F372723

General Info

Members Datasets Scaffolds Average Seq Length
264 207 243 267

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10069118|Ga0307410_100691182
Length 323
Sequence MSPYRLAGVGKSIFVITLLHERHDTTPRNNRSREWARSREKRLHHPHVVLMQRFSTTPMEMIASVWRNRWLTIQMVKREVLGRYRGSTLGLAWSFFYPVVMLGVYTFVFSVVFKARWGIGGEESKASFAIILFVGMIVHGLFAECVNRAPGLILSNVNYVKKVIFPLEILPWVAMGSALFHAVISLAVLLIAQFVLNFSLPWTAIFFPLVILPLVIATMGFAWVLSATGVYVRDISQMTGIITTVLLFVSPVFYPVSALPIEYRGWLLLNPLTFVIEEARNVLIWGRVIDWPRWGISVLAGFTIAWVGFWWFQKVRKGFADVL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
4 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
8 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
9 2818991452 Burkholderia cepacia 561 Isolate Unclassified
10 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
11 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
12 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
13 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
14 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
15 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
16 2928170801 Burkholderia sp. 572 Isolate Unclassified
17 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
18 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
119 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
120 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
121 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
122 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
123 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
191 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
192 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
205 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
206 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
207 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 0
Isolates 7.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.05
Nodule 0.76
Rhizoplane 1.52
Rhizosphere 73.48
Stem 0
Stem Tuber 0
Unclassified 7.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_414 2124908027 Unclassified 3181
2 MRS2a_Contig_59 2124908027 Bacteria 6499
3 JGI24740J21852_10000291 3300001979 Bacteria 21452
4 JGI25162J39368_1000403 3300002737 Bacteria 35711
5 JGI25158J39367_1000031 3300002739 Bacteria 31699
6 JGI25164J39214_1000360 3300002772 Bacteria 27828
7 JGI25159J45721_1000129 3300002987 Bacteria 36238
8 JGI25165J46597_1000419 3300003214 Bacteria 43972
9 JGI25160J50197_1000286 3300003354 Bacteria 36574
10 JGI25161J50226_1000217 3300003374 Bacteria 36238
11 Ga0055526_1000287 3300003771 Bacteria 42257
12 Ga0055526_1002293 3300003771 Bacteria 13057
13 Ga0055537_1000342 3300003773 Bacteria 31899
14 Ga0055537_1003941 3300003773 Bacteria 4403
15 Ga0055524_1002638 3300003775 Bacteria 9122
16 Ga0055524_1004070 3300003775 Bacteria 6868
17 Ga0055534_1000952 3300003784 Bacteria 12859
18 Ga0055534_1001357 3300003784 Bacteria 9807
19 Ga0055534_1007195 3300003784 Bacteria 2692
20 Ga0055528_1020841 3300003790 Bacteria 2108
21 Ga0055531_10018585 3300003794 Bacteria 2862
22 Ga0058692_1002283 3300003856 Bacteria 6490
23 Ga0055543_1000267 3300004625 Bacteria 38844
24 Ga0065165_1000898 3300005262 Bacteria 38426
25 Ga0065714_10002786 3300005288 Bacteria 21761
26 Ga0070658_10003944 3300005327 Bacteria 12163
27 Ga0068869_100011828 3300005334 Bacteria 5741
28 Ga0070680_100043500 3300005336 Bacteria 3648
29 Ga0070682_100013939 3300005337 Bacteria 4637
30 Ga0070675_100690342 3300005354 Unclassified 929
31 Ga0070659_100074632 3300005366 Bacteria 2702
32 Ga0070705_100523100 3300005440 Unclassified 904
33 Ga0070681_10398785 3300005458 Bacteria 1287
34 Ga0070679_100128360 3300005530 Bacteria 2517
35 Ga0070672_100002049 3300005543 Bacteria 12699
36 Ga0068855_100063426 3300005563 Bacteria 4312
37 Ga0068852_100984142 3300005616 Unclassified 862
38 Ga0068858_100151620 3300005842 Bacteria 2180
