F372658

General Info

Members Datasets Scaffolds Average Seq Length
264 190 528 229

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10496288|Ga0207662_104962881
Length 245
Sequence MKAAVLVFPGSNREGDVAQAIELVTGRRPQMIWHGDGDFEKTDLIVLPGGFSYGDYLRCGAMAAQSPVMAEVKKRAAQGVPVLAICNGFQIAAEAGLVPGVLMRNEKLKFICGDVHLKVETSQSLFTNRYQAGQVIKVPVAHAEGNYFAEPAVIAQLEADRQIIFRYTDASGEVVDAANPNGSKASIAGLCNEARNIVGLMPHPERACESILGSADGLAIFESAVAALKTGLFGGPSGSALQAVG

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
172 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
173 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
174 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
175 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
176 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
177 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
178 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
179 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
180 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
181 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
182 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
183 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
184 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
185 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
186 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
187 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
188 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
189 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
190 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.42
Metatranscriptomes 0
Isolates 7.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 3.79
Rhizoplane 0
Rhizosphere 74.24
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10496288 3300025918 Bacteria 840
2 JGI25151J46595_10083518 3300003187 Bacteria 915
3 JGI25406J46586_10000219 3300003203 Bacteria 25317
4 Ga0055535_1004887 3300003761 Bacteria 3104
5 Ga0055541_1001293 3300003841 Bacteria 5490
6 Ga0070658_10008327 3300005327 Bacteria 8339
7 Ga0070676_10102271 3300005328 Bacteria 1772
8 Ga0070690_100461373 3300005330 Bacteria 944
9 Ga0070670_100202793 3300005331 Bacteria 1724
10 Ga0070666_10010654 3300005335 Bacteria 5756
11 Ga0070680_100015841 3300005336 Bacteria 5918
12 Ga0070680_100522819 3300005336 Bacteria 1016
13 Ga0070682_100296567 3300005337 Bacteria 1184
14 Ga0070689_100565925 3300005340 Bacteria 981
15 Ga0070691_10160120 3300005341 Bacteria 1160
16 Ga0070668_100145528 3300005347 Bacteria 1913
17 Ga0070674_100202871 3300005356 Bacteria 1532
18 Ga0070688_100316234 3300005365 Bacteria 1133
19 Ga0070659_100599583 3300005366 Bacteria 946
20 Ga0070713_100098663 3300005436 Bacteria 2526
21 Ga0070710_10122507 3300005437 Bacteria 1575
22 Ga0070701_10216630 3300005438 Bacteria 1140
23 Ga0070708_100701296 3300005445 Bacteria 953
24 Ga0070678_100212458 3300005456 Bacteria 1604
25 Ga0070681_10029061 3300005458 Bacteria 5550
26 Ga0070685_10024538 3300005466 Bacteria 3313
27 Ga0070706_100347490 3300005467 Bacteria 1382
28 Ga0070698_100015620 3300005471 Bacteria 8018
29 Ga0070699_100057798 3300005518 Bacteria 3359
30 Ga0070679_100002889 3300005530 Bacteria 15609
31 Ga0070697_100072310 3300005536 Bacteria 2830
32 Ga0068853_100443856 3300005539 Bacteria 1220
33 Ga0070665_100002041 3300005548 Bacteria 22725
34 Ga0070665_100036248 3300005548 Bacteria 4962
