 Bacteria 1888
201 Ga0496103_0069491 3300048906 Bacteria 2202
202 Ga0496109_1292249 3300048912 Bacteria 666
203 Ga0496115_0001327 3300048918 Bacteria 17646
204 Ga0496118_0006262 3300048921 Bacteria 13158
205 Ga0496119_0053497 3300048922 Bacteria 2465
206 Ga0496121_0000042 3300048924 Bacteria 342304
207 Ga0496125_0009356 3300048928 Bacteria 10094
208 Ga0501032_0044384 3300049569 Bacteria 3009
209 Ga0501032_0083033 3300049569 Bacteria 2131
210 Ga0501033_0178742 3300049570 Bacteria 1522
211 Ga0501034_0076131 3300049571 Bacteria 3363
212 Ga0501043_0002355 3300049579 Bacteria 16021
213 Ga0501047_0000370 3300049581 Bacteria 50827
214 Ga0501047_0002303 3300049581 Bacteria 18248
215 Ga0501072_0143210 3300049588 Bacteria 1906
216 Ga0501073_1194790 3300049589 Bacteria 522
217 Ga0501077_0105822 3300049593 Bacteria 1783
218 Ga0501227_014716 3300049665 Bacteria 1740
219 Ga0501249_000847 3300049679 Bacteria 6783
220 Ga0501080_0006093 3300049742 Bacteria 10810
221 Ga0501083_0016282 3300049744 Bacteria 5206
222 Ga0501267_003546 3300049764 Bacteria 1425
223 Ga0501035_0023472 3300049822 Bacteria 5658
224 Ga0501035_0705030 3300049822 Bacteria 814
225 nmdc:mga00v17_16666_c1 3300050491 Bacteria 4144
226 nmdc:mga07m45_91761_c1 3300050496 Bacteria 1740
227 nmdc:mga05p37_1461067_c1 3300050507 Bacteria 684
228 nmdc:mga05p37_692976_c1 3300050507 Bacteria 1133
229 nmdc:mga06r32_1524371_c1 3300050510 Bacteria 608
230 nmdc:mga0n895_7912_c1 3300050512 Bacteria 9163
231 nmdc:mga0a205_330811_c1 3300050515 Unclassified 1393
232 Ga0500635_0000123 3300053080 Bacteria 45690
233 Ga0500643_009477 3300053087 Bacteria 3718
234 Ga0500643_011037 3300053087 Bacteria 3321
235 Ga0500647_0015266 3300053091 Bacteria 3509
236 Ga0500583_0123853 3300053092 Bacteria 1280
237 Ga0500651_0231159 3300053093 Bacteria 1081
238 Ga0500566_0291435 3300053094 Bacteria 772
239 Ga0500641_0004505 3300053096 Bacteria 4923
240 Ga0500555_137562 3300053103 Bacteria 603
241 Ga0500562_007391 3300053108 Bacteria 2770
242 Ga0500569_003023 3300053109 Bacteria 3383
243 Ga0500572_000799 3300053111 Bacteria 10057
244 Ga0500572_176281 3300053111 Bacteria 700
245 Ga0500597_410690 3300053120 Bacteria 512
246 Ga0500608_000757 3300053122 Bacteria 11764
247 Ga0500614_006647 3300053123 Bacteria 2430
248 Ga0500642_0033749 3300053130 Bacteria 2159
249 Ga0500559_0007236 3300053136 Bacteria 4933
250 Ga0500590_038186 3300053148 Bacteria 2479
251 Ga0500619_237145 3300053154 Bacteria 604
252 Ga0500638_025647 3300053162 Bacteria 2819
253 Ga0500639_247248 3300053163 Bacteria 718
254 Ga0500637_0498805 3300053178 Bacteria 604
255 Ga0500576_034713 3300053725 Bacteria 2285
256 Ga0500625_004305 3300053729 Bacteria 5794
257 Ga0500596_000860 3300053735 Bacteria 6025
258 Ga0501082_0010058 3300060353 Bacteria 8152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0141190 Ga0466969_0141190_128_520 128
2 3300005339 Ga0070660_100000362 Ga0070660_10000036222 131
3 3300025919 Ga0207657_10000084 Ga0207657_1000008415 131
4 3300009093 Ga0105240_10094922 Ga0105240_100949224 132
5 3300025913 Ga0207695_10024973 Ga0207695_100249739 132
6 3300037312 Ga0395899_0155131 Ga0395899_0155131_980_1378 132
7 3300037418 Ga0395900_0665913 Ga0395900_0665913_243_641 132
8 3300037466 Ga0395898_0092761 Ga0395898_0092761_1805_2203 132
9 3300037471 Ga0395905_0438401 Ga0395905_0438401_105_503 132
