F372723
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 264 | 207 | 243 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_10069118|Ga0307410_100691182 |
| Length | 323 |
| Sequence | MSPYRLAGVGKSIFVITLLHERHDTTPRNNRSREWARSREKRLHHPHVVLMQRFSTTPMEMIASVWRNRWLTIQMVKREVLGRYRGSTLGLAWSFFYPVVMLGVYTFVFSVVFKARWGIGGEESKASFAIILFVGMIVHGLFAECVNRAPGLILSNVNYVKKVIFPLEILPWVAMGSALFHAVISLAVLLIAQFVLNFSLPWTAIFFPLVILPLVIATMGFAWVLSATGVYVRDISQMTGIITTVLLFVSPVFYPVSALPIEYRGWLLLNPLTFVIEEARNVLIWGRVIDWPRWGISVLAGFTIAWVGFWWFQKVRKGFADVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 3 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 4 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 5 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 6 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 7 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 8 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 9 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 10 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 11 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 12 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 13 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 14 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 15 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 16 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 17 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 18 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 22 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 24 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 104 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 105 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 108 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 109 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 110 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 113 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 114 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 115 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 117 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 118 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 119 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 120 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 121 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 122 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 123 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 124 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 125 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 177 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 181 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 191 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 192 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 193 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 203 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 204 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 205 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 206 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 207 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.05 |
| Metatranscriptomes | 0 |
| Isolates | 7.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.05 |
| Nodule | 0.76 |
| Rhizoplane | 1.52 |
| Rhizosphere | 73.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_414 | 2124908027 | Unclassified | 3181 |
| 2 | MRS2a_Contig_59 | 2124908027 | Bacteria | 6499 |
| 3 | JGI24740J21852_10000291 | 3300001979 | Bacteria | 21452 |
| 4 | JGI25162J39368_1000403 | 3300002737 | Bacteria | 35711 |
| 5 | JGI25158J39367_1000031 | 3300002739 | Bacteria | 31699 |
| 6 | JGI25164J39214_1000360 | 3300002772 | Bacteria | 27828 |
| 7 | JGI25159J45721_1000129 | 3300002987 | Bacteria | 36238 |
| 8 | JGI25165J46597_1000419 | 3300003214 | Bacteria | 43972 |
| 9 | JGI25160J50197_1000286 | 3300003354 | Bacteria | 36574 |
| 10 | JGI25161J50226_1000217 | 3300003374 | Bacteria | 36238 |
| 11 | Ga0055526_1000287 | 3300003771 | Bacteria | 42257 |
| 12 | Ga0055526_1002293 | 3300003771 | Bacteria | 13057 |
| 13 | Ga0055537_1000342 | 3300003773 | Bacteria | 31899 |
| 14 | Ga0055537_1003941 | 3300003773 | Bacteria | 4403 |
| 15 | Ga0055524_1002638 | 3300003775 | Bacteria | 9122 |
| 16 | Ga0055524_1004070 | 3300003775 | Bacteria | 6868 |
| 17 | Ga0055534_1000952 | 3300003784 | Bacteria | 12859 |
| 18 | Ga0055534_1001357 | 3300003784 | Bacteria | 9807 |
| 19 | Ga0055534_1007195 | 3300003784 | Bacteria | 2692 |
| 20 | Ga0055528_1020841 | 3300003790 | Bacteria | 2108 |
| 21 | Ga0055531_10018585 | 3300003794 | Bacteria | 2862 |
| 22 | Ga0058692_1002283 | 3300003856 | Bacteria | 6490 |
| 23 | Ga0055543_1000267 | 3300004625 | Bacteria | 38844 |
| 24 | Ga0065165_1000898 | 3300005262 | Bacteria | 38426 |