35 Ga0070665_100044210 3300005548 Bacteria 4473
36 Ga0070665_100493404 3300005548 Bacteria 1236
37 Ga0070665_100549037 3300005548 Bacteria 1167
38 Ga0068855_100498471 3300005563 Bacteria 1323
39 Ga0068857_100041147 3300005577 Bacteria 4098
40 Ga0068856_100025379 3300005614 Bacteria 5779
41 Ga0068856_100219317 3300005614 Bacteria 1917
42 Ga0068852_100089471 3300005616 Bacteria 2752
43 Ga0068852_100250718 3300005616 Bacteria 1696
44 Ga0068852_100436752 3300005616 Bacteria 1293
45 Ga0068859_100181338 3300005617 Bacteria 2188
46 Ga0068864_100258895 3300005618 Bacteria 1618
47 Ga0068860_100001632 3300005843 Bacteria 24029
48 Ga0068860_100015356 3300005843 Bacteria 7481
49 Ga0068860_100317506 3300005843 Bacteria 1529
50 Ga0068862_100182252 3300005844 Bacteria 1885
51 Ga0081455_10000434 3300005937 Bacteria 54939
52 Ga0081455_10002143 3300005937 Bacteria 23543
53 Ga0081455_10007176 3300005937 Bacteria 11778
54 Ga0081539_10000207 3300005985 Bacteria 136970
55 Ga0081539_10009772 3300005985 Bacteria 7934
56 Ga0081539_10011462 3300005985 Bacteria 7001
57 Ga0075365_10029237 3300006038 Bacteria 3520
58 Ga0075365_10326099 3300006038 Bacteria 1081
59 Ga0075368_10124368 3300006042 Bacteria 1069
60 Ga0075362_10029282 3300006177 Bacteria 2372
61 Ga0075362_10052564 3300006177 Bacteria 1826
62 Ga0075362_10122617 3300006177 Bacteria 1231
63 Ga0075367_10221399 3300006178 Bacteria 1184
64 Ga0075367_10378253 3300006178 Bacteria 895
65 Ga0075369_10000336 3300006186 Bacteria 14025
66 Ga0075366_10013866 3300006195 Bacteria 4594
67 Ga0075366_10091553 3300006195 Bacteria 1821
68 Ga0075366_10188225 3300006195 Bacteria 1254
69 Ga0075431_100598402 3300006847 Bacteria 1087
70 Ga0075434_100009006 3300006871 Bacteria 9298
71 Ga0068865_100082298 3300006881 Bacteria 2314
72 Ga0075436_100005370 3300006914 Bacteria 8820
73 Ga0097620_100181331 3300006931 Bacteria 2188
74 Ga0097620_100256367 3300006931 Bacteria 1840
75 Ga0105240_10346169 3300009093 Bacteria 1687
76 Ga0111539_10544564 3300009094 Bacteria 1352
77 Ga0114129_10590848 3300009147 Bacteria 1440
78 Ga0105243_10549941 3300009148 Bacteria 1103
79 Ga0105241_10634333 3300009174 Bacteria 969
80 Ga0105241_10660131 3300009174 Bacteria 951
81 Ga0105248_10936393 3300009177 Bacteria 978
82 Ga0105237_10186207 3300009545 Bacteria 2076
83 Ga0105237_10467239 3300009545 Bacteria 1268
84 Ga0105238_10001577 3300009551 Bacteria 22832
85 Ga0105238_10272840 3300009551 Bacteria 1672
86 Ga0105238_10473689 3300009551 Bacteria 1251
87 Ga0105249_10514479 3300009553 Bacteria 1244
88 Ga0105035_107265 3300009988 Bacteria 930
89 Ga0105239_10212405 3300010375 Bacteria 2169
90 Ga0157370_10009458 3300013104 Bacteria 10410
91 Ga0157369_10038152 3300013105 Bacteria 5254
92 Ga0157369_10197245 3300013105 Bacteria 2113
93 Ga0163162_10783964 3300013306 Bacteria 1071
94 Ga0157372_10363751 3300013307 Bacteria 1686
95 Ga0157375_10785570 3300013308 Bacteria 1101
96 Ga0163163_10544599 3300014325 Bacteria 1223
97 Ga0182008_10180163 3300014497 Bacteria 1069
98 Ga0213876_10021715 3300021384 Bacteria 3395
99 Ga0213876_10133145 3300021384 Bacteria 1322
100 Ga0213871_10006183 3300021441 Bacteria 2520
101 Ga0209566_100126 3300025225 Bacteria 94445
102 Ga0209025_1017865 3300025294 Bacteria 4064
103 Ga0209025_1022468 3300025294 Bacteria 3341
104 Ga0207692_10062829 3300025898 Bacteria 1928