10 3300038443 Ga0395901_0068235 Ga0395901_0068235_1049_1447 132
11 3300005327 Ga0070658_10000001 Ga0070658_1000000184 133
12 3300005327 Ga0070658_10578697 Ga0070658_105786972 133
13 3300005336 Ga0070680_100003500 Ga0070680_10000350013 133
14 3300005336 Ga0070680_100011802 Ga0070680_1000118022 133
15 3300005339 Ga0070660_100325089 Ga0070660_1003250892 133
16 3300005339 Ga0070660_100952982 Ga0070660_1009529822 133
17 3300005345 Ga0070692_10002035 Ga0070692_100020358 133
18 3300005345 Ga0070692_10202853 Ga0070692_102028531 133
19 3300005347 Ga0070668_100419365 Ga0070668_1004193651 133
20 3300005366 Ga0070659_100008628 Ga0070659_1000086281 133
21 3300005367 Ga0070667_100012240 Ga0070667_1000122404 133
22 3300005435 Ga0070714_100235732 Ga0070714_1002357322 133
23 3300005530 Ga0070679_100061779 Ga0070679_1000617794 133
24 3300005547 Ga0070693_100005623 Ga0070693_1000056232 133
25 3300005563 Ga0068855_100074480 Ga0068855_1000744805 133
26 3300005563 Ga0068855_102235350 Ga0068855_1022353501 133
27 3300005578 Ga0068854_100090343 Ga0068854_1000903432 133
28 3300005578 Ga0068854_100640562 Ga0068854_1006405622 133
29 3300005616 Ga0068852_102827402 Ga0068852_1028274021 133
30 3300009093 Ga0105240_10333147 Ga0105240_103331472 133
31 3300009545 Ga0105237_10899964 Ga0105237_108999641 133
32 3300013100 Ga0157373_10039992 Ga0157373_100399924 133
33 3300013104 Ga0157370_10399942 Ga0157370_103999422 133
34 3300020081 Ga0206354_10464580 Ga0206354_104645802 133
35 3300020082 Ga0206353_10189764 Ga0206353_101897646 133
36 3300025909 Ga0207705_10000002 Ga0207705_100000021795 133
37 3300025913 Ga0207695_10447050 Ga0207695_104470502 133
38 3300025917 Ga0207660_10108229 Ga0207660_101082292 133
39 3300025917 Ga0207660_10119851 Ga0207660_101198513 133
40 3300025919 Ga0207657_10031150 Ga0207657_100311507 133
41 3300025920 Ga0207649_10478245 Ga0207649_104782451 133
42 3300025921 Ga0207652_10154307 Ga0207652_101543073 133
43 3300025932 Ga0207690_10005489 Ga0207690_100054898 133
44 3300025949 Ga0207667_10175153 Ga0207667_101751531 133
45 3300025981 Ga0207640_10292208 Ga0207640_102922081 133
46 3300026078 Ga0207702_10145260 Ga0207702_101452603 133
47 3300031901 Ga0307406_10821868 Ga0307406_108218681 133
48 3300037312 Ga0395899_0156744 Ga0395899_0156744_1184_1588 133
49 3300037312 Ga0395899_0238456 Ga0395899_0238456_619_1020 133
50 3300037418 Ga0395900_0006010 Ga0395900_0006010_8109_8513 133
51 3300037418 Ga0395900_0176098 Ga0395900_0176098_109_510 133
52 3300038443 Ga0395901_0000440 Ga0395901_0000440_26877_27281 133
53 3300038443 Ga0395901_1149376 Ga0395901_1149376_322_723 133
54 3300041511 Ga0451855_1186690 Ga0451855_1186690_24_428 133
55 3300044684 Ga0466966_0039580 Ga0466966_0039580_2392_2799 133
56 3300049764 Ga0501267_003546 Ga0501267_003546_551_955 133
57 iso_pu_bacteria 2643221541 2643728982 133
58 iso_pu_bacteria 2643221605 2644038230 133
59 iso_pu_bacteria 2643221606 2644044997 133
60 iso_pu_bacteria 2643221671 2644391170 133
61 3300005335 Ga0070666_10924086 Ga0070666_109240861 134
62 3300005338 Ga0068868_100033582 Ga0068868_1000335823 134
63 3300005344 Ga0070661_100806627 Ga0070661_1008066271 134
64 3300005457 Ga0070662_100051382 Ga0070662_1000513823 134
65 3300005458 Ga0070681_10082562 Ga0070681_100825624 134
66 3300005530 Ga0070679_100014354 Ga0070679_1000143549 134