39 Ga0070716_100046966 3300006173 Bacteria 2433
40 Ga0075366_10013980 3300006195 Bacteria 4579
41 Ga0075430_100034513 3300006846 Bacteria 4293
42 Ga0075430_100045339 3300006846 Unclassified 3715
43 Ga0075433_10023120 3300006852 Bacteria 5228
44 Ga0075433_10352202 3300006852 Bacteria 1301
45 Ga0075434_100167874 3300006871 Bacteria 2214
46 Ga0075434_100342460 3300006871 Bacteria 1516
47 Ga0075429_100001966 3300006880 Bacteria 17078
48 Ga0075429_100002248 3300006880 Bacteria 16164
49 Ga0075436_100424313 3300006914 Bacteria 966
50 Ga0075435_100078418 3300007076 Bacteria 2708
51 Ga0105251_10000242 3300009011 Bacteria 54918
52 Ga0105251_10000955 3300009011 Bacteria 25755
53 Ga0105244_10000477 3300009036 Bacteria 36264
54 Ga0105244_10051822 3300009036 Bacteria 2091
55 Ga0111539_10154137 3300009094 Bacteria 2689
56 Ga0105243_10047329 3300009148 Bacteria 3385
57 Ga0105237_10374952 3300009545 Bacteria 1427
58 Ga0105238_10017693 3300009551 Bacteria 7246
59 Ga0157373_10000216 3300013100 Bacteria 47143
60 Ga0157373_10005911 3300013100 Bacteria 9158
61 Ga0157371_10007024 3300013102 Bacteria 9160
62 Ga0157370_10001726 3300013104 Bacteria 26910
63 Ga0157370_10003397 3300013104 Bacteria 18698
64 Ga0157370_10014426 3300013104 Bacteria 8077
65 Ga0157370_10039310 3300013104 Bacteria 4572
66 Ga0157369_10013801 3300013105 Bacteria 9131
67 Ga0157369_10459694 3300013105 Bacteria 1318
68 Ga0163162_10002451 3300013306 Bacteria 17500
69 Ga0157372_10052348 3300013307 Bacteria 4546
70 Ga0182008_10000455 3300014497 Bacteria 31241
71 Ga0209436_100116 3300025208 Bacteria 39369
72 Ga0209566_100501 3300025225 Bacteria 27177
73 Ga0209672_103200 3300025228 Bacteria 3493
74 Ga0207427_100078 3300025231 Bacteria 147526
75 Ga0209437_100090 3300025233 Bacteria 247138
76 Ga0209233_1000077 3300025261 Bacteria 349570
77 Ga0209565_1000296 3300025263 Bacteria 47631
78 Ga0209565_1000367 3300025263 Bacteria 38709
79 Ga0209565_1000379 3300025263 Bacteria 38059
80 Ga0209673_1004263 3300025273 Bacteria 7774
81 Ga0209130_1000518 3300025284 Bacteria 38858
82 Ga0209675_1000268 3300025291 Bacteria 49787
83 Ga0209675_1000389 3300025291 Bacteria 36614
84 Ga0209675_1001382 3300025291 Bacteria 14144
85 Ga0209564_1000063 3300025295 Bacteria 318515
86 Ga0209564_1000908 3300025295 Bacteria 38758
87 Ga0209564_1003283 3300025295 Bacteria 11274
88 Ga0209758_1029543 3300025297 Bacteria 2289
89 Ga0209256_1000227 3300025299 Bacteria 103299
90 Ga0209256_1000638 3300025299 Bacteria 47804
91 Ga0207426_1000506 3300025302 Bacteria 57538
92 Ga0209257_1000067 3300025304 Bacteria 342468
93 Ga0207655_1002120 3300025728 Bacteria 16584
94 Ga0207655_1063669 3300025728 Unclassified 1411
95 Ga0207713_1000955 3300025735 Bacteria 25763
96 Ga0207705_10025707 3300025909 Bacteria 4201
97 Ga0207707_10177426 3300025912 Bacteria 1861
98 Ga0207671_10250860 3300025914 Bacteria 1391
99 Ga0207652_10073181 3300025921 Bacteria 2981
100 Ga0207694_10009833 3300025924 Bacteria 7223
101 Ga0207709_10028143 3300025935 Bacteria 3246
102 Ga0207669_10215702 3300025937 Bacteria 1404
103 Ga0207665_10060426 3300025939 Bacteria 2566
104 Ga0207691_10005044 3300025940 Bacteria 12740
105 Ga0207689_10050761 3300025942 Bacteria 3419
106 Ga0207667_10049085 3300025949 Bacteria 4460
107 Ga0207703_10146898 3300026035 Bacteria 2052
108 Ga0209371_1001051 3300027312 Bacteria 20781
109 Ga0209967_1005818 3300027364 Bacteria 1666
110 Ga0268256_1001187 3300030500 Bacteria 16663
111 Ga0265327_10000438 3300031251 Bacteria 75623
112 Ga0307509_10224415 3300031507 Bacteria 1688
113 Ga0316576_10009811 3300031727 Bacteria 6198
114 Ga0307410_10069118 3300031852 Bacteria 2442
115 Ga0307414_10278947 3300032004 Bacteria 1403
116 Ga0307415_100368937 3300032126 Bacteria 1215
117 Ga0307507_10106872 3300033179 Bacteria 2309
118 Ga0316584_0273659 3300036712 Unclassified 1229
119 Ga0395901_0645094 3300038443 Bacteria 1063
120 Ga0439438_003524 3300041405 Bacteria 6309