105 Ga0207680_10249545 3300025903 Bacteria 1225
106 Ga0207647_10113892 3300025904 Bacteria 1598
107 Ga0207705_10041156 3300025909 Bacteria 3314
108 Ga0207705_10080570 3300025909 Bacteria 2372
109 Ga0207654_10401028 3300025911 Bacteria 954
110 Ga0207707_10013882 3300025912 Bacteria 7024
111 Ga0207695_10067173 3300025913 Bacteria 3679
112 Ga0207695_10249637 3300025913 Bacteria 1674
113 Ga0207695_10522547 3300025913 Bacteria 1069
114 Ga0207693_10166805 3300025915 Bacteria 1734
115 Ga0207660_10035823 3300025917 Bacteria 3447
116 Ga0207662_10479674 3300025918 Bacteria 854
117 Ga0207652_10027622 3300025921 Bacteria 4729
118 Ga0207681_10070672 3300025923 Bacteria 2432
119 Ga0207694_10003346 3300025924 Bacteria 12758
120 Ga0207644_10135246 3300025931 Bacteria 1892
121 Ga0207690_10208686 3300025932 Bacteria 1488
122 Ga0207686_10057773 3300025934 Bacteria 2444
123 Ga0207670_10268145 3300025936 Bacteria 1326
124 Ga0207704_10090676 3300025938 Bacteria 2007
125 Ga0207661_10878856 3300025944 Bacteria 825
126 Ga0207679_10229242 3300025945 Bacteria 1567
127 Ga0207674_10032698 3300026116 Bacteria 5453
128 Ga0207674_10190346 3300026116 Bacteria 2001
129 Ga0207683_10232883 3300026121 Bacteria 1680
130 Ga0207698_10474666 3300026142 Bacteria 1212
131 Ga0268266_10001996 3300028379 Bacteria 22830
132 Ga0268266_10009478 3300028379 Bacteria 8567
133 Ga0268266_10186323 3300028379 Bacteria 1892
134 Ga0268266_10346541 3300028379 Bacteria 1395
135 Ga0268266_10850555 3300028379 Bacteria 882
136 Ga0268265_10688481 3300028380 Bacteria 986
137 Ga0268264_10001466 3300028381 Bacteria 22037
138 Ga0316576_10023481 3300031727 Bacteria 4296
139 Ga0307516_10335911 3300031730 Bacteria 1179
140 Ga0307410_10527151 3300031852 Bacteria 976
141 Ga0307412_10452619 3300031911 Bacteria 1058
142 Ga0307415_100411968 3300032126 Bacteria 1157
143 Ga0316583_10096292 3300032133 Bacteria 1032
144 Ga0373923_0059864 3300035111 Bacteria 1615
145 Ga0373941_0151644 3300035115 Bacteria 851
146 Ga0316574_0151000 3300035398 Bacteria 1497
147 Ga0373935_0373484 3300035692 Bacteria 1020
148 Ga0373947_0335811 3300035725 Bacteria 1012
149 Ga0373937_0317985 3300036401 Bacteria 1473
150 Ga0316584_0005789 3300036712 Bacteria 8336
151 Ga0395899_0027167 3300037312 Bacteria 4317
152 Ga0395899_0075637 3300037312 Bacteria 2458
153 Ga0395899_0134515 3300037312 Bacteria 1763
154 Ga0395899_0178224 3300037312 Bacteria 1493
155 Ga0395900_0035147 3300037418 Bacteria 5162
156 Ga0395900_0038828 3300037418 Bacteria 4908
157 Ga0395900_0102804 3300037418 Bacteria 2935
158 Ga0395900_0247013 3300037418 Bacteria 1787
159 Ga0395898_0016415 3300037466 Bacteria 7578
160 Ga0395898_0030276 3300037466 Bacteria 5417
161 Ga0395901_0001851 3300038443 Bacteria 21879
162 Ga0395901_0008119 3300038443 Bacteria 10600
163 Ga0395901_0034540 3300038443 Bacteria 5222
164 Ga0395901_0055930 3300038443 Bacteria 4104
165 Ga0395901_0076455 3300038443 Bacteria 3493
166 Ga0400483_012628 3300039062 Bacteria 3065
167 Ga0400483_052111 3300039062 Bacteria 2721
168 Ga0400483_149301 3300039062 Bacteria 4392
169 Ga0436365_0376694 3300039437 Bacteria 6274
170 Ga0436365_0672716 3300039437 Bacteria 2585
171 Ga0436365_1360918 3300039437 Bacteria 2123
172 Ga0436360_0369505 3300039438 Bacteria 4319
173 Ga0436360_0730862 3300039438 Bacteria 1074
174 Ga0436360_1264475 3300039438 Bacteria 2587
175 Ga0436361_0171581 3300039447 Bacteria 898