67 3300005563 Ga0068855_100026945 Ga0068855_10002694510 134
68 3300005564 Ga0070664_100179061 Ga0070664_1001790613 134
69 3300005577 Ga0068857_100180434 Ga0068857_1001804342 134
70 3300005614 Ga0068856_100545372 Ga0068856_1005453721 134
71 3300006358 Ga0068871_100659490 Ga0068871_1006594901 134
72 3300021388 Ga0213875_10142842 Ga0213875_101428422 134
73 3300025921 Ga0207652_10310192 Ga0207652_103101921 134
74 3300025949 Ga0207667_10033255 Ga0207667_100332559 134
75 3300025981 Ga0207640_10891865 Ga0207640_108918651 134
76 3300025986 Ga0207658_11303955 Ga0207658_113039551 134
77 3300037418 Ga0395900_0202279 Ga0395900_0202279_621_1034 134
78 3300037853 Ga0436364_1261832 Ga0436364_1261832_922_1329 134
79 3300038443 Ga0395901_1467982 Ga0395901_1467982_53_466 134
80 iso_pu_bacteria 2929199973 2929200398 134
81 iso_pu_bacteria 8055909800 8055912424 134
82 3300005334 Ga0068869_100276077 Ga0068869_1002760772 135
83 3300005336 Ga0070680_101163676 Ga0070680_1011636762 135
84 3300005341 Ga0070691_10484627 Ga0070691_104846271 135
85 3300005344 Ga0070661_100125892 Ga0070661_1001258922 135
86 3300005367 Ga0070667_101749426 Ga0070667_1017494261 135
87 3300005458 Ga0070681_10418018 Ga0070681_104180183 135
88 3300005535 Ga0070684_102278013 Ga0070684_1022780131 135
89 3300005539 Ga0068853_100091720 Ga0068853_1000917204 135
90 3300005563 Ga0068855_100008020 Ga0068855_1000080205 135
91 3300005563 Ga0068855_100349207 Ga0068855_1003492072 135
92 3300005614 Ga0068856_101087646 Ga0068856_1010876462 135
93 3300005616 Ga0068852_100113360 Ga0068852_1001133603 135
94 3300005617 Ga0068859_100091149 Ga0068859_1000911493 135
95 3300005618 Ga0068864_100758291 Ga0068864_1007582912 135
96 3300005843 Ga0068860_100077315 Ga0068860_1000773153 135
97 3300005843 Ga0068860_100150936 Ga0068860_1001509362 135
98 3300005844 Ga0068862_100003311 Ga0068862_10000331115 135
99 3300005844 Ga0068862_101012702 Ga0068862_1010127022 135
100 3300005844 Ga0068862_101793660 Ga0068862_1017936601 135
101 3300006028 Ga0070717_10155538 Ga0070717_101555382 135
102 3300006237 Ga0097621_100395015 Ga0097621_1003950152 135
103 3300006358 Ga0068871_100540579 Ga0068871_1005405792 135
104 3300006844 Ga0075428_100125674 Ga0075428_1001256743 135
105 3300006852 Ga0075433_10894101 Ga0075433_108941012 135
106 3300006881 Ga0068865_101298138 Ga0068865_1012981381 135
107 3300006931 Ga0097620_100091148 Ga0097620_1000911483 135
108 3300009093 Ga0105240_10017650 Ga0105240_1001765013 135
109 3300009093 Ga0105240_10064736 Ga0105240_100647364 135
110 3300009098 Ga0105245_12969336 Ga0105245_129693361 135
111 3300009101 Ga0105247_10531659 Ga0105247_105316592 135
112 3300009147 Ga0114129_10618434 Ga0114129_106184342 135
113 3300009147 Ga0114129_11607282 Ga0114129_116072822 135
114 3300009174 Ga0105241_10517191 Ga0105241_105171911 135
115 3300009174 Ga0105241_11434560 Ga0105241_114345602 135
116 3300009174 Ga0105241_12099175 Ga0105241_120991751 135
117 3300009176 Ga0105242_10244272 Ga0105242_102442722 135
118 3300009176 Ga0105242_10636719 Ga0105242_106367192 135
119 3300009177 Ga0105248_10005071 Ga0105248_100050715 135
120 3300009177 Ga0105248_10046769 Ga0105248_100467695 135
121 3300009551 Ga0105238_10598988 Ga0105238_105989882 135
122 3300009551 Ga0105238_10629068 Ga0105238_106290681 135
123 3300009553 Ga0105249_11175508 Ga0105249_111755082 135