121 Ga0439447_000802 3300041407 Bacteria 11559
122 Ga0439447_008578 3300041407 Bacteria 3159
123 Ga0439466_0000180 3300041411 Bacteria 25149
124 Ga0439466_0000299 3300041411 Bacteria 19156
125 Ga0439466_0014124 3300041411 Bacteria 2913
126 Ga0451791_1578584 3300041451 Bacteria 887
127 Ga0451837_0607370 3300041494 Bacteria 2482
128 Ga0439432_000090 3300042006 Bacteria 28639
129 Ga0439432_023009 3300042006 Bacteria 2055
130 Ga0439451_000034 3300042009 Bacteria 27633
131 Ga0439452_000404 3300042010 Bacteria 25488
132 Ga0439456_000119 3300042013 Bacteria 24617
133 Ga0439456_002854 3300042013 Bacteria 3486
134 Ga0439456_010634 3300042013 Bacteria 1902
135 Ga0439463_000052 3300042016 Bacteria 24955
136 Ga0450906_004520 3300042145 Bacteria 2911
137 Ga0450907_000214 3300042146 Bacteria 20555
138 Ga0439460_0000021 3300042461 Bacteria 22882
139 Ga0439460_0025746 3300042461 Bacteria 1641
140 Ga0466966_0000500 3300044684 Bacteria 25111
141 Ga0466961_0000167 3300044693 Bacteria 44505
142 Ga0453684_0000189 3300044712 Bacteria 269690
143 Ga0453684_0033074 3300044712 Bacteria 7216
144 Ga0466957_0157010 3300044842 Bacteria 1475
145 Ga0451576_0085626 3300045051 Bacteria 3279
146 Ga0451576_0554734 3300045051 Bacteria 1207
147 Ga0495651_0000518 3300046462 Bacteria 30011
148 Ga0495650_0004578 3300046471 Bacteria 9406
149 Ga0495580_0006790 3300046472 Bacteria 9279
150 Ga0495605_0000747 3300046474 Bacteria 23843
151 Ga0495584_0000141 3300046491 Bacteria 50024
152 Ga0495584_0000285 3300046491 Bacteria 35720
153 Ga0495585_0001746 3300046492 Bacteria 16559
154 Ga0495607_0000294 3300046501 Bacteria 52746
155 Ga0495607_0001105 3300046501 Bacteria 24543
156 Ga0495583_0000244 3300046506 Bacteria 89766
157 Ga0495606_0061361 3300046507 Bacteria 2404
158 Ga0495610_0002731 3300046512 Bacteria 14505
159 Ga0495628_0006307 3300046516 Bacteria 10359
160 Ga0495628_0371249 3300046516 Bacteria 1049
161 Ga0495631_0013299 3300046518 Bacteria 3996
162 Ga0495632_0000527 3300046519 Bacteria 36131
163 Ga0495632_0005636 3300046519 Bacteria 8233
164 Ga0495637_0000046 3300046520 Bacteria 108118
165 Ga0495637_0143111 3300046520 Bacteria 906
166 Ga0495643_0001350 3300046522 Bacteria 23094
167 Ga0495644_0000402 3300046523 Bacteria 19420
168 Ga0495644_0065554 3300046523 Bacteria 1364
169 Ga0495648_0023586 3300046524 Bacteria 4208
170 Ga0495663_0002330 3300046525 Bacteria 5744
171 Ga0495642_0000096 3300046528 Bacteria 50386
172 Ga0495654_0081162 3300046530 Bacteria 1520
173 Ga0495609_0000069 3300046538 Bacteria 128601
174 Ga0495609_0000396 3300046538 Bacteria 36617
175 Ga0495621_0000203 3300046539 Bacteria 13807
176 Ga0495597_0000054 3300046542 Bacteria 95390
177 Ga0495597_0041376 3300046542 Bacteria 2059
178 Ga0495622_0000309 3300046557 Bacteria 36399
179 Ga0495633_0001105 3300046558 Bacteria 21707
180 Ga0495668_0056961 3300046616 Bacteria 2156
181 Ga0495611_0007815 3300046648 Bacteria 4540
182 Ga0495625_0045633 3300046660 Bacteria 3166
183 Ga0495659_0000930 3300046664 Bacteria 10390
184 Ga0495661_0000086 3300046665 Bacteria 113945
185 Ga0495661_0001439 3300046665 Bacteria 19899
186 Ga0495588_0000401 3300046674 Bacteria 24521
187 Ga0495613_0000648 3300046689 Bacteria 27667
188 Ga0495670_0000287 3300046691 Bacteria 23738
189 Ga0495671_0000500 3300046692 Bacteria 30197
190 Ga0495649_0000432 3300046694 Bacteria 36223
191 Ga0495649_0002210 3300046694 Bacteria 13889
192 Ga0495589_0001601 3300046794 Bacteria 12975
193 Ga0495589_0003288 3300046794 Bacteria 8775
194 Ga0495636_0000191 3300047318 Bacteria 24040
195 Ga0495674_0103467 3300047319 Bacteria 2421
196 Ga0495672_0000125 3300047320 Bacteria 118271
197 Ga0495672_0001359 3300047320 Bacteria 24241
198 Ga0495672_0016854 3300047320 Bacteria 4903
199 Ga0495687_030547 3300047443 Bacteria 2480
200 Ga0495687_158607 3300047443 Bacteria 764
201 Ga0495679_000106 3300047446 Bacteria 75283