| 25 | Ga0065714_10002786 | 3300005288 | Bacteria | 21761 |
| 26 | Ga0070658_10003944 | 3300005327 | Bacteria | 12163 |
| 27 | Ga0068869_100011828 | 3300005334 | Bacteria | 5741 |
| 28 | Ga0070680_100043500 | 3300005336 | Bacteria | 3648 |
| 29 | Ga0070682_100013939 | 3300005337 | Bacteria | 4637 |
| 30 | Ga0070675_100690342 | 3300005354 | Unclassified | 929 |
| 31 | Ga0070659_100074632 | 3300005366 | Bacteria | 2702 |
| 32 | Ga0070705_100523100 | 3300005440 | Unclassified | 904 |
| 33 | Ga0070681_10398785 | 3300005458 | Bacteria | 1287 |
| 34 | Ga0070679_100128360 | 3300005530 | Bacteria | 2517 |
| 35 | Ga0070672_100002049 | 3300005543 | Bacteria | 12699 |
| 36 | Ga0068855_100063426 | 3300005563 | Bacteria | 4312 |
| 37 | Ga0068852_100984142 | 3300005616 | Unclassified | 862 |
| 38 | Ga0068858_100151620 | 3300005842 | Bacteria | 2180 |
| 39 | Ga0070716_100046966 | 3300006173 | Bacteria | 2433 |
| 40 | Ga0075366_10013980 | 3300006195 | Bacteria | 4579 |
| 41 | Ga0075430_100034513 | 3300006846 | Bacteria | 4293 |
| 42 | Ga0075430_100045339 | 3300006846 | Unclassified | 3715 |
| 43 | Ga0075433_10023120 | 3300006852 | Bacteria | 5228 |
| 44 | Ga0075433_10352202 | 3300006852 | Bacteria | 1301 |
| 45 | Ga0075434_100167874 | 3300006871 | Bacteria | 2214 |
| 46 | Ga0075434_100342460 | 3300006871 | Bacteria | 1516 |
| 47 | Ga0075429_100001966 | 3300006880 | Bacteria | 17078 |
| 48 | Ga0075429_100002248 | 3300006880 | Bacteria | 16164 |
| 49 | Ga0075436_100424313 | 3300006914 | Bacteria | 966 |
| 50 | Ga0075435_100078418 | 3300007076 | Bacteria | 2708 |
| 51 | Ga0105251_10000242 | 3300009011 | Bacteria | 54918 |
| 52 | Ga0105251_10000955 | 3300009011 | Bacteria | 25755 |
| 53 | Ga0105244_10000477 | 3300009036 | Bacteria | 36264 |
| 54 | Ga0105244_10051822 | 3300009036 | Bacteria | 2091 |
| 55 | Ga0111539_10154137 | 3300009094 | Bacteria | 2689 |
| 56 | Ga0105243_10047329 | 3300009148 | Bacteria | 3385 |
| 57 | Ga0105237_10374952 | 3300009545 | Bacteria | 1427 |
| 58 | Ga0105238_10017693 | 3300009551 | Bacteria | 7246 |
| 59 | Ga0157373_10000216 | 3300013100 | Bacteria | 47143 |
| 60 | Ga0157373_10005911 | 3300013100 | Bacteria | 9158 |
| 61 | Ga0157371_10007024 | 3300013102 | Bacteria | 9160 |
| 62 | Ga0157370_10001726 | 3300013104 | Bacteria | 26910 |
| 63 | Ga0157370_10003397 | 3300013104 | Bacteria | 18698 |
| 64 | Ga0157370_10014426 | 3300013104 | Bacteria | 8077 |
| 65 | Ga0157370_10039310 | 3300013104 | Bacteria | 4572 |
| 66 | Ga0157369_10013801 | 3300013105 | Bacteria | 9131 |
| 67 | Ga0157369_10459694 | 3300013105 | Bacteria | 1318 |
| 68 | Ga0163162_10002451 | 3300013306 | Bacteria | 17500 |
| 69 | Ga0157372_10052348 | 3300013307 | Bacteria | 4546 |
| 70 | Ga0182008_10000455 | 3300014497 | Bacteria | 31241 |
| 71 | Ga0209436_100116 | 3300025208 | Bacteria | 39369 |
| 72 | Ga0209566_100501 | 3300025225 | Bacteria | 27177 |
| 73 | Ga0209672_103200 | 3300025228 | Bacteria | 3493 |
| 74 | Ga0207427_100078 | 3300025231 | Bacteria | 147526 |
| 75 | Ga0209437_100090 | 3300025233 | Bacteria | 247138 |
| 76 | Ga0209233_1000077 | 3300025261 | Bacteria | 349570 |
| 77 | Ga0209565_1000296 | 3300025263 | Bacteria | 47631 |
| 78 | Ga0209565_1000367 | 3300025263 | Bacteria | 38709 |
| 79 | Ga0209565_1000379 | 3300025263 | Bacteria | 38059 |
| 80 | Ga0209673_1004263 | 3300025273 | Bacteria | 7774 |
| 81 | Ga0209130_1000518 | 3300025284 | Bacteria | 38858 |
| 82 | Ga0209675_1000268 | 3300025291 | Bacteria | 49787 |
| 83 | Ga0209675_1000389 | 3300025291 | Bacteria | 36614 |
| 84 | Ga0209675_1001382 | 3300025291 | Bacteria | 14144 |
| 85 | Ga0209564_1000063 | 3300025295 | Bacteria | 318515 |
| 86 | Ga0209564_1000908 | 3300025295 | Bacteria | 38758 |
| 87 | Ga0209564_1003283 | 3300025295 | Bacteria | 11274 |
| 88 | Ga0209758_1029543 | 3300025297 | Bacteria | 2289 |
| 89 | Ga0209256_1000227 | 3300025299 | Bacteria | 103299 |
| 90 | Ga0209256_1000638 | 3300025299 | Bacteria | 47804 |
| 91 | Ga0207426_1000506 | 3300025302 | Bacteria | 57538 |
| 92 | Ga0209257_1000067 | 3300025304 | Bacteria | 342468 |
| 93 | Ga0207655_1002120 | 3300025728 | Bacteria | 16584 |
| 94 | Ga0207655_1063669 | 3300025728 | Unclassified | 1411 |
| 95 | Ga0207713_1000955 | 3300025735 | Bacteria | 25763 |
| 96 | Ga0207705_10025707 | 3300025909 | Bacteria | 4201 |
| 97 | Ga0207707_10177426 | 3300025912 | Bacteria | 1861 |
| 98 | Ga0207671_10250860 | 3300025914 | Bacteria | 1391 |
| 99 | Ga0207652_10073181 | 3300025921 | Bacteria | 2981 |
| 100 | Ga0207694_10009833 | 3300025924 | Bacteria | 7223 |
| 101 | Ga0207709_10028143 | 3300025935 | Bacteria | 3246 |
| 102 | Ga0207669_10215702 | 3300025937 | Bacteria | 1404 |
| 103 | Ga0207665_10060426 | 3300025939 | Bacteria | 2566 |
| 104 | Ga0207691_10005044 | 3300025940 | Bacteria | 12740 |
| 105 | Ga0207689_10050761 | 3300025942 | Bacteria | 3419 |