176 Ga0436361_0388962 3300039447 Bacteria 3113
177 Ga0436361_1163612 3300039447 Bacteria 1508
178 Ga0436363_0362619 3300039450 Bacteria 1386
179 Ga0436362_0677078 3300039453 Bacteria 1068
180 Ga0439459_0039049 3300042438 Bacteria 1001
181 Ga0466965_0387277 3300044683 Bacteria 771
182 Ga0466963_0174923 3300044694 Bacteria 1497
183 Ga0466963_0360648 3300044694 Bacteria 1024
184 Ga0466957_0363101 3300044842 Bacteria 984
185 Ga0466960_0287310 3300044901 Bacteria 923
186 Ga0451576_0001200 3300045051 Bacteria 46344
187 Ga0466967_0082808 3300045976 Bacteria 2900
188 Ga0495617_119140 3300046452 Bacteria 851
189 Ga0495608_0332007 3300046511 Bacteria 938
190 Ga0495635_0109208 3300046663 Bacteria 1890
191 Ga0495657_0134658 3300046675 Bacteria 1545
192 Ga0495669_0136956 3300046684 Bacteria 1155
193 Ga0495684_0048400 3300047471 Bacteria 3251
194 Ga0495602_0070082 3300048088 Bacteria 3003
195 Ga0495626_0128531 3300048091 Bacteria 1084
196 Ga0496119_0003988 3300048922 Bacteria 14944
197 Ga0496126_0694911 3300048929 Bacteria 791
198 Ga0501032_0169566 3300049569 Bacteria 1432
199 Ga0501033_0026408 3300049570 Bacteria 4372
200 Ga0501033_0045085 3300049570 Bacteria 3282
201 Ga0501033_0083345 3300049570 Bacteria 2344
202 Ga0501033_0444818 3300049570 Bacteria 901
203 Ga0501034_0004242 3300049571 Bacteria 15992
204 Ga0501034_0037546 3300049571 Bacteria 4905
205 Ga0501034_0082176 3300049571 Unclassified 3224
206 Ga0501034_0418246 3300049571 Bacteria 1262
207 Ga0501036_0297230 3300049572 Bacteria 1351
208 Ga0501036_0374384 3300049572 Bacteria 1189
209 Ga0501037_0415800 3300049573 Bacteria 921
210 Ga0501040_0325473 3300049576 Bacteria 1100
211 Ga0501043_0493724 3300049579 Bacteria 915
212 Ga0501046_0332035 3300049580 Bacteria 1106
213 Ga0501047_0430425 3300049581 Bacteria 1150
214 Ga0501047_0680678 3300049581 Bacteria 847
215 Ga0501068_0244956 3300049584 Bacteria 1141
216 Ga0501070_0072638 3300049586 Bacteria 2848
217 Ga0501072_0476030 3300049588 Bacteria 988
218 Ga0501083_0023099 3300049744 Bacteria 4315
219 Ga0501035_0043153 3300049822 Bacteria 4065
220 Ga0501035_0104550 3300049822 Bacteria 2483
221 Ga0501044_0101315 3300049823 Bacteria 2897
222 Ga0501044_0117070 3300049823 Bacteria 2669
223 nmdc:mga03683_27877_c1 3300050489 Bacteria 2241
224 nmdc:mga03683_98994_c1 3300050489 Bacteria 1280
225 nmdc:mga0yw44_65149_c1 3300050492 Bacteria 2245
226 nmdc:mga0yw44_99739_c1 3300050492 Bacteria 1848
227 nmdc:mga0k408_263206_c1 3300050493 Bacteria 1030
228 nmdc:mga0k408_42473_c2 3300050493 Bacteria 2002
229 nmdc:mga06z11_347000_c1 3300050494 Bacteria 888
230 nmdc:mga06z11_69100_c1 3300050494 Bacteria 1864
231 nmdc:mga07m45_48677_c1 3300050496 Bacteria 2384
232 nmdc:mga0sz30_41844_c1 3300050516 Bacteria 1525
233 nmdc:mga0sz30_4363_c1 3300050516 Bacteria 5108
234 Ga0500646_0062843 3300053090 Bacteria 1097
235 Ga0500647_0029848 3300053091 Bacteria 2588
236 Ga0500647_0032251 3300053091 Bacteria 2496
237 Ga0500651_0269936 3300053093 Bacteria 984
238 Ga0500641_0089335 3300053096 Bacteria 1314
239 Ga0500595_056680 3300053119 Bacteria 1196
240 Ga0500658_0243289 3300053134 Bacteria 826
241 Ga0500568_0003910 3300053139 Bacteria 8106
242 Ga0500616_0003394 3300053153 Bacteria 12221
243 Ga0500616_0047233 3300053153 Bacteria 2286
244 Ga0530510_0206537 3300061734 Bacteria 1459
245 2513878047 2513237139 Bacteria 8737671