202 Ga0495673_0016853 3300047469 Bacteria 3723
203 Ga0495681_0000597 3300047470 Bacteria 27535
204 Ga0495626_0000114 3300048091 Bacteria 105174
205 Ga0495626_0000699 3300048091 Bacteria 31942
206 Ga0495626_0000843 3300048091 Bacteria 27491
207 Ga0496101_0592238 3300048904 Bacteria 877
208 Ga0496106_0209691 3300048909 Bacteria 1552
209 Ga0496116_0052927 3300048919 Bacteria 2685
210 Ga0496118_0200245 3300048921 Bacteria 1184
211 Ga0496121_0001685 3300048924 Bacteria 36349
212 Ga0496124_0341130 3300048927 Bacteria 1064
213 Ga0496126_0011126 3300048929 Bacteria 9344
214 Ga0495678_000348 3300049459 Bacteria 48155
215 Ga0495678_000569 3300049459 Bacteria 35204
216 Ga0495682_0000651 3300049460 Bacteria 23215
217 Ga0495682_0024949 3300049460 Bacteria 2226
218 Ga0501031_0047349 3300049568 Bacteria 2803
219 Ga0501032_0115768 3300049569 Bacteria 1773
220 Ga0501037_0104848 3300049573 Bacteria 2038
221 Ga0501039_0000240 3300049575 Bacteria 39869
222 Ga0501041_0050521 3300049577 Bacteria 2535
223 Ga0501043_0176158 3300049579 Bacteria 1667
224 Ga0501046_0003758 3300049580 Bacteria 13901
225 Ga0501208_000468 3300049655 Bacteria 3215
226 Ga0501253_000120 3300049683 Bacteria 5679
227 Ga0501279_000313 3300049775 Bacteria 6567
228 nmdc:mga0k408_78_c1 3300050493 Bacteria 45819
229 nmdc:mga05p37_61103_c1 3300050507 Unclassified 4639
230 nmdc:mga09592_1058_c1 3300050508 Bacteria 21818
231 nmdc:mga09592_276322_c1 3300050508 Bacteria 1457
232 nmdc:mga0qj67_209040_c1 3300050509 Bacteria 1585
233 nmdc:mga0n895_79627_c1 3300050512 Bacteria 3263
234 nmdc:mga0rr50_582934_c1 3300050513 Bacteria 953
235 nmdc:mga0rr50_72956_c1 3300050513 Bacteria 2623
236 nmdc:mga08x19_10340_c1 3300050514 Bacteria 5601
237 nmdc:mga0a205_23262_c1 3300050515 Bacteria 5876
238 nmdc:mga0a205_30219_c1 3300050515 Bacteria 5187
239 nmdc:mga0a205_340944_c1 3300050515 Bacteria 1367
240 nmdc:mga0a205_41781_c1 3300050515 Bacteria 4417
241 Ga0495601_0269442 3300053077 Bacteria 1111
242 Ga0500619_000209 3300053154 Bacteria 13571
243 Ga0466962_0012382 3300061719 Bacteria 4101

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10017693 Ga0105238_100176932 219
2 3300013105 Ga0157369_10459694 Ga0157369_104596942 220
3 3300025297 Ga0209758_1029543 Ga0209758_10295432 221
4 3300050514 nmdc:mga08x19_10340_c1 nmdc:mga08x19_10340_c1_4916_5587 222
5 3300047320 Ga0495672_0000125 Ga0495672_0000125_31733_32587 230
6 3300049775 Ga0501279_000313 Ga0501279_000313_730_1584 233
7 3300047443 Ga0495687_158607 Ga0495687_158607_32_742 235
8 3300046462 Ga0495651_0000518 Ga0495651_0000518_3289_4143 237
9 3300046516 Ga0495628_0006307 Ga0495628_0006307_3335_4189 237
10 3300053077 Ga0495601_0269442 Ga0495601_0269442_188_1042 237
11 3300003771 Ga0055526_1000287 Ga0055526_100028717 238
12 3300003773 Ga0055537_1000342 Ga0055537_100034217 238
13 3300003775 Ga0055524_1004070 Ga0055524_10040705 238
14 3300003784 Ga0055534_1007195 Ga0055534_10071952 238
15 3300025263 Ga0209565_1000379 Ga0209565_100037912 238
16 3300025291 Ga0209675_1001382 Ga0209675_100138210 238
17 3300025295 Ga0209564_1000063 Ga0209564_100006386 238
18 3300025299 Ga0209256_1000227 Ga0209256_100022758 238
19 3300005327 Ga0070658_10003944 Ga0070658_100039442 241
20 3300005366 Ga0070659_100074632 Ga0070659_1000746322 241
21 3300025924 Ga0207694_10009833 Ga0207694_100098332 241
22 3300002737 JGI25162J39368_1000403 JGI25162J39368_100040319 245
23 3300002772 JGI25164J39214_1000360 JGI25164J39214_100036013 245
24 3300003214 JGI25165J46597_1000419 JGI25165J46597_100041919 245
25 3300025231 Ga0207427_100078 Ga0207427_100078107 245
26 3300025233 Ga0209437_100090 Ga0209437_10009086 245
27 3300025261 Ga0209233_1000077 Ga0209233_1000077183 245
28 3300025909 Ga0207705_10025707 Ga0207705_100257072 245
29 3300025225 Ga0209566_100501 Ga0209566_10050119 248
30 3300032004 Ga0307414_10278947 Ga0307414_102789471 248