| 106 | Ga0207667_10049085 | 3300025949 | Bacteria | 4460 |
| 107 | Ga0207703_10146898 | 3300026035 | Bacteria | 2052 |
| 108 | Ga0209371_1001051 | 3300027312 | Bacteria | 20781 |
| 109 | Ga0209967_1005818 | 3300027364 | Bacteria | 1666 |
| 110 | Ga0268256_1001187 | 3300030500 | Bacteria | 16663 |
| 111 | Ga0265327_10000438 | 3300031251 | Bacteria | 75623 |
| 112 | Ga0307509_10224415 | 3300031507 | Bacteria | 1688 |
| 113 | Ga0316576_10009811 | 3300031727 | Bacteria | 6198 |
| 114 | Ga0307410_10069118 | 3300031852 | Bacteria | 2442 |
| 115 | Ga0307414_10278947 | 3300032004 | Bacteria | 1403 |
| 116 | Ga0307415_100368937 | 3300032126 | Bacteria | 1215 |
| 117 | Ga0307507_10106872 | 3300033179 | Bacteria | 2309 |
| 118 | Ga0316584_0273659 | 3300036712 | Unclassified | 1229 |
| 119 | Ga0395901_0645094 | 3300038443 | Bacteria | 1063 |
| 120 | Ga0439438_003524 | 3300041405 | Bacteria | 6309 |
| 121 | Ga0439447_000802 | 3300041407 | Bacteria | 11559 |
| 122 | Ga0439447_008578 | 3300041407 | Bacteria | 3159 |
| 123 | Ga0439466_0000180 | 3300041411 | Bacteria | 25149 |
| 124 | Ga0439466_0000299 | 3300041411 | Bacteria | 19156 |
| 125 | Ga0439466_0014124 | 3300041411 | Bacteria | 2913 |
| 126 | Ga0451791_1578584 | 3300041451 | Bacteria | 887 |
| 127 | Ga0451837_0607370 | 3300041494 | Bacteria | 2482 |
| 128 | Ga0439432_000090 | 3300042006 | Bacteria | 28639 |
| 129 | Ga0439432_023009 | 3300042006 | Bacteria | 2055 |
| 130 | Ga0439451_000034 | 3300042009 | Bacteria | 27633 |
| 131 | Ga0439452_000404 | 3300042010 | Bacteria | 25488 |
| 132 | Ga0439456_000119 | 3300042013 | Bacteria | 24617 |
| 133 | Ga0439456_002854 | 3300042013 | Bacteria | 3486 |
| 134 | Ga0439456_010634 | 3300042013 | Bacteria | 1902 |
| 135 | Ga0439463_000052 | 3300042016 | Bacteria | 24955 |
| 136 | Ga0450906_004520 | 3300042145 | Bacteria | 2911 |
| 137 | Ga0450907_000214 | 3300042146 | Bacteria | 20555 |
| 138 | Ga0439460_0000021 | 3300042461 | Bacteria | 22882 |
| 139 | Ga0439460_0025746 | 3300042461 | Bacteria | 1641 |
| 140 | Ga0466966_0000500 | 3300044684 | Bacteria | 25111 |
| 141 | Ga0466961_0000167 | 3300044693 | Bacteria | 44505 |
| 142 | Ga0453684_0000189 | 3300044712 | Bacteria | 269690 |
| 143 | Ga0453684_0033074 | 3300044712 | Bacteria | 7216 |
| 144 | Ga0466957_0157010 | 3300044842 | Bacteria | 1475 |
| 145 | Ga0451576_0085626 | 3300045051 | Bacteria | 3279 |
| 146 | Ga0451576_0554734 | 3300045051 | Bacteria | 1207 |
| 147 | Ga0495651_0000518 | 3300046462 | Bacteria | 30011 |
| 148 | Ga0495650_0004578 | 3300046471 | Bacteria | 9406 |
| 149 | Ga0495580_0006790 | 3300046472 | Bacteria | 9279 |
| 150 | Ga0495605_0000747 | 3300046474 | Bacteria | 23843 |
| 151 | Ga0495584_0000141 | 3300046491 | Bacteria | 50024 |
| 152 | Ga0495584_0000285 | 3300046491 | Bacteria | 35720 |
| 153 | Ga0495585_0001746 | 3300046492 | Bacteria | 16559 |
| 154 | Ga0495607_0000294 | 3300046501 | Bacteria | 52746 |
| 155 | Ga0495607_0001105 | 3300046501 | Bacteria | 24543 |
| 156 | Ga0495583_0000244 | 3300046506 | Bacteria | 89766 |
| 157 | Ga0495606_0061361 | 3300046507 | Bacteria | 2404 |
| 158 | Ga0495610_0002731 | 3300046512 | Bacteria | 14505 |
| 159 | Ga0495628_0006307 | 3300046516 | Bacteria | 10359 |
| 160 | Ga0495628_0371249 | 3300046516 | Bacteria | 1049 |
| 161 | Ga0495631_0013299 | 3300046518 | Bacteria | 3996 |
| 162 | Ga0495632_0000527 | 3300046519 | Bacteria | 36131 |
| 163 | Ga0495632_0005636 | 3300046519 | Bacteria | 8233 |
| 164 | Ga0495637_0000046 | 3300046520 | Bacteria | 108118 |
| 165 | Ga0495637_0143111 | 3300046520 | Bacteria | 906 |
| 166 | Ga0495643_0001350 | 3300046522 | Bacteria | 23094 |
| 167 | Ga0495644_0000402 | 3300046523 | Bacteria | 19420 |
| 168 | Ga0495644_0065554 | 3300046523 | Bacteria | 1364 |
| 169 | Ga0495648_0023586 | 3300046524 | Bacteria | 4208 |
| 170 | Ga0495663_0002330 | 3300046525 | Bacteria | 5744 |
| 171 | Ga0495642_0000096 | 3300046528 | Bacteria | 50386 |
| 172 | Ga0495654_0081162 | 3300046530 | Bacteria | 1520 |
| 173 | Ga0495609_0000069 | 3300046538 | Bacteria | 128601 |
| 174 | Ga0495609_0000396 | 3300046538 | Bacteria | 36617 |
| 175 | Ga0495621_0000203 | 3300046539 | Bacteria | 13807 |
| 176 | Ga0495597_0000054 | 3300046542 | Bacteria | 95390 |
| 177 | Ga0495597_0041376 | 3300046542 | Bacteria | 2059 |
| 178 | Ga0495622_0000309 | 3300046557 | Bacteria | 36399 |
| 179 | Ga0495633_0001105 | 3300046558 | Bacteria | 21707 |
| 180 | Ga0495668_0056961 | 3300046616 | Bacteria | 2156 |
| 181 | Ga0495611_0007815 | 3300046648 | Bacteria | 4540 |
| 182 | Ga0495625_0045633 | 3300046660 | Bacteria | 3166 |
| 183 | Ga0495659_0000930 | 3300046664 | Bacteria | 10390 |
| 184 | Ga0495661_0000086 | 3300046665 | Bacteria | 113945 |
| 185 | Ga0495661_0001439 | 3300046665 | Bacteria | 19899 |
| 186 | Ga0495588_0000401 | 3300046674 | Bacteria | 24521 |