246 2514012655 2513237161 Bacteria 8871253
247 2617352570 2617270735 Bacteria 9163226
248 2805920007 2802429603 Bacteria 8777136
249 2824674272 2824671348 Bacteria 8369588
250 2824690894 2824687955 Bacteria 8360029
251 2824778207 2824773399 Bacteria 8360218
252 2838127459 2838122688 Bacteria 8803140
253 2841941587 2841941048 Bacteria 8688029
254 2841952396 2841949485 Bacteria 8680857
255 2841967733 2841966195 Bacteria 8673214
256 2841982104 2841974524 Bacteria 8931498
257 2841986420 2841983080 Bacteria 8395090
258 2842777951 2842775625 Bacteria 5587290
259 2847945052 2847939898 Bacteria 8606328
260 2883578433 2883577096 Bacteria 4709178
261 2894774394 2894772417 Bacteria 5305674
262 2929204056 2929199973 Bacteria 7260745
263 8055911414 8055909800 Bacteria 7278581
264 8057736573 8057733483 Bacteria 6578323
265 Ga0207662_10496288
266 JGI25151J46595_10083518
267 JGI25406J46586_10000219
268 Ga0055535_1004887
269 Ga0055541_1001293
270 Ga0070658_10008327
271 Ga0070676_10102271
272 Ga0070690_100461373
273 Ga0070670_100202793
274 Ga0070666_10010654
275 Ga0070680_100015841
276 Ga0070680_100522819
277 Ga0070682_100296567
278 Ga0070689_100565925
279 Ga0070691_10160120
280 Ga0070668_100145528
281 Ga0070674_100202871
282 Ga0070688_100316234
283 Ga0070659_100599583
284 Ga0070713_100098663
285 Ga0070710_10122507
286 Ga0070701_10216630
287 Ga0070708_100701296
288 Ga0070678_100212458
289 Ga0070681_10029061
290 Ga0070685_10024538
291 Ga0070706_100347490
292 Ga0070698_100015620
293 Ga0070699_100057798
294 Ga0070679_100002889
295 Ga0070697_100072310
296 Ga0068853_100443856
297 Ga0070665_100002041
298 Ga0070665_100036248
299 Ga0070665_100044210
300 Ga0070665_100493404
301 Ga0070665_100549037
302 Ga0068855_100498471
303 Ga0068857_100041147
304 Ga0068856_100025379
305 Ga0068856_100219317
306 Ga0068852_100089471
307 Ga0068852_100250718
308 Ga0068852_100436752
309 Ga0068859_100181338
310 Ga0068864_100258895
311 Ga0068860_100001632
312 Ga0068860_100015356
313 Ga0068860_100317506
314 Ga0068862_100182252
315 Ga0081455_10000434
316 Ga0081455_10002143
317 Ga0081455_10007176
318 Ga0081539_10000207
319 Ga0081539_10009772
320 Ga0081539_10011462
321 Ga0075365_10029237
322 Ga0075365_10326099
323 Ga0075368_10124368
324 Ga0075362_10029282
325 Ga0075362_10052564
326 Ga0075362_10122617
327 Ga0075367_10221399
328 Ga0075367_10378253
329 Ga0075369_10000336
330 Ga0075366_10013866
331 Ga0075366_10091553
332 Ga0075366_10188225
333 Ga0075431_100598402
334 Ga0075434_100009006
335 Ga0068865_100082298
336 Ga0075436_100005370
337 Ga0097620_100181331
338 Ga0097620_100256367
339 Ga0105240_10346169
340 Ga0111539_10544564
341 Ga0114129_10590848
342 Ga0105243_10549941
343 Ga0105241_10634333
344 Ga0105241_10660131
345 Ga0105248_10936393
346 Ga0105237_10186207
347 Ga0105237_10467239
348 Ga0105238_10001577
349 Ga0105238_10272840
350 Ga0105238_10473689
351 Ga0105249_10514479
352 Ga0105035_107265
353 Ga0105239_10212405
354 Ga0157370_10009458
355 Ga0157369_10038152
356 Ga0157369_10197245
357 Ga0163162_10783964
358 Ga0157372_10363751
359 Ga0157375_10785570
360 Ga0163163_10544599
361 Ga0182008_10180163
362 Ga0213876_10021715
363 Ga0213876_10133145
364 Ga0213871_10006183
365 Ga0209566_100126
366 Ga0209025_1017865
367 Ga0209025_1022468
368 Ga0207692_10062829
369 Ga0207680_10249545
370 Ga0207647_10113892
371 Ga0207705_10041156
372 Ga0207705_10080570
373 Ga0207654_10401028