31 3300045051 Ga0451576_0554734 Ga0451576_0554734_444_1193 249
32 3300048904 Ga0496101_0592238 Ga0496101_0592238_23_781 249
33 3300048924 Ga0496121_0001685 Ga0496121_0001685_5736_6614 249
34 3300048927 Ga0496124_0341130 Ga0496124_0341130_289_1047 249
35 3300031251 Ga0265327_10000438 Ga0265327_1000043859 250
36 3300005337 Ga0070682_100013939 Ga0070682_1000139392 251
37 3300005563 Ga0068855_100063426 Ga0068855_1000634263 251
38 3300009011 Ga0105251_10000242 Ga0105251_100002424 251
39 3300013102 Ga0157371_10007024 Ga0157371_100070242 251
40 3300013104 Ga0157370_10039310 Ga0157370_100393102 251
41 3300013307 Ga0157372_10052348 Ga0157372_100523482 251
42 3300025949 Ga0207667_10049085 Ga0207667_100490853 251
43 3300005543 Ga0070672_100002049 Ga0070672_1000020499 253
44 3300025940 Ga0207691_10005044 Ga0207691_100050442 253
45 3300002739 JGI25158J39367_1000031 JGI25158J39367_100003126 256
46 3300002987 JGI25159J45721_1000129 JGI25159J45721_100012926 256
47 3300003354 JGI25160J50197_1000286 JGI25160J50197_100028626 256
48 3300003374 JGI25161J50226_1000217 JGI25161J50226_100021726 256
49 3300003771 Ga0055526_1002293 Ga0055526_100229310 256
50 3300003773 Ga0055537_1003941 Ga0055537_10039414 256
51 3300003775 Ga0055524_1002638 Ga0055524_10026383 256
52 3300003784 Ga0055534_1000952 Ga0055534_10009529 256
53 3300003790 Ga0055528_1020841 Ga0055528_10208412 256
54 3300004625 Ga0055543_1000267 Ga0055543_100026728 256
55 3300005262 Ga0065165_1000898 Ga0065165_100089828 256
56 3300025208 Ga0209436_100116 Ga0209436_10011610 256
57 3300025263 Ga0209565_1000296 Ga0209565_100029636 256
58 3300025263 Ga0209565_1000367 Ga0209565_100036710 256
59 3300025273 Ga0209673_1004263 Ga0209673_10042636 256
60 3300025284 Ga0209130_1000518 Ga0209130_100051828 256
61 3300025291 Ga0209675_1000268 Ga0209675_100026838 256
62 3300025295 Ga0209564_1000908 Ga0209564_100090828 256
63 3300025295 Ga0209564_1003283 Ga0209564_100328310 256
64 3300025299 Ga0209256_1000638 Ga0209256_100063820 256
65 3300025302 Ga0207426_1000506 Ga0207426_100050628 256
66 3300046471 Ga0495650_0004578 Ga0495650_0004578_2054_2827 257
67 3300046491 Ga0495584_0000141 Ga0495584_0000141_2181_2954 257
68 3300046501 Ga0495607_0000294 Ga0495607_0000294_7906_8679 257
69 3300046506 Ga0495583_0000244 Ga0495583_0000244_15838_16611 257
70 3300046507 Ga0495606_0061361 Ga0495606_0061361_895_1668 257
71 3300046512 Ga0495610_0002731 Ga0495610_0002731_7270_8043 257
72 3300046518 Ga0495631_0013299 Ga0495631_0013299_906_1679 257
73 3300046519 Ga0495632_0005636 Ga0495632_0005636_2054_2827 257
74 3300046520 Ga0495637_0000046 Ga0495637_0000046_85039_85812 257
75 3300046523 Ga0495644_0000402 Ga0495644_0000402_12750_13523 257
76 3300046524 Ga0495648_0023586 Ga0495648_0023586_2222_2995 257
77 3300046538 Ga0495609_0000069 Ga0495609_0000069_52377_53150 257
78 3300046616 Ga0495668_0056961 Ga0495668_0056961_1297_2070 257
79 3300046648 Ga0495611_0007815 Ga0495611_0007815_1568_2341 257
80 3300046660 Ga0495625_0045633 Ga0495625_0045633_742_1515 257
81 3300046665 Ga0495661_0000086 Ga0495661_0000086_52392_53165 257
82 3300046694 Ga0495649_0002210 Ga0495649_0002210_12626_13399 257
83 3300047320 Ga0495672_0016854 Ga0495672_0016854_889_1662 257
84 3300047446 Ga0495679_000106 Ga0495679_000106_50390_51163 257
85 3300047469 Ga0495673_0016853 Ga0495673_0016853_1326_2099 257
86 3300047470 Ga0495681_0000597 Ga0495681_0000597_356_1129 257
87 3300048091 Ga0495626_0000114 Ga0495626_0000114_81850_82623 257
88 3300049459 Ga0495678_000348 Ga0495678_000348_8263_9036 257
89 3300005354 Ga0070675_100690342 Ga0070675_1006903421 258
90 3300005440 Ga0070705_100523100 Ga0070705_1005231001 258
91 3300005842 Ga0068858_100151620 Ga0068858_1001516202 258
92 3300006852 Ga0075433_10352202 Ga0075433_103522022 258
93 3300006871 Ga0075434_100342460 Ga0075434_1003424602 258
94 3300009148 Ga0105243_10047329 Ga0105243_100473293 258
95 3300025935 Ga0207709_10028143 Ga0207709_100281433 258