| 187 | Ga0495613_0000648 | 3300046689 | Bacteria | 27667 |
| 188 | Ga0495670_0000287 | 3300046691 | Bacteria | 23738 |
| 189 | Ga0495671_0000500 | 3300046692 | Bacteria | 30197 |
| 190 | Ga0495649_0000432 | 3300046694 | Bacteria | 36223 |
| 191 | Ga0495649_0002210 | 3300046694 | Bacteria | 13889 |
| 192 | Ga0495589_0001601 | 3300046794 | Bacteria | 12975 |
| 193 | Ga0495589_0003288 | 3300046794 | Bacteria | 8775 |
| 194 | Ga0495636_0000191 | 3300047318 | Bacteria | 24040 |
| 195 | Ga0495674_0103467 | 3300047319 | Bacteria | 2421 |
| 196 | Ga0495672_0000125 | 3300047320 | Bacteria | 118271 |
| 197 | Ga0495672_0001359 | 3300047320 | Bacteria | 24241 |
| 198 | Ga0495672_0016854 | 3300047320 | Bacteria | 4903 |
| 199 | Ga0495687_030547 | 3300047443 | Bacteria | 2480 |
| 200 | Ga0495687_158607 | 3300047443 | Bacteria | 764 |
| 201 | Ga0495679_000106 | 3300047446 | Bacteria | 75283 |
| 202 | Ga0495673_0016853 | 3300047469 | Bacteria | 3723 |
| 203 | Ga0495681_0000597 | 3300047470 | Bacteria | 27535 |
| 204 | Ga0495626_0000114 | 3300048091 | Bacteria | 105174 |
| 205 | Ga0495626_0000699 | 3300048091 | Bacteria | 31942 |
| 206 | Ga0495626_0000843 | 3300048091 | Bacteria | 27491 |
| 207 | Ga0496101_0592238 | 3300048904 | Bacteria | 877 |
| 208 | Ga0496106_0209691 | 3300048909 | Bacteria | 1552 |
| 209 | Ga0496116_0052927 | 3300048919 | Bacteria | 2685 |
| 210 | Ga0496118_0200245 | 3300048921 | Bacteria | 1184 |
| 211 | Ga0496121_0001685 | 3300048924 | Bacteria | 36349 |
| 212 | Ga0496124_0341130 | 3300048927 | Bacteria | 1064 |
| 213 | Ga0496126_0011126 | 3300048929 | Bacteria | 9344 |
| 214 | Ga0495678_000348 | 3300049459 | Bacteria | 48155 |
| 215 | Ga0495678_000569 | 3300049459 | Bacteria | 35204 |
| 216 | Ga0495682_0000651 | 3300049460 | Bacteria | 23215 |
| 217 | Ga0495682_0024949 | 3300049460 | Bacteria | 2226 |
| 218 | Ga0501031_0047349 | 3300049568 | Bacteria | 2803 |
| 219 | Ga0501032_0115768 | 3300049569 | Bacteria | 1773 |
| 220 | Ga0501037_0104848 | 3300049573 | Bacteria | 2038 |
| 221 | Ga0501039_0000240 | 3300049575 | Bacteria | 39869 |
| 222 | Ga0501041_0050521 | 3300049577 | Bacteria | 2535 |
| 223 | Ga0501043_0176158 | 3300049579 | Bacteria | 1667 |
| 224 | Ga0501046_0003758 | 3300049580 | Bacteria | 13901 |
| 225 | Ga0501208_000468 | 3300049655 | Bacteria | 3215 |
| 226 | Ga0501253_000120 | 3300049683 | Bacteria | 5679 |
| 227 | Ga0501279_000313 | 3300049775 | Bacteria | 6567 |
| 228 | nmdc:mga0k408_78_c1 | 3300050493 | Bacteria | 45819 |
| 229 | nmdc:mga05p37_61103_c1 | 3300050507 | Unclassified | 4639 |
| 230 | nmdc:mga09592_1058_c1 | 3300050508 | Bacteria | 21818 |
| 231 | nmdc:mga09592_276322_c1 | 3300050508 | Bacteria | 1457 |
| 232 | nmdc:mga0qj67_209040_c1 | 3300050509 | Bacteria | 1585 |
| 233 | nmdc:mga0n895_79627_c1 | 3300050512 | Bacteria | 3263 |
| 234 | nmdc:mga0rr50_582934_c1 | 3300050513 | Bacteria | 953 |
| 235 | nmdc:mga0rr50_72956_c1 | 3300050513 | Bacteria | 2623 |
| 236 | nmdc:mga08x19_10340_c1 | 3300050514 | Bacteria | 5601 |
| 237 | nmdc:mga0a205_23262_c1 | 3300050515 | Bacteria | 5876 |
| 238 | nmdc:mga0a205_30219_c1 | 3300050515 | Bacteria | 5187 |
| 239 | nmdc:mga0a205_340944_c1 | 3300050515 | Bacteria | 1367 |
| 240 | nmdc:mga0a205_41781_c1 | 3300050515 | Bacteria | 4417 |
| 241 | Ga0495601_0269442 | 3300053077 | Bacteria | 1111 |
| 242 | Ga0500619_000209 | 3300053154 | Bacteria | 13571 |
| 243 | Ga0466962_0012382 | 3300061719 | Bacteria | 4101 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10017693 | Ga0105238_100176932 | 219 |
| 2 | 3300013105 | Ga0157369_10459694 | Ga0157369_104596942 | 220 |
| 3 | 3300025297 | Ga0209758_1029543 | Ga0209758_10295432 | 221 |
| 4 | 3300050514 | nmdc:mga08x19_10340_c1 | nmdc:mga08x19_10340_c1_4916_5587 | 222 |
| 5 | 3300047320 | Ga0495672_0000125 | Ga0495672_0000125_31733_32587 | 230 |
| 6 | 3300049775 | Ga0501279_000313 | Ga0501279_000313_730_1584 | 233 |
| 7 | 3300047443 | Ga0495687_158607 | Ga0495687_158607_32_742 | 235 |
| 8 | 3300046462 | Ga0495651_0000518 | Ga0495651_0000518_3289_4143 | 237 |
| 9 | 3300046516 | Ga0495628_0006307 | Ga0495628_0006307_3335_4189 | 237 |
| 10 | 3300053077 | Ga0495601_0269442 | Ga0495601_0269442_188_1042 | 237 |
| 11 | 3300003771 | Ga0055526_1000287 | Ga0055526_100028717 | 238 |
| 12 | 3300003773 | Ga0055537_1000342 | Ga0055537_100034217 | 238 |
| 13 | 3300003775 | Ga0055524_1004070 | Ga0055524_10040705 | 238 |
| 14 | 3300003784 | Ga0055534_1007195 | Ga0055534_10071952 | 238 |
| 15 | 3300025263 | Ga0209565_1000379 | Ga0209565_100037912 | 238 |
| 16 | 3300025291 | Ga0209675_1001382 | Ga0209675_100138210 | 238 |
| 17 | 3300025295 | Ga0209564_1000063 | Ga0209564_100006386 | 238 |
| 18 | 3300025299 | Ga0209256_1000227 | Ga0209256_100022758 | 238 |
| 19 | 3300005327 | Ga0070658_10003944 | Ga0070658_100039442 | 241 |