124 3300009986 Ga0105033_110124 Ga0105033_1101242 135
125 3300010375 Ga0105239_10109810 Ga0105239_101098103 135
126 3300013100 Ga0157373_10459352 Ga0157373_104593521 135
127 3300013102 Ga0157371_11438056 Ga0157371_114380561 135
128 3300013307 Ga0157372_11372754 Ga0157372_113727542 135
129 3300014968 Ga0157379_11845610 Ga0157379_118456101 135
130 3300014969 Ga0157376_11557664 Ga0157376_115576642 135
131 3300025911 Ga0207654_11006174 Ga0207654_110061742 135
132 3300025912 Ga0207707_10145772 Ga0207707_101457723 135
133 3300025913 Ga0207695_10020952 Ga0207695_100209527 135
134 3300025913 Ga0207695_10125720 Ga0207695_101257202 135
135 3300025917 Ga0207660_11690346 Ga0207660_116903461 135
136 3300025919 Ga0207657_10183923 Ga0207657_101839232 135
137 3300025920 Ga0207649_10230165 Ga0207649_102301652 135
138 3300025933 Ga0207706_10446635 Ga0207706_104466352 135
139 3300025934 Ga0207686_10181466 Ga0207686_101814662 135
140 3300025934 Ga0207686_10631292 Ga0207686_106312922 135
141 3300025941 Ga0207711_10005004 Ga0207711_100050045 135
142 3300025941 Ga0207711_10043562 Ga0207711_100435622 135
143 3300025942 Ga0207689_10156521 Ga0207689_101565212 135
144 3300025949 Ga0207667_10000429 Ga0207667_1000042939 135
145 3300025949 Ga0207667_10303915 Ga0207667_103039153 135
146 3300026023 Ga0207677_11907816 Ga0207677_119078161 135
147 3300026067 Ga0207678_10588824 Ga0207678_105888242 135
148 3300026067 Ga0207678_11574040 Ga0207678_115740401 135
149 3300026116 Ga0207674_10547919 Ga0207674_105479192 135
150 3300026116 Ga0207674_10953048 Ga0207674_109530482 135
151 3300026142 Ga0207698_10187212 Ga0207698_101872123 135
152 3300027378 Ga0209981_1000142 Ga0209981_10001425 135
153 3300027462 Ga0210000_1006148 Ga0210000_10061482 135
154 3300027543 Ga0209999_1015477 Ga0209999_10154772 135
155 3300028381 Ga0268264_10058269 Ga0268264_100582693 135
156 3300028786 Ga0307517_10003229 Ga0307517_1000322923 135
157 3300028800 Ga0265338_10398410 Ga0265338_103984102 135
158 3300031239 Ga0265328_10009865 Ga0265328_100098652 135
159 3300031250 Ga0265331_10000439 Ga0265331_1000043925 135
160 3300031456 Ga0307513_10018717 Ga0307513_100187174 135
161 3300031548 Ga0307408_100273608 Ga0307408_1002736082 135
162 3300031616 Ga0307508_10063473 Ga0307508_100634732 135
163 3300031731 Ga0307405_10189282 Ga0307405_101892822 135
164 3300035083 Ga0373926_0220511 Ga0373926_0220511_197_604 135
165 3300035089 Ga0373944_0007138 Ga0373944_0007138_473_880 135
166 3300035171 Ga0373946_0103935 Ga0373946_0103935_688_1095 135
167 3300035695 Ga0373927_0000615 Ga0373927_0000615_18943_19350 135
168 3300037068 Ga0373925_0000278 Ga0373925_0000278_14800_15207 135
169 3300039437 Ga0436365_0010969 Ga0436365_0010969_74861_75331 135
170 3300046459 Ga0495629_0014588 Ga0495629_0014588_1608_2018 135
171 3300046515 Ga0495620_0041169 Ga0495620_0041169_450_860 135
172 3300046522 Ga0495643_0041390 Ga0495643_0041390_1861_2271 135
173 3300046538 Ga0495609_0094171 Ga0495609_0094171_608_1018 135
174 3300046542 Ga0495597_0001177 Ga0495597_0001177_4799_5209 135
175 3300046543 Ga0495645_0614691 Ga0495645_0614691_159_569 135
176 3300046616 Ga0495668_0055811 Ga0495668_0055811_1058_1468 135
177 3300046660 Ga0495625_0143754 Ga0495625_0143754_540_950 135
178 3300046684 Ga0495669_0128162 Ga0495669_0128162_170_580 135
179 3300046690 Ga0495624_0172385 Ga0495624_0172385_886_1296 135