96 3300026035 Ga0207703_10146898 Ga0207703_101468982 258
97 3300046472 Ga0495580_0006790 Ga0495580_0006790_3641_4498 258
98 3300047319 Ga0495674_0103467 Ga0495674_0103467_44_1030 258
99 3300047443 Ga0495687_030547 Ga0495687_030547_1078_1935 258
100 3300050515 nmdc:mga0a205_340944_c1 nmdc:mga0a205_340944_c1_211_1041 258
101 3300003856 Ga0058692_1002283 Ga0058692_10022833 259
102 3300027312 Ga0209371_1001051 Ga0209371_100105116 259
103 3300030500 Ga0268256_1001187 Ga0268256_100118710 259
104 iso_pu_bacteria 2643221569 2643863675 259
105 iso_pu_bacteria 2643221594 2643982877 259
106 3300003784 Ga0055534_1001357 Ga0055534_10013578 260
107 3300013100 Ga0157373_10005911 Ga0157373_100059113 260
108 3300013104 Ga0157370_10003397 Ga0157370_1000339711 260
109 3300013104 Ga0157370_10014426 Ga0157370_100144262 260
110 3300013105 Ga0157369_10013801 Ga0157369_100138013 260
111 3300025291 Ga0209675_1000389 Ga0209675_100038921 260
112 3300031507 Ga0307509_10224415 Ga0307509_102244152 261
113 3300033179 Ga0307507_10106872 Ga0307507_101068722 261
114 3300042461 Ga0439460_0025746 Ga0439460_0025746_53_865 261
115 3300046474 Ga0495605_0000747 Ga0495605_0000747_4090_4929 261
116 3300046491 Ga0495584_0000285 Ga0495584_0000285_22830_23669 261
117 3300046519 Ga0495632_0000527 Ga0495632_0000527_22812_23651 261
118 3300046520 Ga0495637_0143111 Ga0495637_0143111_27_866 261
119 3300046522 Ga0495643_0001350 Ga0495643_0001350_18174_19013 261
120 3300046528 Ga0495642_0000096 Ga0495642_0000096_30749_31588 261
121 3300046530 Ga0495654_0081162 Ga0495654_0081162_361_1200 261
122 3300046538 Ga0495609_0000396 Ga0495609_0000396_22675_23514 261
123 3300046542 Ga0495597_0041376 Ga0495597_0041376_54_893 261
124 3300046694 Ga0495649_0000432 Ga0495649_0000432_12567_13406 261
125 3300046794 Ga0495589_0003288 Ga0495589_0003288_6004_6843 261
126 3300047318 Ga0495636_0000191 Ga0495636_0000191_18806_19645 261
127 3300047320 Ga0495672_0001359 Ga0495672_0001359_19007_19846 261
128 3300048091 Ga0495626_0000699 Ga0495626_0000699_18932_19771 261
129 3300049459 Ga0495678_000569 Ga0495678_000569_21890_22729 261
130 3300049460 Ga0495682_0000651 Ga0495682_0000651_18426_19265 261
131 3300044684 Ga0466966_0000500 Ga0466966_0000500_9431_10294 262
132 3300044693 Ga0466961_0000167 Ga0466961_0000167_32502_33365 262
133 3300044712 Ga0453684_0000189 Ga0453684_0000189_215321_216109 262
134 3300044842 Ga0466957_0157010 Ga0466957_0157010_30_893 262
135 3300061719 Ga0466962_0012382 Ga0466962_0012382_1120_1983 262
136 3300005334 Ga0068869_100011828 Ga0068869_1000118284 263
137 3300005336 Ga0070680_100043500 Ga0070680_1000435003 263
138 3300005458 Ga0070681_10398785 Ga0070681_103987852 263
139 3300006846 Ga0075430_100045339 Ga0075430_1000453393 263
140 3300006880 Ga0075429_100002248 Ga0075429_1000022485 263
141 3300013100 Ga0157373_10000216 Ga0157373_1000021624 263
142 3300025914 Ga0207671_10250860 Ga0207671_102508602 263
143 3300025921 Ga0207652_10073181 Ga0207652_100731813 263
144 3300025942 Ga0207689_10050761 Ga0207689_100507612 263
145 3300046557 Ga0495622_0000309 Ga0495622_0000309_24461_25252 263
146 3300046674 Ga0495588_0000401 Ga0495588_0000401_9694_10485 263
147 3300048909 Ga0496106_0209691 Ga0496106_0209691_46_867 263
148 3300048921 Ga0496118_0200245 Ga0496118_0200245_12_830 263
149 3300049568 Ga0501031_0047349 Ga0501031_0047349_32_823 263
150 3300049569 Ga0501032_0115768 Ga0501032_0115768_813_1604 263
151 3300049573 Ga0501037_0104848 Ga0501037_0104848_32_823 263
152 3300049575 Ga0501039_0000240 Ga0501039_0000240_29654_30445 263
153 3300049577 Ga0501041_0050521 Ga0501041_0050521_657_1448 263
154 3300049579 Ga0501043_0176158 Ga0501043_0176158_755_1546 263
155 3300049580 Ga0501046_0003758 Ga0501046_0003758_4763_5554 263
156 3300014497 Ga0182008_10000455 Ga0182008_1000045514 264
157 3300046492 Ga0495585_0001746 Ga0495585_0001746_827_1645 264