| 20 | 3300005366 | Ga0070659_100074632 | Ga0070659_1000746322 | 241 |
| 21 | 3300025924 | Ga0207694_10009833 | Ga0207694_100098332 | 241 |
| 22 | 3300002737 | JGI25162J39368_1000403 | JGI25162J39368_100040319 | 245 |
| 23 | 3300002772 | JGI25164J39214_1000360 | JGI25164J39214_100036013 | 245 |
| 24 | 3300003214 | JGI25165J46597_1000419 | JGI25165J46597_100041919 | 245 |
| 25 | 3300025231 | Ga0207427_100078 | Ga0207427_100078107 | 245 |
| 26 | 3300025233 | Ga0209437_100090 | Ga0209437_10009086 | 245 |
| 27 | 3300025261 | Ga0209233_1000077 | Ga0209233_1000077183 | 245 |
| 28 | 3300025909 | Ga0207705_10025707 | Ga0207705_100257072 | 245 |
| 29 | 3300025225 | Ga0209566_100501 | Ga0209566_10050119 | 248 |
| 30 | 3300032004 | Ga0307414_10278947 | Ga0307414_102789471 | 248 |
| 31 | 3300045051 | Ga0451576_0554734 | Ga0451576_0554734_444_1193 | 249 |
| 32 | 3300048904 | Ga0496101_0592238 | Ga0496101_0592238_23_781 | 249 |
| 33 | 3300048924 | Ga0496121_0001685 | Ga0496121_0001685_5736_6614 | 249 |
| 34 | 3300048927 | Ga0496124_0341130 | Ga0496124_0341130_289_1047 | 249 |
| 35 | 3300031251 | Ga0265327_10000438 | Ga0265327_1000043859 | 250 |
| 36 | 3300005337 | Ga0070682_100013939 | Ga0070682_1000139392 | 251 |
| 37 | 3300005563 | Ga0068855_100063426 | Ga0068855_1000634263 | 251 |
| 38 | 3300009011 | Ga0105251_10000242 | Ga0105251_100002424 | 251 |
| 39 | 3300013102 | Ga0157371_10007024 | Ga0157371_100070242 | 251 |
| 40 | 3300013104 | Ga0157370_10039310 | Ga0157370_100393102 | 251 |
| 41 | 3300013307 | Ga0157372_10052348 | Ga0157372_100523482 | 251 |
| 42 | 3300025949 | Ga0207667_10049085 | Ga0207667_100490853 | 251 |
| 43 | 3300005543 | Ga0070672_100002049 | Ga0070672_1000020499 | 253 |
| 44 | 3300025940 | Ga0207691_10005044 | Ga0207691_100050442 | 253 |
| 45 | 3300002739 | JGI25158J39367_1000031 | JGI25158J39367_100003126 | 256 |
| 46 | 3300002987 | JGI25159J45721_1000129 | JGI25159J45721_100012926 | 256 |
| 47 | 3300003354 | JGI25160J50197_1000286 | JGI25160J50197_100028626 | 256 |
| 48 | 3300003374 | JGI25161J50226_1000217 | JGI25161J50226_100021726 | 256 |
| 49 | 3300003771 | Ga0055526_1002293 | Ga0055526_100229310 | 256 |
| 50 | 3300003773 | Ga0055537_1003941 | Ga0055537_10039414 | 256 |
| 51 | 3300003775 | Ga0055524_1002638 | Ga0055524_10026383 | 256 |
| 52 | 3300003784 | Ga0055534_1000952 | Ga0055534_10009529 | 256 |
| 53 | 3300003790 | Ga0055528_1020841 | Ga0055528_10208412 | 256 |
| 54 | 3300004625 | Ga0055543_1000267 | Ga0055543_100026728 | 256 |
| 55 | 3300005262 | Ga0065165_1000898 | Ga0065165_100089828 | 256 |
| 56 | 3300025208 | Ga0209436_100116 | Ga0209436_10011610 | 256 |
| 57 | 3300025263 | Ga0209565_1000296 | Ga0209565_100029636 | 256 |
| 58 | 3300025263 | Ga0209565_1000367 | Ga0209565_100036710 | 256 |
| 59 | 3300025273 | Ga0209673_1004263 | Ga0209673_10042636 | 256 |
| 60 | 3300025284 | Ga0209130_1000518 | Ga0209130_100051828 | 256 |
| 61 | 3300025291 | Ga0209675_1000268 | Ga0209675_100026838 | 256 |
| 62 | 3300025295 | Ga0209564_1000908 | Ga0209564_100090828 | 256 |
| 63 | 3300025295 | Ga0209564_1003283 | Ga0209564_100328310 | 256 |
| 64 | 3300025299 | Ga0209256_1000638 | Ga0209256_100063820 | 256 |
| 65 | 3300025302 | Ga0207426_1000506 | Ga0207426_100050628 | 256 |
| 66 | 3300046471 | Ga0495650_0004578 | Ga0495650_0004578_2054_2827 | 257 |
| 67 | 3300046491 | Ga0495584_0000141 | Ga0495584_0000141_2181_2954 | 257 |
| 68 | 3300046501 | Ga0495607_0000294 | Ga0495607_0000294_7906_8679 | 257 |
| 69 | 3300046506 | Ga0495583_0000244 | Ga0495583_0000244_15838_16611 | 257 |
| 70 | 3300046507 | Ga0495606_0061361 | Ga0495606_0061361_895_1668 | 257 |
| 71 | 3300046512 | Ga0495610_0002731 | Ga0495610_0002731_7270_8043 | 257 |
| 72 | 3300046518 | Ga0495631_0013299 | Ga0495631_0013299_906_1679 | 257 |
| 73 | 3300046519 | Ga0495632_0005636 | Ga0495632_0005636_2054_2827 | 257 |
| 74 | 3300046520 | Ga0495637_0000046 | Ga0495637_0000046_85039_85812 | 257 |
| 75 | 3300046523 | Ga0495644_0000402 | Ga0495644_0000402_12750_13523 | 257 |
| 76 | 3300046524 | Ga0495648_0023586 | Ga0495648_0023586_2222_2995 | 257 |
| 77 | 3300046538 | Ga0495609_0000069 | Ga0495609_0000069_52377_53150 | 257 |
| 78 | 3300046616 | Ga0495668_0056961 | Ga0495668_0056961_1297_2070 | 257 |
| 79 | 3300046648 | Ga0495611_0007815 | Ga0495611_0007815_1568_2341 | 257 |
| 80 | 3300046660 | Ga0495625_0045633 | Ga0495625_0045633_742_1515 | 257 |
| 81 | 3300046665 | Ga0495661_0000086 | Ga0495661_0000086_52392_53165 | 257 |
| 82 | 3300046694 | Ga0495649_0002210 | Ga0495649_0002210_12626_13399 | 257 |
| 83 | 3300047320 | Ga0495672_0016854 | Ga0495672_0016854_889_1662 | 257 |
| 84 | 3300047446 | Ga0495679_000106 | Ga0495679_000106_50390_51163 | 257 |
| 85 | 3300047469 | Ga0495673_0016853 | Ga0495673_0016853_1326_2099 | 257 |