180 3300048905 Ga0496102_0199050 Ga0496102_0199050_1432_1842 135
181 3300048906 Ga0496103_0069491 Ga0496103_0069491_154_564 135
182 3300048912 Ga0496109_1292249 Ga0496109_1292249_165_581 135
183 3300048918 Ga0496115_0001327 Ga0496115_0001327_198_605 135
184 3300048921 Ga0496118_0006262 Ga0496118_0006262_1435_1845 135
185 3300048922 Ga0496119_0053497 Ga0496119_0053497_861_1271 135
186 3300048924 Ga0496121_0000042 Ga0496121_0000042_316307_316717 135
187 3300049569 Ga0501032_0083033 Ga0501032_0083033_763_1170 135
188 3300049571 Ga0501034_0076131 Ga0501034_0076131_1099_1506 135
189 3300049581 Ga0501047_0000370 Ga0501047_0000370_38367_38777 135
190 3300049588 Ga0501072_0143210 Ga0501072_0143210_1317_1727 135
191 3300049589 Ga0501073_1194790 Ga0501073_1194790_43_450 135
192 3300049593 Ga0501077_0105822 Ga0501077_0105822_579_989 135
193 3300049665 Ga0501227_014716 Ga0501227_014716_576_983 135
194 3300049679 Ga0501249_000847 Ga0501249_000847_4388_4795 135
195 3300049822 Ga0501035_0023472 Ga0501035_0023472_1005_1412 135
196 3300049822 Ga0501035_0705030 Ga0501035_0705030_14_421 135
197 3300050507 nmdc:mga05p37_1461067_c1 nmdc:mga05p37_1461067_c1_134_544 135
198 3300050507 nmdc:mga05p37_692976_c1 nmdc:mga05p37_692976_c1_496_912 135
199 3300050510 nmdc:mga06r32_1524371_c1 nmdc:mga06r32_1524371_c1_184_594 135
200 3300050512 nmdc:mga0n895_7912_c1 nmdc:mga0n895_7912_c1_8306_8716 135
201 3300050515 nmdc:mga0a205_330811_c1 nmdc:mga0a205_330811_c1_796_1206 135
202 3300053080 Ga0500635_0000123 Ga0500635_0000123_22736_23146 135
203 3300053087 Ga0500643_009477 Ga0500643_009477_1864_2271 135
204 3300053092 Ga0500583_0123853 Ga0500583_0123853_525_935 135
205 3300053093 Ga0500651_0231159 Ga0500651_0231159_104_514 135
206 3300053094 Ga0500566_0291435 Ga0500566_0291435_150_560 135
207 3300053096 Ga0500641_0004505 Ga0500641_0004505_1242_1649 135
208 3300053109 Ga0500569_003023 Ga0500569_003023_1041_1451 135
209 3300053111 Ga0500572_176281 Ga0500572_176281_20_430 135
210 3300053122 Ga0500608_000757 Ga0500608_000757_4705_5115 135
211 3300053123 Ga0500614_006647 Ga0500614_006647_213_623 135
212 3300053130 Ga0500642_0033749 Ga0500642_0033749_991_1401 135
213 3300053136 Ga0500559_0007236 Ga0500559_0007236_150_560 135
214 3300053154 Ga0500619_237145 Ga0500619_237145_150_560 135
215 3300053162 Ga0500638_025647 Ga0500638_025647_1516_1926 135
216 3300053163 Ga0500639_247248 Ga0500639_247248_39_449 135
217 3300053178 Ga0500637_0498805 Ga0500637_0498805_15_425 135
218 3300053725 Ga0500576_034713 Ga0500576_034713_1356_1766 135
219 3300053729 Ga0500625_004305 Ga0500625_004305_1454_1864 135
220 3300053735 Ga0500596_000860 Ga0500596_000860_3885_4295 135
221 3300005539 Ga0068853_101557808 Ga0068853_1015578081 136
222 3300005578 Ga0068854_101358750 Ga0068854_1013587501 136
223 3300012513 Ga0157326_1004632 Ga0157326_10046322 136
224 3300026116 Ga0207674_10029882 Ga0207674_100298823 136
225 3300032004 Ga0307414_10228550 Ga0307414_102285501 136
226 3300039437 Ga0436365_1416132 Ga0436365_1416132_742_1155 136
227 3300049569 Ga0501032_0044384 Ga0501032_0044384_1588_2034 136
228 3300049579 Ga0501043_0002355 Ga0501043_0002355_813_1259 136
229 3300049581 Ga0501047_0002303 Ga0501047_0002303_11191_11637 136
230 3300005295 Ga0065707_10368175 Ga0065707_103681752 137
231 3300005334 Ga0068869_100404566 Ga0068869_1004045662 137