158 3300050515 nmdc:mga0a205_23262_c1 nmdc:mga0a205_23262_c1_941_1771 264
159 3300041451 Ga0451791_1578584 Ga0451791_1578584_58_858 265
160 3300041494 Ga0451837_0607370 Ga0451837_0607370_1091_1891 265
161 3300032126 Ga0307415_100368937 Ga0307415_1003689372 266
162 3300042013 Ga0439456_000119 Ga0439456_000119_18361_19182 266
163 3300046525 Ga0495663_0002330 Ga0495663_0002330_4180_5076 266
164 3300046558 Ga0495633_0001105 Ga0495633_0001105_19203_20021 266
165 iso_pu_bacteria 2857537821 2857538029 266
166 3300006195 Ga0075366_10013980 Ga0075366_100139802 267
167 3300050493 nmdc:mga0k408_78_c1 nmdc:mga0k408_78_c1_44554_45408 267
168 iso_pu_bacteria 2929183550 2929189301 267
169 3300031727 Ga0316576_10009811 Ga0316576_100098112 268
170 3300036712 Ga0316584_0273659 Ga0316584_0273659_72_902 268
171 iso_pu_bacteria 2818991448 2819613362 268
172 iso_pu_bacteria 2969304461 2969308711 269
173 iso_pu_bacteria 8001522603 8001523593 269
174 iso_pu_bacteria 8029995093 8029996861 269
175 3300005616 Ga0068852_100984142 Ga0068852_1009841421 270
176 3300009036 Ga0105244_10051822 Ga0105244_100518222 270
177 3300025728 Ga0207655_1063669 Ga0207655_10636692 270
178 3300048919 Ga0496116_0052927 Ga0496116_0052927_879_1703 270
179 3300003794 Ga0055531_10018585 Ga0055531_100185852 271
180 3300025228 Ga0209672_103200 Ga0209672_1032002 271
181 3300025304 Ga0209257_1000067 Ga0209257_100006757 271
182 3300046516 Ga0495628_0371249 Ga0495628_0371249_202_1029 271
183 3300048929 Ga0496126_0011126 Ga0496126_0011126_4298_5113 271
184 3300053154 Ga0500619_000209 Ga0500619_000209_6350_7177 271
185 iso_pu_bacteria 2511231011 2511295207 271
186 iso_pu_bacteria 2599185239 2599739310 271
187 iso_pu_bacteria 2818991452 2819632693 271
188 iso_pu_bacteria 2818991456 2819655704 271
189 3300001979 JGI24740J21852_10000291 JGI24740J21852_100002919 272
190 3300006871 Ga0075434_100167874 Ga0075434_1001678742 272
191 3300006914 Ga0075436_100424313 Ga0075436_1004243131 272
192 3300007076 Ga0075435_100078418 Ga0075435_1000784182 272
193 3300009094 Ga0111539_10154137 Ga0111539_101541373 272
194 3300045051 Ga0451576_0085626 Ga0451576_0085626_1738_2559 272
195 3300050508 nmdc:mga09592_276322_c1 nmdc:mga09592_276322_c1_210_1031 272
196 3300050512 nmdc:mga0n895_79627_c1 nmdc:mga0n895_79627_c1_1665_2486 272
197 3300050513 nmdc:mga0rr50_582934_c1 nmdc:mga0rr50_582934_c1_93_914 272
198 3300050513 nmdc:mga0rr50_72956_c1 nmdc:mga0rr50_72956_c1_1361_2182 272
199 3300050515 nmdc:mga0a205_41781_c1 nmdc:mga0a205_41781_c1_3423_4244 272
200 iso_pu_bacteria 2808606395 2809033467 272
201 iso_pu_bacteria 2834641062 2834641330 272
202 iso_pu_bacteria 2852103415 2852107591 272
203 iso_pu_bacteria 2928170801 2928173197 272
204 iso_pu_bacteria 8021120328 8021122583 272
205 2124908027 MRS2a_Contig_414 MRS2a_00304640 273
206 2124908027 MRS2a_Contig_59 MRS2a_00460100 273
207 3300005288 Ga0065714_10002786 Ga0065714_1000278612 273
208 3300005530 Ga0070679_100128360 Ga0070679_1001283601 273
209 3300006173 Ga0070716_100046966 Ga0070716_1000469662 273
210 3300006846 Ga0075430_100034513 Ga0075430_1000345132 273
211 3300006852 Ga0075433_10023120 Ga0075433_100231204 273
212 3300006880 Ga0075429_100001966 Ga0075429_10000196612 273
213 3300009011 Ga0105251_10000955 Ga0105251_1000095512 273
214 3300009036 Ga0105244_10000477 Ga0105244_1000047727 273
215 3300009545 Ga0105237_10374952 Ga0105237_103749521 273
216 3300013104 Ga0157370_10001726 Ga0157370_100017266 273
217 3300013306 Ga0163162_10002451 Ga0163162_1000245112 273
218 3300025728 Ga0207655_1002120 Ga0207655_10021204 273
219 3300025735 Ga0207713_1000955 Ga0207713_100095512 273
220 3300025912 Ga0207707_10177426 Ga0207707_101774262 273
221 3300025937 Ga0207669_10215702 Ga0207669_102157022 273
222 3300025939 Ga0207665_10060426 Ga0207665_100604263 273
223 3300027364 Ga0209967_1005818 Ga0209967_10058182 273