374 Ga0207707_10013882
375 Ga0207695_10067173
376 Ga0207695_10249637
377 Ga0207695_10522547
378 Ga0207693_10166805
379 Ga0207660_10035823
380 Ga0207662_10479674
381 Ga0207652_10027622
382 Ga0207681_10070672
383 Ga0207694_10003346
384 Ga0207644_10135246
385 Ga0207690_10208686
386 Ga0207686_10057773
387 Ga0207670_10268145
388 Ga0207704_10090676
389 Ga0207661_10878856
390 Ga0207679_10229242
391 Ga0207674_10032698
392 Ga0207674_10190346
393 Ga0207683_10232883
394 Ga0207698_10474666
395 Ga0268266_10001996
396 Ga0268266_10009478
397 Ga0268266_10186323
398 Ga0268266_10346541
399 Ga0268266_10850555
400 Ga0268265_10688481
401 Ga0268264_10001466
402 Ga0316576_10023481
403 Ga0307516_10335911
404 Ga0307410_10527151
405 Ga0307412_10452619
406 Ga0307415_100411968
407 Ga0316583_10096292
408 Ga0373923_0059864
409 Ga0373941_0151644
410 Ga0316574_0151000
411 Ga0373935_0373484
412 Ga0373947_0335811
413 Ga0373937_0317985
414 Ga0316584_0005789
415 Ga0395899_0027167
416 Ga0395899_0075637
417 Ga0395899_0134515
418 Ga0395899_0178224
419 Ga0395900_0035147
420 Ga0395900_0038828
421 Ga0395900_0102804
422 Ga0395900_0247013
423 Ga0395898_0016415
424 Ga0395898_0030276
425 Ga0395901_0001851
426 Ga0395901_0008119
427 Ga0395901_0034540
428 Ga0395901_0055930
429 Ga0395901_0076455
430 Ga0400483_012628
431 Ga0400483_052111
432 Ga0400483_149301
433 Ga0436365_0376694
434 Ga0436365_0672716
435 Ga0436365_1360918
436 Ga0436360_0369505
437 Ga0436360_0730862
438 Ga0436360_1264475
439 Ga0436361_0171581
440 Ga0436361_0388962
441 Ga0436361_1163612
442 Ga0436363_0362619
443 Ga0436362_0677078
444 Ga0439459_0039049
445 Ga0466965_0387277
446 Ga0466963_0174923
447 Ga0466963_0360648
448 Ga0466957_0363101
449 Ga0466960_0287310
450 Ga0451576_0001200
451 Ga0466967_0082808
452 Ga0495617_119140
453 Ga0495608_0332007
454 Ga0495635_0109208
455 Ga0495657_0134658
456 Ga0495669_0136956
457 Ga0495684_0048400
458 Ga0495602_0070082
459 Ga0495626_0128531
460 Ga0496119_0003988
461 Ga0496126_0694911
462 Ga0501032_0169566
463 Ga0501033_0026408
464 Ga0501033_0045085
465 Ga0501033_0083345
466 Ga0501033_0444818
467 Ga0501034_0004242
468 Ga0501034_0037546
469 Ga0501034_0082176
470 Ga0501034_0418246
471 Ga0501036_0297230
472 Ga0501036_0374384
473 Ga0501037_0415800
474 Ga0501040_0325473
475 Ga0501043_0493724
476 Ga0501046_0332035
477 Ga0501047_0430425
478 Ga0501047_0680678
479 Ga0501068_0244956
480 Ga0501070_0072638
481 Ga0501072_0476030
482 Ga0501083_0023099
483 Ga0501035_0043153
484 Ga0501035_0104550
485 Ga0501044_0101315
486 Ga0501044_0117070
487 nmdc:mga03683_27877_c1
488 nmdc:mga03683_98994_c1
489 nmdc:mga0yw44_65149_c1
490 nmdc:mga0yw44_99739_c1
491 nmdc:mga0k408_263206_c1
492 nmdc:mga0k408_42473_c2
493 nmdc:mga06z11_347000_c1
494 nmdc:mga06z11_69100_c1
495 nmdc:mga07m45_48677_c1
496 nmdc:mga0sz30_41844_c1
497 nmdc:mga0sz30_4363_c1
498 Ga0500646_0062843
499 Ga0500647_0029848
500 Ga0500647_0032251
501 Ga0500651_0269936
502 Ga0500641_0089335
503 Ga0500595_056680
504 Ga0500658_0243289
505 Ga0500568_0003910
506 Ga0500616_0003394
507 Ga0500616_0047233
508 Ga0530510_0206537
509 2513878047
510 2514012655
511 2617352570
512 2805920007
513 2824674272
514 2824690894
515 2824778207
516 2838127459
517 2841941587
518 2841952396
519 2841967733
520 2841982104
521 2841986420
522 2842777951
523 2847945052
524 2883578433
525 2894774394
526 2929204056
527 8055911414
528 8057736573