| 86 | 3300047470 | Ga0495681_0000597 | Ga0495681_0000597_356_1129 | 257 |
| 87 | 3300048091 | Ga0495626_0000114 | Ga0495626_0000114_81850_82623 | 257 |
| 88 | 3300049459 | Ga0495678_000348 | Ga0495678_000348_8263_9036 | 257 |
| 89 | 3300005354 | Ga0070675_100690342 | Ga0070675_1006903421 | 258 |
| 90 | 3300005440 | Ga0070705_100523100 | Ga0070705_1005231001 | 258 |
| 91 | 3300005842 | Ga0068858_100151620 | Ga0068858_1001516202 | 258 |
| 92 | 3300006852 | Ga0075433_10352202 | Ga0075433_103522022 | 258 |
| 93 | 3300006871 | Ga0075434_100342460 | Ga0075434_1003424602 | 258 |
| 94 | 3300009148 | Ga0105243_10047329 | Ga0105243_100473293 | 258 |
| 95 | 3300025935 | Ga0207709_10028143 | Ga0207709_100281433 | 258 |
| 96 | 3300026035 | Ga0207703_10146898 | Ga0207703_101468982 | 258 |
| 97 | 3300046472 | Ga0495580_0006790 | Ga0495580_0006790_3641_4498 | 258 |
| 98 | 3300047319 | Ga0495674_0103467 | Ga0495674_0103467_44_1030 | 258 |
| 99 | 3300047443 | Ga0495687_030547 | Ga0495687_030547_1078_1935 | 258 |
| 100 | 3300050515 | nmdc:mga0a205_340944_c1 | nmdc:mga0a205_340944_c1_211_1041 | 258 |
| 101 | 3300003856 | Ga0058692_1002283 | Ga0058692_10022833 | 259 |
| 102 | 3300027312 | Ga0209371_1001051 | Ga0209371_100105116 | 259 |
| 103 | 3300030500 | Ga0268256_1001187 | Ga0268256_100118710 | 259 |
| 104 | iso_pu_bacteria | 2643221569 | 2643863675 | 259 |
| 105 | iso_pu_bacteria | 2643221594 | 2643982877 | 259 |
| 106 | 3300003784 | Ga0055534_1001357 | Ga0055534_10013578 | 260 |
| 107 | 3300013100 | Ga0157373_10005911 | Ga0157373_100059113 | 260 |
| 108 | 3300013104 | Ga0157370_10003397 | Ga0157370_1000339711 | 260 |
| 109 | 3300013104 | Ga0157370_10014426 | Ga0157370_100144262 | 260 |
| 110 | 3300013105 | Ga0157369_10013801 | Ga0157369_100138013 | 260 |
| 111 | 3300025291 | Ga0209675_1000389 | Ga0209675_100038921 | 260 |
| 112 | 3300031507 | Ga0307509_10224415 | Ga0307509_102244152 | 261 |
| 113 | 3300033179 | Ga0307507_10106872 | Ga0307507_101068722 | 261 |
| 114 | 3300042461 | Ga0439460_0025746 | Ga0439460_0025746_53_865 | 261 |
| 115 | 3300046474 | Ga0495605_0000747 | Ga0495605_0000747_4090_4929 | 261 |
| 116 | 3300046491 | Ga0495584_0000285 | Ga0495584_0000285_22830_23669 | 261 |
| 117 | 3300046519 | Ga0495632_0000527 | Ga0495632_0000527_22812_23651 | 261 |
| 118 | 3300046520 | Ga0495637_0143111 | Ga0495637_0143111_27_866 | 261 |
| 119 | 3300046522 | Ga0495643_0001350 | Ga0495643_0001350_18174_19013 | 261 |
| 120 | 3300046528 | Ga0495642_0000096 | Ga0495642_0000096_30749_31588 | 261 |
| 121 | 3300046530 | Ga0495654_0081162 | Ga0495654_0081162_361_1200 | 261 |
| 122 | 3300046538 | Ga0495609_0000396 | Ga0495609_0000396_22675_23514 | 261 |
| 123 | 3300046542 | Ga0495597_0041376 | Ga0495597_0041376_54_893 | 261 |
| 124 | 3300046694 | Ga0495649_0000432 | Ga0495649_0000432_12567_13406 | 261 |
| 125 | 3300046794 | Ga0495589_0003288 | Ga0495589_0003288_6004_6843 | 261 |
| 126 | 3300047318 | Ga0495636_0000191 | Ga0495636_0000191_18806_19645 | 261 |
| 127 | 3300047320 | Ga0495672_0001359 | Ga0495672_0001359_19007_19846 | 261 |
| 128 | 3300048091 | Ga0495626_0000699 | Ga0495626_0000699_18932_19771 | 261 |
| 129 | 3300049459 | Ga0495678_000569 | Ga0495678_000569_21890_22729 | 261 |
| 130 | 3300049460 | Ga0495682_0000651 | Ga0495682_0000651_18426_19265 | 261 |
| 131 | 3300044684 | Ga0466966_0000500 | Ga0466966_0000500_9431_10294 | 262 |
| 132 | 3300044693 | Ga0466961_0000167 | Ga0466961_0000167_32502_33365 | 262 |
| 133 | 3300044712 | Ga0453684_0000189 | Ga0453684_0000189_215321_216109 | 262 |
| 134 | 3300044842 | Ga0466957_0157010 | Ga0466957_0157010_30_893 | 262 |
| 135 | 3300061719 | Ga0466962_0012382 | Ga0466962_0012382_1120_1983 | 262 |
| 136 | 3300005334 | Ga0068869_100011828 | Ga0068869_1000118284 | 263 |
| 137 | 3300005336 | Ga0070680_100043500 | Ga0070680_1000435003 | 263 |
| 138 | 3300005458 | Ga0070681_10398785 | Ga0070681_103987852 | 263 |
| 139 | 3300006846 | Ga0075430_100045339 | Ga0075430_1000453393 | 263 |
| 140 | 3300006880 | Ga0075429_100002248 | Ga0075429_1000022485 | 263 |
| 141 | 3300013100 | Ga0157373_10000216 | Ga0157373_1000021624 | 263 |
| 142 | 3300025914 | Ga0207671_10250860 | Ga0207671_102508602 | 263 |
| 143 | 3300025921 | Ga0207652_10073181 | Ga0207652_100731813 | 263 |
| 144 | 3300025942 | Ga0207689_10050761 | Ga0207689_100507612 | 263 |
| 145 | 3300046557 | Ga0495622_0000309 | Ga0495622_0000309_24461_25252 | 263 |
| 146 | 3300046674 | Ga0495588_0000401 | Ga0495588_0000401_9694_10485 | 263 |
| 147 | 3300048909 | Ga0496106_0209691 | Ga0496106_0209691_46_867 | 263 |
| 148 | 3300048921 | Ga0496118_0200245 | Ga0496118_0200245_12_830 | 263 |
| 149 | 3300049568 | Ga0501031_0047349 | Ga0501031_0047349_32_823 | 263 |
| 150 | 3300049569 | Ga0501032_0115768 | Ga0501032_0115768_813_1604 | 263 |