224 3300031852 Ga0307410_10069118 Ga0307410_100691182 273
225 3300038443 Ga0395901_0645094 Ga0395901_0645094_96_917 273
226 3300041405 Ga0439438_003524 Ga0439438_003524_1439_2260 273
227 3300041407 Ga0439447_000802 Ga0439447_000802_4245_5141 273
228 3300041407 Ga0439447_008578 Ga0439447_008578_2004_2825 273
229 3300041411 Ga0439466_0000180 Ga0439466_0000180_6420_7316 273
230 3300041411 Ga0439466_0000299 Ga0439466_0000299_1316_2206 273
231 3300041411 Ga0439466_0014124 Ga0439466_0014124_654_1475 273
232 3300042006 Ga0439432_000090 Ga0439432_000090_18958_19854 273
233 3300042006 Ga0439432_023009 Ga0439432_023009_1196_2017 273
234 3300042009 Ga0439451_000034 Ga0439451_000034_7094_7915 273
235 3300042010 Ga0439452_000404 Ga0439452_000404_21873_22763 273
236 3300042013 Ga0439456_002854 Ga0439456_002854_1256_2077 273
237 3300042013 Ga0439456_010634 Ga0439456_010634_392_1282 273
238 3300042016 Ga0439463_000052 Ga0439463_000052_17706_18602 273
239 3300042145 Ga0450906_004520 Ga0450906_004520_856_1752 273
240 3300042146 Ga0450907_000214 Ga0450907_000214_11410_12306 273
241 3300042461 Ga0439460_0000021 Ga0439460_0000021_17834_18730 273
242 3300044712 Ga0453684_0033074 Ga0453684_0033074_2721_3587 273
243 3300046501 Ga0495607_0001105 Ga0495607_0001105_9481_10338 273
244 3300046523 Ga0495644_0065554 Ga0495644_0065554_52_909 273
245 3300046539 Ga0495621_0000203 Ga0495621_0000203_4073_4903 273
246 3300046542 Ga0495597_0000054 Ga0495597_0000054_44977_45807 273
247 3300046664 Ga0495659_0000930 Ga0495659_0000930_7835_8692 273
248 3300046665 Ga0495661_0001439 Ga0495661_0001439_5764_6621 273
249 3300046689 Ga0495613_0000648 Ga0495613_0000648_22899_23720 273
250 3300046691 Ga0495670_0000287 Ga0495670_0000287_13303_14160 273
251 3300046692 Ga0495671_0000500 Ga0495671_0000500_19910_20731 273
252 3300046794 Ga0495589_0001601 Ga0495589_0001601_6873_7694 273
253 3300048091 Ga0495626_0000843 Ga0495626_0000843_6751_7572 273
254 3300049460 Ga0495682_0024949 Ga0495682_0024949_523_1380 273
255 3300049655 Ga0501208_000468 Ga0501208_000468_449_1270 273
256 3300049683 Ga0501253_000120 Ga0501253_000120_3619_4449 273
257 3300050507 nmdc:mga05p37_61103_c1 nmdc:mga05p37_61103_c1_342_1172 273
258 3300050508 nmdc:mga09592_1058_c1 nmdc:mga09592_1058_c1_11704_12534 273
259 3300050509 nmdc:mga0qj67_209040_c1 nmdc:mga0qj67_209040_c1_455_1285 273
260 3300050515 nmdc:mga0a205_30219_c1 nmdc:mga0a205_30219_c1_35_865 273
261 iso_pu_bacteria 2643221554 2643791847 273
262 iso_pu_bacteria 2856287931 2856290341 273
263 iso_pu_bacteria 2857357740 2857362634 273
264 iso_pu_bacteria 642555112 642594105 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

71

284

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.9064 18 273
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.903 18 273
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.8792 18 271
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8786 18 271
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8749 18 273
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5827 70 266 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5128 71 264 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4617 76 273 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4478 70 266 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4011 71 264 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7C8AYH2-F1-model_v4 Transport permease protein 0.9874 1 273 GO:0015920
GO:0043190
GO:0140359
AF-A0A7C8AYH2-F1-model_v4 Transport permease protein 0.9838 1 273 GO:0015920
GO:0043190
GO:0140359
AF-J3GNX5-F1-model_v4 Transport permease protein 0.9828 1 273 GO:0015920
GO:0043190
GO:0140359
AF-A0A855NKY7-F1-model_v4 deleted 0.982 6 273
AF-A0A1I3RW86-F1-model_v4 Transport permease protein 0.9809 6 273 GO:0015920
GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
90.7 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map