232 3300005353 Ga0070669_100920027 Ga0070669_1009200271 137
233 3300005355 Ga0070671_100158763 Ga0070671_1001587632 137
234 3300005548 Ga0070665_100615341 Ga0070665_1006153412 137
235 3300005616 Ga0068852_102380292 Ga0068852_1023802921 137
236 3300005719 Ga0068861_101303711 Ga0068861_1013037111 137
237 3300005841 Ga0068863_100005315 Ga0068863_10000531512 137
238 3300006051 Ga0075364_10021290 Ga0075364_100212902 137
239 3300006353 Ga0075370_10108314 Ga0075370_101083142 137
240 3300009093 Ga0105240_10285864 Ga0105240_102858643 137
241 3300009177 Ga0105248_10008346 Ga0105248_100083466 137
242 3300010375 Ga0105239_10015099 Ga0105239_100150995 137
243 3300025923 Ga0207681_10336380 Ga0207681_103363802 137
244 3300025931 Ga0207644_10166201 Ga0207644_101662012 137
245 3300025941 Ga0207711_10067901 Ga0207711_100679014 137
246 3300025972 Ga0207668_10051492 Ga0207668_100514922 137
247 3300026088 Ga0207641_10008657 Ga0207641_100086572 137
248 3300026118 Ga0207675_101562341 Ga0207675_1015623412 137
249 3300028379 Ga0268266_11895261 Ga0268266_118952611 137
250 3300041463 Ga0451804_0796472 Ga0451804_0796472_57_470 137
251 3300048928 Ga0496125_0009356 Ga0496125_0009356_9021_9434 137
252 3300049570 Ga0501033_0178742 Ga0501033_0178742_815_1228 137
253 3300049742 Ga0501080_0006093 Ga0501080_0006093_2367_2828 137
254 3300049744 Ga0501083_0016282 Ga0501083_0016282_979_1407 137
255 3300050491 nmdc:mga00v17_16666_c1 nmdc:mga00v17_16666_c1_2091_2504 137
256 3300050496 nmdc:mga07m45_91761_c1 nmdc:mga07m45_91761_c1_889_1302 137
257 3300053087 Ga0500643_011037 Ga0500643_011037_1030_1443 137
258 3300053091 Ga0500647_0015266 Ga0500647_0015266_1586_1999 137
259 3300053103 Ga0500555_137562 Ga0500555_137562_18_431 137
260 3300053108 Ga0500562_007391 Ga0500562_007391_1529_1942 137
261 3300053111 Ga0500572_000799 Ga0500572_000799_6198_6695 137
262 3300053120 Ga0500597_410690 Ga0500597_410690_60_473 137
263 3300053148 Ga0500590_038186 Ga0500590_038186_1772_2185 137
264 3300060353 Ga0501082_0010058 Ga0501082_0010058_7120_7548 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

32

162

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9618 3 135
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9572 3 136
5j3e-assembly2.cif.gz_B crystal structure of human thyn1 protein in complex with 5-methylcytosine containing dna 0.9415 3 137
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9303 3 136
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9282 5 135
ID Description Score Start End Superfamily
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9609 1 73 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9469 3 136 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9336 2 137 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9214 2 137 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9201 3 136 3.10.590.10
ID Description Score Start End GO Terms
AF-Q4EAW6-F1-model_v4 deleted 0.999 89 137
AF-A0A7C2SQE2-F1-model_v4 EVE domain-containing protein 0.9987 1 137
AF-A0A1Q8B4F1-F1-model_v4 Ubiquinol-cytochrome C reductase 0.998 5 135
AF-A0A317H2U1-F1-model_v4 EVE domain-containing protein 0.9975 3 136
AF-A0A257J184-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9973 3 136

Feature Viewer

pLDDT pTM Quality
95.36 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map