| 151 | 3300049573 | Ga0501037_0104848 | Ga0501037_0104848_32_823 | 263 |
| 152 | 3300049575 | Ga0501039_0000240 | Ga0501039_0000240_29654_30445 | 263 |
| 153 | 3300049577 | Ga0501041_0050521 | Ga0501041_0050521_657_1448 | 263 |
| 154 | 3300049579 | Ga0501043_0176158 | Ga0501043_0176158_755_1546 | 263 |
| 155 | 3300049580 | Ga0501046_0003758 | Ga0501046_0003758_4763_5554 | 263 |
| 156 | 3300014497 | Ga0182008_10000455 | Ga0182008_1000045514 | 264 |
| 157 | 3300046492 | Ga0495585_0001746 | Ga0495585_0001746_827_1645 | 264 |
| 158 | 3300050515 | nmdc:mga0a205_23262_c1 | nmdc:mga0a205_23262_c1_941_1771 | 264 |
| 159 | 3300041451 | Ga0451791_1578584 | Ga0451791_1578584_58_858 | 265 |
| 160 | 3300041494 | Ga0451837_0607370 | Ga0451837_0607370_1091_1891 | 265 |
| 161 | 3300032126 | Ga0307415_100368937 | Ga0307415_1003689372 | 266 |
| 162 | 3300042013 | Ga0439456_000119 | Ga0439456_000119_18361_19182 | 266 |
| 163 | 3300046525 | Ga0495663_0002330 | Ga0495663_0002330_4180_5076 | 266 |
| 164 | 3300046558 | Ga0495633_0001105 | Ga0495633_0001105_19203_20021 | 266 |
| 165 | iso_pu_bacteria | 2857537821 | 2857538029 | 266 |
| 166 | 3300006195 | Ga0075366_10013980 | Ga0075366_100139802 | 267 |
| 167 | 3300050493 | nmdc:mga0k408_78_c1 | nmdc:mga0k408_78_c1_44554_45408 | 267 |
| 168 | iso_pu_bacteria | 2929183550 | 2929189301 | 267 |
| 169 | 3300031727 | Ga0316576_10009811 | Ga0316576_100098112 | 268 |
| 170 | 3300036712 | Ga0316584_0273659 | Ga0316584_0273659_72_902 | 268 |
| 171 | iso_pu_bacteria | 2818991448 | 2819613362 | 268 |
| 172 | iso_pu_bacteria | 2969304461 | 2969308711 | 269 |
| 173 | iso_pu_bacteria | 8001522603 | 8001523593 | 269 |
| 174 | iso_pu_bacteria | 8029995093 | 8029996861 | 269 |
| 175 | 3300005616 | Ga0068852_100984142 | Ga0068852_1009841421 | 270 |
| 176 | 3300009036 | Ga0105244_10051822 | Ga0105244_100518222 | 270 |
| 177 | 3300025728 | Ga0207655_1063669 | Ga0207655_10636692 | 270 |
| 178 | 3300048919 | Ga0496116_0052927 | Ga0496116_0052927_879_1703 | 270 |
| 179 | 3300003794 | Ga0055531_10018585 | Ga0055531_100185852 | 271 |
| 180 | 3300025228 | Ga0209672_103200 | Ga0209672_1032002 | 271 |
| 181 | 3300025304 | Ga0209257_1000067 | Ga0209257_100006757 | 271 |
| 182 | 3300046516 | Ga0495628_0371249 | Ga0495628_0371249_202_1029 | 271 |
| 183 | 3300048929 | Ga0496126_0011126 | Ga0496126_0011126_4298_5113 | 271 |
| 184 | 3300053154 | Ga0500619_000209 | Ga0500619_000209_6350_7177 | 271 |
| 185 | iso_pu_bacteria | 2511231011 | 2511295207 | 271 |
| 186 | iso_pu_bacteria | 2599185239 | 2599739310 | 271 |
| 187 | iso_pu_bacteria | 2818991452 | 2819632693 | 271 |
| 188 | iso_pu_bacteria | 2818991456 | 2819655704 | 271 |
| 189 | 3300001979 | JGI24740J21852_10000291 | JGI24740J21852_100002919 | 272 |
| 190 | 3300006871 | Ga0075434_100167874 | Ga0075434_1001678742 | 272 |
| 191 | 3300006914 | Ga0075436_100424313 | Ga0075436_1004243131 | 272 |
| 192 | 3300007076 | Ga0075435_100078418 | Ga0075435_1000784182 | 272 |
| 193 | 3300009094 | Ga0111539_10154137 | Ga0111539_101541373 | 272 |
| 194 | 3300045051 | Ga0451576_0085626 | Ga0451576_0085626_1738_2559 | 272 |
| 195 | 3300050508 | nmdc:mga09592_276322_c1 | nmdc:mga09592_276322_c1_210_1031 | 272 |
| 196 | 3300050512 | nmdc:mga0n895_79627_c1 | nmdc:mga0n895_79627_c1_1665_2486 | 272 |
| 197 | 3300050513 | nmdc:mga0rr50_582934_c1 | nmdc:mga0rr50_582934_c1_93_914 | 272 |
| 198 | 3300050513 | nmdc:mga0rr50_72956_c1 | nmdc:mga0rr50_72956_c1_1361_2182 | 272 |
| 199 | 3300050515 | nmdc:mga0a205_41781_c1 | nmdc:mga0a205_41781_c1_3423_4244 | 272 |
| 200 | iso_pu_bacteria | 2808606395 | 2809033467 | 272 |
| 201 | iso_pu_bacteria | 2834641062 | 2834641330 | 272 |
| 202 | iso_pu_bacteria | 2852103415 | 2852107591 | 272 |
| 203 | iso_pu_bacteria | 2928170801 | 2928173197 | 272 |
| 204 | iso_pu_bacteria | 8021120328 | 8021122583 | 272 |
| 205 | 2124908027 | MRS2a_Contig_414 | MRS2a_00304640 | 273 |
| 206 | 2124908027 | MRS2a_Contig_59 | MRS2a_00460100 | 273 |
| 207 | 3300005288 | Ga0065714_10002786 | Ga0065714_1000278612 | 273 |
| 208 | 3300005530 | Ga0070679_100128360 | Ga0070679_1001283601 | 273 |
| 209 | 3300006173 | Ga0070716_100046966 | Ga0070716_1000469662 | 273 |
| 210 | 3300006846 | Ga0075430_100034513 | Ga0075430_1000345132 | 273 |
| 211 | 3300006852 | Ga0075433_10023120 | Ga0075433_100231204 | 273 |
| 212 | 3300006880 | Ga0075429_100001966 | Ga0075429_10000196612 | 273 |
| 213 | 3300009011 | Ga0105251_10000955 | Ga0105251_1000095512 | 273 |
| 214 | 3300009036 | Ga0105244_10000477 | Ga0105244_1000047727 | 273 |
| 215 | 3300009545 | Ga0105237_10374952 | Ga0105237_103749521 | 273 |
| 216 | 3300013104 | Ga0157370_10001726 | Ga0157370_100017266 | 273 |
| 217 | 3300013306 | Ga0163162_10002451 | Ga0163162_1000245112 | 273 |
| 218 | 3300025728 | Ga0207655_1002120 | Ga0207655_10021204 | 273 |