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

1

225

0.91

PF01965

DJ-1_PfpI

DJ-1/PfpI family

28

104

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9404 2 216
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9189 2 216
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8663 2 214
4l78-assembly1.cif.gz_A xenon trapping and statistical coupling analysis uncover regions important for structure and function of multidomain protein stpurl 0.866 2 214
4lgy-assembly1.cif.gz_A importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis 0.8628 2 214
ID Description Score Start End Superfamily
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9593 1 217 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9568 2 215 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9562 1 215 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9465 1 217 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.941 2 216 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1I7LA57-F1-model_v4 Multifunctional fusion protein [Includes: Phosphoribosylformylglycinamidine synthase subunit PurL (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit II) (Glutamine amidotransferase PurL) (Phosphoribosylformylglycinamidine synthase subunit II) (FGAR amidotransferase II) (FGAR-AT II); Phosphoribosylformylglycinamidine synthase subunit PurQ (Formylglycinamide ribonucleotide amidotransferase subunit I) (Glutaminase PurQ) (Phosphoribosylformylglycinamidine synthase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (EC 3.5.1.2)] 0.9774 1 215 GO:0000287
GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
AF-A0A2V8MWT8-F1-model_v4 Multifunctional fusion protein [Includes: Phosphoribosylformylglycinamidine synthase subunit PurL (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit II) (Glutamine amidotransferase PurL) (Phosphoribosylformylglycinamidine synthase subunit II) (FGAR amidotransferase II) (FGAR-AT II); Phosphoribosylformylglycinamidine synthase subunit PurQ (Formylglycinamide ribonucleotide amidotransferase subunit I) (Glutaminase PurQ) (Phosphoribosylformylglycinamidine synthase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (EC 3.5.1.2)] 0.9752 1 222 GO:0000287
GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A0N0I5B5-F1-model_v4 deleted 0.9745 69 224
AF-Q3EWN9-F1-model_v4 deleted 0.9737 69 224
AF-A0A1D4RLC1-F1-model_v4 Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) 0.9736 63 220 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787

Map