| 219 | 3300025735 | Ga0207713_1000955 | Ga0207713_100095512 | 273 |
| 220 | 3300025912 | Ga0207707_10177426 | Ga0207707_101774262 | 273 |
| 221 | 3300025937 | Ga0207669_10215702 | Ga0207669_102157022 | 273 |
| 222 | 3300025939 | Ga0207665_10060426 | Ga0207665_100604263 | 273 |
| 223 | 3300027364 | Ga0209967_1005818 | Ga0209967_10058182 | 273 |
| 224 | 3300031852 | Ga0307410_10069118 | Ga0307410_100691182 | 273 |
| 225 | 3300038443 | Ga0395901_0645094 | Ga0395901_0645094_96_917 | 273 |
| 226 | 3300041405 | Ga0439438_003524 | Ga0439438_003524_1439_2260 | 273 |
| 227 | 3300041407 | Ga0439447_000802 | Ga0439447_000802_4245_5141 | 273 |
| 228 | 3300041407 | Ga0439447_008578 | Ga0439447_008578_2004_2825 | 273 |
| 229 | 3300041411 | Ga0439466_0000180 | Ga0439466_0000180_6420_7316 | 273 |
| 230 | 3300041411 | Ga0439466_0000299 | Ga0439466_0000299_1316_2206 | 273 |
| 231 | 3300041411 | Ga0439466_0014124 | Ga0439466_0014124_654_1475 | 273 |
| 232 | 3300042006 | Ga0439432_000090 | Ga0439432_000090_18958_19854 | 273 |
| 233 | 3300042006 | Ga0439432_023009 | Ga0439432_023009_1196_2017 | 273 |
| 234 | 3300042009 | Ga0439451_000034 | Ga0439451_000034_7094_7915 | 273 |
| 235 | 3300042010 | Ga0439452_000404 | Ga0439452_000404_21873_22763 | 273 |
| 236 | 3300042013 | Ga0439456_002854 | Ga0439456_002854_1256_2077 | 273 |
| 237 | 3300042013 | Ga0439456_010634 | Ga0439456_010634_392_1282 | 273 |
| 238 | 3300042016 | Ga0439463_000052 | Ga0439463_000052_17706_18602 | 273 |
| 239 | 3300042145 | Ga0450906_004520 | Ga0450906_004520_856_1752 | 273 |
| 240 | 3300042146 | Ga0450907_000214 | Ga0450907_000214_11410_12306 | 273 |
| 241 | 3300042461 | Ga0439460_0000021 | Ga0439460_0000021_17834_18730 | 273 |
| 242 | 3300044712 | Ga0453684_0033074 | Ga0453684_0033074_2721_3587 | 273 |
| 243 | 3300046501 | Ga0495607_0001105 | Ga0495607_0001105_9481_10338 | 273 |
| 244 | 3300046523 | Ga0495644_0065554 | Ga0495644_0065554_52_909 | 273 |
| 245 | 3300046539 | Ga0495621_0000203 | Ga0495621_0000203_4073_4903 | 273 |
| 246 | 3300046542 | Ga0495597_0000054 | Ga0495597_0000054_44977_45807 | 273 |
| 247 | 3300046664 | Ga0495659_0000930 | Ga0495659_0000930_7835_8692 | 273 |
| 248 | 3300046665 | Ga0495661_0001439 | Ga0495661_0001439_5764_6621 | 273 |
| 249 | 3300046689 | Ga0495613_0000648 | Ga0495613_0000648_22899_23720 | 273 |
| 250 | 3300046691 | Ga0495670_0000287 | Ga0495670_0000287_13303_14160 | 273 |
| 251 | 3300046692 | Ga0495671_0000500 | Ga0495671_0000500_19910_20731 | 273 |
| 252 | 3300046794 | Ga0495589_0001601 | Ga0495589_0001601_6873_7694 | 273 |
| 253 | 3300048091 | Ga0495626_0000843 | Ga0495626_0000843_6751_7572 | 273 |
| 254 | 3300049460 | Ga0495682_0024949 | Ga0495682_0024949_523_1380 | 273 |
| 255 | 3300049655 | Ga0501208_000468 | Ga0501208_000468_449_1270 | 273 |
| 256 | 3300049683 | Ga0501253_000120 | Ga0501253_000120_3619_4449 | 273 |
| 257 | 3300050507 | nmdc:mga05p37_61103_c1 | nmdc:mga05p37_61103_c1_342_1172 | 273 |
| 258 | 3300050508 | nmdc:mga09592_1058_c1 | nmdc:mga09592_1058_c1_11704_12534 | 273 |
| 259 | 3300050509 | nmdc:mga0qj67_209040_c1 | nmdc:mga0qj67_209040_c1_455_1285 | 273 |
| 260 | 3300050515 | nmdc:mga0a205_30219_c1 | nmdc:mga0a205_30219_c1_35_865 | 273 |
| 261 | iso_pu_bacteria | 2643221554 | 2643791847 | 273 |
| 262 | iso_pu_bacteria | 2856287931 | 2856290341 | 273 |
| 263 | iso_pu_bacteria | 2857357740 | 2857362634 | 273 |
| 264 | iso_pu_bacteria | 642555112 | 642594105 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.9064 | 18 | 273 |
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.903 | 18 | 273 |
| 6oih-assembly1.cif.gz_D | crystal structure of o-antigen polysaccharide abc-transporter | 0.8792 | 18 | 271 |
| 8dku-assembly1.cif.gz_B | cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen | 0.8786 | 18 | 271 |
| 6m96-assembly1.cif.gz_B-2 | atp-bound conformation of the wzmwzt o antigen abc transporter | 0.8749 | 18 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5827 | 70 | 266 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5128 | 71 | 264 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4617 | 76 | 273 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4478 | 70 | 266 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4011 | 71 | 264 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C8AYH2-F1-model_v4 | Transport permease protein | 0.9874 | 1 | 273 |
GO:0015920
GO:0043190 GO:0140359 |
| AF-A0A7C8AYH2-F1-model_v4 | Transport permease protein | 0.9838 | 1 | 273 |
GO:0015920
GO:0043190 GO:0140359 |
| AF-J3GNX5-F1-model_v4 | Transport permease protein | 0.9828 | 1 | 273 |
GO:0015920
GO:0043190 GO:0140359 |
| AF-A0A855NKY7-F1-model_v4 | deleted | 0.982 | 6 | 273 |
|
| AF-A0A1I3RW86-F1-model_v4 | Transport permease protein | 0.9809 | 6 | 273 |
GO:0015920
GO:0043190 GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar