F372419

General Info

Members Datasets Scaffolds Average Seq Length
264 193 528 101

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10302214|Ga0070709_103022143
Length 117
Sequence VGRVRAGLTGVATSASIRLDLDVVRALASEKRLLILEWLKDPVAHFPPQKDGDLVKDGVCSVFIADKLGVSQPTAGEHLQVLSRAGLIRGKRVKQWVYYQRVEPRIRQAKRALNGAW

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
135 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
143 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
177 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
180 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
183 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
186 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
191 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
192 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
193 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 0
Rhizoplane 1.14
Rhizosphere 81.06
Stem 0
Stem Tuber 0
Unclassified 13.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10302214 3300005434 Bacteria 1169
2 JGI25153J46596_10000047 3300003215 Bacteria 146400
3 Ga0055536_1001142 3300003781 Bacteria 16627
4 Ga0055530_10121818 3300003791 Unclassified 505
5 Ga0065704_10289957 3300005289 Bacteria 905
6 Ga0070658_10604876 3300005327 Unclassified 950
7 Ga0070666_11042145 3300005335 Unclassified 607
8 Ga0070680_100140103 3300005336 Unclassified 2028
9 Ga0068868_100080724 3300005338 Bacteria 2607
10 Ga0070660_100290905 3300005339 Bacteria 1338
11 Ga0070660_101412255 3300005339 Unclassified 591
12 Ga0070689_101556523 3300005340 Unclassified 600
13 Ga0070675_100187500 3300005354 Bacteria 1791
14 Ga0070673_101945554 3300005364 Unclassified 558
15 Ga0070709_10306187 3300005434 Bacteria 1162
16 Ga0070709_11132852 3300005434 Unclassified 627
17 Ga0070714_100013165 3300005435 Bacteria 6624
18 Ga0070714_100063978 3300005435 Bacteria 3165
19 Ga0070714_100411465 3300005435 Bacteria 1280
20 Ga0070714_100538250 3300005435 Bacteria 1117
21 Ga0070714_100575813 3300005435 Bacteria 1080
22 Ga0070713_100004860 3300005436 Bacteria 9109
23 Ga0070713_100029667 3300005436 Bacteria 4334
24 Ga0070713_100082460 3300005436 Bacteria 2746
25 Ga0070710_10000652 3300005437 Bacteria 16517
26 Ga0070711_100034228 3300005439 Bacteria 3388
27 Ga0070711_100179328 3300005439 Bacteria 1621
28 Ga0070700_101016252 3300005441 Unclassified 682
29 Ga0070708_100087127 3300005445 Bacteria 2837
30 Ga0070708_100253054 3300005445 Bacteria 1655
31 Ga0070681_10022333 3300005458 Bacteria 6353
32 Ga0068867_100225349 3300005459 Unclassified 1513
33 Ga0070706_100502627 3300005467 Bacteria 1128
34 Ga0070707_100079078 3300005468 Bacteria 3173
35 Ga0070698_100099793 3300005471 Bacteria 2876
36 Ga0070698_101664100 3300005471 Unclassified 590
37 Ga0070699_100843890 3300005518 Bacteria 839
38 Ga0070699_101035596 3300005518 Bacteria 753
39 Ga0070679_100137073 3300005530 Bacteria 2428
40 Ga0070684_101227297 3300005535 Unclassified 705
41 Ga0070697_101846600 3300005536 Bacteria 541
42 Ga0068853_100592578 3300005539 Bacteria 1052
43 Ga0068853_102020847 3300005539 Unclassified 559
44 Ga0070672_100140251 3300005543 Bacteria 1993
45 Ga0070686_100816106 3300005544 Unclassified 753
46 Ga0068857_100242196 3300005577 Bacteria 1652
47 Ga0068856_100104820 3300005614 Bacteria 2822
48 Ga0070702_101169442 3300005615 Bacteria 618
49 Ga0068852_101222887 3300005616 Unclassified 772
50 Ga0068859_100185865 3300005617 Bacteria 2162
51 Ga0068859_102369122 3300005617 Unclassified 585
52 Ga0068861_100026214 3300005719 Bacteria 4237
53 Ga0068863_100258806 3300005841 Unclassified 1682
54 Ga0068858_100012329 3300005842 Bacteria 8059
55 Ga0068860_100129984 3300005843 Bacteria 2416
56 Ga0068862_100003378 3300005844 Bacteria 13767
57 Ga0081455_10246519 3300005937 Bacteria 1309
58 Ga0070717_10203148 3300006028 Bacteria 1736
59 Ga0070717_11045209 3300006028 Bacteria 744
60 Ga0070717_11054887 3300006028 Unclassified 740
61 Ga0070716_100005932 3300006173 Bacteria 5945
62 Ga0070716_100039411 3300006173 Bacteria 2622
63 Ga0070716_100355995 3300006173 Bacteria 1038
64 Ga0070712_100021746 3300006175 Bacteria 4217
65 Ga0070712_100042772 3300006175 Bacteria 3116
66 Ga0070712_100224153 3300006175 Bacteria 1490
67 Ga0070712_100444055 3300006175 Bacteria 1079
68 Ga0070712_100613614 3300006175 Bacteria 922
69 Ga0075370_10053969 3300006353 Bacteria 2281
70 Ga0075430_100603541 3300006846 Bacteria 906
71 Ga0068865_100096593 3300006881 Bacteria 2155
72 Ga0075436_100298748 3300006914 Bacteria 1154
73 Ga0075436_101055859 3300006914 Bacteria 611
74 Ga0097620_100185878 3300006931 Bacteria 2162
75 Ga0097620_102369840 3300006931 Unclassified 585
76 Ga0099794_10001364 3300007265 Bacteria 8494
77 Ga0105245_10419779 3300009098 Unclassified 1341
78 Ga0105247_11778453 3300009101 Bacteria 512
79 Ga0105243_10553209 3300009148 Unclassified 1100
80 Ga0105242_10255607 3300009176 Bacteria 1580
81 Ga0105248_10202050 3300009177 Bacteria 2239
82 Ga0105237_10010393 3300009545 Bacteria 9907
83 Ga0105238_11170278 3300009551 Unclassified 793
84 Ga0105239_10025023 3300010375 Bacteria 6576
85 Ga0105239_10612316 3300010375 Bacteria 1243
86 Ga0105246_10071678 3300011119 Bacteria 2440
87 Ga0157374_10039788 3300013296 Bacteria 4328
88 Ga0157378_10084851 3300013297 Bacteria 2868
89 Ga0157378_10148862 3300013297 Bacteria 2180
90 Ga0163162_10311739 3300013306 Bacteria 1706
91 Ga0157372_10112496 3300013307 Bacteria 3119
92 Ga0157375_10041759 3300013308 Bacteria 4431
93 Ga0157379_10094537 3300014968 Bacteria 2682
94 Ga0157376_10040823 3300014969 Bacteria 3794
95 Ga0157376_11017246 3300014969 Unclassified 852
96 Ga0209676_1000276 3300025292 Bacteria 106867
97 Ga0209758_1000070 3300025297 Bacteria 284093
98 Ga0209758_1012594 3300025297 Bacteria 4715
99 Ga0209050_1042266 3300025298 Bacteria 1246
100 Ga0207692_10000106 3300025898 Bacteria 24772
101 Ga0207642_10269405 3300025899 Bacteria 974
102 Ga0207647_10014550 3300025904 Bacteria 5422
103 Ga0207699_10001616 3300025906 Bacteria 10688
104 Ga0207699_10663455 3300025906 Bacteria 762
105 Ga0207699_11305067 3300025906 Unclassified 537
106 Ga0207705_10347831 3300025909 Bacteria 1142
107 Ga0207684_10146393 3300025910 Bacteria 2032
108 Ga0207684_10556714 3300025910 Bacteria 981
109 Ga0207684_11633273 3300025910 Bacteria 521
110 Ga0207707_11363474 3300025912 Bacteria 567
111 Ga0207693_10002866 3300025915 Bacteria 14942
112 Ga0207693_10068295 3300025915 Bacteria 2782
113 Ga0207693_10353254 3300025915 Bacteria 1150
114 Ga0207663_10007836 3300025916 Bacteria 5563
115 Ga0207663_10250730 3300025916 Bacteria 1303
116 Ga0207663_10304279 3300025916 Bacteria 1192
117 Ga0207660_10080000 3300025917 Bacteria 2398
118 Ga0207657_10288252 3300025919 Bacteria 1302
119 Ga0207652_10026675 3300025921 Bacteria 4814
120 Ga0207646_10181179 3300025922 Bacteria 1903
121 Ga0207646_10704882 3300025922 Bacteria 902
122 Ga0207646_10933159 3300025922 Bacteria 769
123 Ga0207700_10000126 3300025928 Bacteria 45263
124 Ga0207700_10028349 3300025928 Bacteria 3935
125 Ga0207700_10028810 3300025928 Bacteria 3912
126 Ga0207664_10000148 3300025929 Bacteria 57411
127 Ga0207664_10012292 3300025929 Bacteria 6116
128 Ga0207664_10368179 3300025929 Bacteria 1274
129 Ga0207664_10429421 3300025929 Bacteria 1178
130 Ga0207664_10901064 3300025929 Bacteria 794
131 Ga0207664_11002533 3300025929 Bacteria 748
132 Ga0207709_11621933 3300025935 Bacteria 537
133 Ga0207670_11334268 3300025936 Unclassified 609
134 Ga0207704_10059620 3300025938 Bacteria 2357
135 Ga0207665_10010756 3300025939 Bacteria 6009
136 Ga0207665_10106574 3300025939 Bacteria 1964
137 Ga0207665_10297983 3300025939 Bacteria 1204
138 Ga0207689_10002220 3300025942 Bacteria 18185
139 Ga0207661_10140252 3300025944 Bacteria 2080
140 Ga0207661_10580012 3300025944 Bacteria 1029
141 Ga0207651_11981835 3300025960 Unclassified 523
142 Ga0207677_10134201 3300026023 Bacteria 1884
143 Ga0207703_10006285 3300026035 Bacteria 9499
144 Ga0207639_11320692 3300026041 Unclassified 677
145 Ga0207708_10641055 3300026075 Bacteria 903
146 Ga0207702_10215564 3300026078 Bacteria 1787
147 Ga0207648_10122371 3300026089 Unclassified 2288
148 Ga0207674_11081611 3300026116 Bacteria 771
149 Ga0207675_100018173 3300026118 Bacteria 6556
150 Ga0207698_11069828 3300026142 Unclassified 819
151 Ga0209588_1000059 3300027671 Bacteria 38911
152 Ga0268266_12385301 3300028379 Bacteria 500
153 Ga0268265_10103091 3300028380 Bacteria 2309
154 Ga0268264_10009423 3300028381 Bacteria 8086
155 Ga0268264_10065634 3300028381 Bacteria 3059
156 Ga0265337_1169339 3300028556 Unclassified 592
157 Ga0265326_10063763 3300028558 Bacteria 1042
158 Ga0265319_1030934 3300028563 Bacteria 1867
159 Ga0265334_10001380 3300028573 Bacteria 11710
160 Ga0265334_10138713 3300028573 Bacteria 862
161 Ga0265318_10000561 3300028577 Bacteria 26198
162 Ga0265318_10082268 3300028577 Bacteria 1188
163 Ga0265322_10189047 3300028654 Bacteria 589
164 Ga0265338_10015390 3300028800 Bacteria 8408
165 Ga0265338_10151321 3300028800 Bacteria 1802
166 Ga0265338_10581409 3300028800 Bacteria 781
167 Ga0307511_10437793 3300030521 Bacteria 522
168 Ga0307512_10119692 3300030522 Bacteria 1698
169 Ga0265330_10008861 3300031235 Bacteria 4812
170 Ga0265330_10326819 3300031235 Bacteria 647
171 Ga0265332_10003270 3300031238 Bacteria 7874
172 Ga0265328_10017023 3300031239 Bacteria 2820
173 Ga0265328_10177550 3300031239 Bacteria 805
174 Ga0265320_10032773 3300031240 Bacteria 2657
175 Ga0265320_10054466 3300031240 Bacteria 1929
176 Ga0265325_10003501 3300031241 Bacteria 10219
177 Ga0265329_10012825 3300031242 Bacteria 3003
178 Ga0265329_10242868 3300031242 Bacteria 599
179 Ga0265340_10002903 3300031247 Bacteria 9758
180 Ga0265339_10018615 3300031249 Bacteria 4091
181 Ga0265339_10094732 3300031249 Bacteria 1560
182 Ga0265327_10018508 3300031251 Bacteria 4315
183 Ga0265316_10010442 3300031344 Bacteria 8459
184 Ga0307513_11003539 3300031456 Unclassified 544
185 Ga0265313_10053736 3300031595 Bacteria 1916
186 Ga0265314_10018712 3300031711 Bacteria 5390
187 Ga0265314_10070461 3300031711 Bacteria 2342
188 Ga0265342_10017748 3300031712 Bacteria 4621
189 Ga0307405_10650850 3300031731 Bacteria 867
190 Ga0307406_10955369 3300031901 Bacteria 733
191 Ga0307409_102810789 3300031995 Unclassified 514
192 Ga0307414_10127028 3300032004 Bacteria 1972
193 Ga0307507_10041454 3300033179 Bacteria 4606
194 Ga0316214_1011648 3300033545 Bacteria 1198
195 Ga0316212_1010631 3300033547 Bacteria 1320
196 Ga0373935_0000232 3300035692 Bacteria 27329
197 Ga0373947_0000008 3300035725 Bacteria 182094
198 Ga0373937_0648229 3300036401 Bacteria 1001
199 Ga0395898_0320771 3300037466 Bacteria 1478
200 Ga0436364_0025107 3300037853 Bacteria 84205
201 Ga0436364_1493596 3300037853 Bacteria 706
202 Ga0395901_0668673 3300038443 Bacteria 1040
203 Ga0237819_00458 3300038705 Bacteria 13912
204 Ga0237816_09849 3300039145 Bacteria 563
205 Ga0436363_0530370 3300039450 Bacteria 751
206 Ga0436362_0202293 3300039453 Bacteria 545
207 Ga0451789_0321697 3300041443 Bacteria 731
208 Ga0451847_1018292 3300041503 Bacteria 558
209 Ga0451849_1521843 3300041505 Bacteria 805
210 Ga0466972_0020075 3300044658 Bacteria 3341
211 Ga0466968_0705337 3300044735 Bacteria 515
212 Ga0466970_0109662 3300044765 Bacteria 1507
213 Ga0466959_0254988 3300045049 Bacteria 1209
214 Ga0466967_0003811 3300045976 Bacteria 9972
215 Ga0495594_0055328 3300046499 Bacteria 2188
216 Ga0495594_0150339 3300046499 Bacteria 1322
217 Ga0495608_0100398 3300046511 Bacteria 1866
218 Ga0495643_0172611 3300046522 Bacteria 1056
219 Ga0495622_0155021 3300046557 Bacteria 1035
220 Ga0495668_0000001 3300046616 Bacteria 1013420
221 Ga0495625_0195932 3300046660 Bacteria 1336
222 Ga0495625_0335157 3300046660 Bacteria 960
223 Ga0495658_0904161 3300046683 Bacteria 564
224 Ga0495672_0511489 3300047320 Archaea 532
225 Ga0496112_0001076 3300048915 Bacteria 20196
226 Ga0496115_0466325 3300048918 Bacteria 1018
227 Ga0501039_1518438 3300049575 Bacteria 515
228 Ga0501067_0049528 3300049583 Unclassified 2327
229 Ga0501069_0295463 3300049585 Bacteria 949
230 Ga0501071_0745337 3300049587 Bacteria 755
231 Ga0501074_0617055 3300049590 Bacteria 767
232 Ga0501074_1107858 3300049590 Bacteria 556
233 Ga0501276_016136 3300049773 Bacteria 677
234 Ga0501044_0074551 3300049823 Bacteria 3447
235 Ga0501044_0591135 3300049823 Bacteria 1004
236 nmdc:mga07m45_50403_c1 3300050496 Bacteria 2346
237 nmdc:mga0a205_1521069_c1 3300050515 Bacteria 517
238 Ga0495655_0216718 3300053083 Bacteria 632
239 Ga0495619_1084519 3300053085 Bacteria 533
240 Ga0500644_0023358 3300053088 Bacteria 1877
241 Ga0500646_0059968 3300053090 Bacteria 1117
242 Ga0500583_0364869 3300053092 Bacteria 698
243 Ga0500651_0379861 3300053093 Bacteria 797
244 Ga0500650_0398881 3300053098 Bacteria 595
245 Ga0500650_0402779 3300053098 Archaea 592
246 Ga0500562_058138 3300053108 Bacteria 1038
247 Ga0500594_0023212 3300053118 Bacteria 1571
248 Ga0500642_0071797 3300053130 Bacteria 1576
249 Ga0500658_0003437 3300053134 Bacteria 5976
250 Ga0500658_0141619 3300053134 Bacteria 1079
251 Ga0500658_0375931 3300053134 Bacteria 651
252 Ga0500568_0013499 3300053139 Bacteria 3722
253 Ga0500568_0017314 3300053139 Bacteria 3183
254 Ga0500577_0109180 3300053142 Bacteria 1140
255 Ga0500588_0049689 3300053146 Bacteria 1302
256 Ga0500604_0036769 3300053151 Bacteria 1461
257 Ga0500604_0077940 3300053151 Bacteria 1067
258 Ga0500622_0378383 3300053156 Archaea 580
259 Ga0500627_0387233 3300053158 Unclassified 598
260 Ga0500627_0482525 3300053158 Archaea 518
261 Ga0500633_0100199 3300053160 Bacteria 1066
262 Ga0500611_236002 3300053727 Unclassified 525
263 Ga0500609_004577 3300053731 Bacteria 1908
264 Ga0500599_024318 3300053736 Bacteria 873
265 Ga0070709_10302214
266 JGI25153J46596_10000047
267 Ga0055536_1001142
268 Ga0055530_10121818
269 Ga0065704_10289957
270 Ga0070658_10604876
271 Ga0070666_11042145
272 Ga0070680_100140103
273 Ga0068868_100080724
274 Ga0070660_100290905
275 Ga0070660_101412255
276 Ga0070689_101556523
277 Ga0070675_100187500
278 Ga0070673_101945554
279 Ga0070709_10306187
280 Ga0070709_11132852
281 Ga0070714_100013165
282 Ga0070714_100063978
283 Ga0070714_100411465
284 Ga0070714_100538250
285 Ga0070714_100575813
286 Ga0070713_100004860
287 Ga0070713_100029667
288 Ga0070713_100082460
289 Ga0070710_10000652
290 Ga0070711_100034228
291 Ga0070711_100179328
292 Ga0070700_101016252
293 Ga0070708_100087127
294 Ga0070708_100253054
295 Ga0070681_10022333
296 Ga0068867_100225349
297 Ga0070706_100502627
298 Ga0070707_100079078
299 Ga0070698_100099793
300 Ga0070698_101664100
301 Ga0070699_100843890
302 Ga0070699_101035596
303 Ga0070679_100137073
304 Ga0070684_101227297
305 Ga0070697_101846600
306 Ga0068853_100592578
307 Ga0068853_102020847
308 Ga0070672_100140251
309 Ga0070686_100816106
310 Ga0068857_100242196
311 Ga0068856_100104820
312 Ga0070702_101169442
313 Ga0068852_101222887
314 Ga0068859_100185865
315 Ga0068859_102369122
316 Ga0068861_100026214
317 Ga0068863_100258806
318 Ga0068858_100012329
319 Ga0068860_100129984
320 Ga0068862_100003378
321 Ga0081455_10246519
322 Ga0070717_10203148
323 Ga0070717_11045209
324 Ga0070717_11054887
325 Ga0070716_100005932
326 Ga0070716_100039411
327 Ga0070716_100355995
328 Ga0070712_100021746
329 Ga0070712_100042772
330 Ga0070712_100224153
331 Ga0070712_100444055
332 Ga0070712_100613614
333 Ga0075370_10053969
334 Ga0075430_100603541
335 Ga0068865_100096593
336 Ga0075436_100298748
337 Ga0075436_101055859
338 Ga0097620_100185878
339 Ga0097620_102369840
340 Ga0099794_10001364
341 Ga0105245_10419779
342 Ga0105247_11778453
343 Ga0105243_10553209
344 Ga0105242_10255607
345 Ga0105248_10202050
346 Ga0105237_10010393
347 Ga0105238_11170278
348 Ga0105239_10025023
349 Ga0105239_10612316
350 Ga0105246_10071678
351 Ga0157374_10039788
352 Ga0157378_10084851
353 Ga0157378_10148862
354 Ga0163162_10311739
355 Ga0157372_10112496
356 Ga0157375_10041759
357 Ga0157379_10094537
358 Ga0157376_10040823
359 Ga0157376_11017246
360 Ga0209676_1000276
361 Ga0209758_1000070
362 Ga0209758_1012594
363 Ga0209050_1042266
364 Ga0207692_10000106
365 Ga0207642_10269405
366 Ga0207647_10014550
367 Ga0207699_10001616
368 Ga0207699_10663455
369 Ga0207699_11305067
370 Ga0207705_10347831
371 Ga0207684_10146393
372 Ga0207684_10556714
373 Ga0207684_11633273
374 Ga0207707_11363474
375 Ga0207693_10002866
376 Ga0207693_10068295
377 Ga0207693_10353254
378 Ga0207663_10007836
379 Ga0207663_10250730
380 Ga0207663_10304279
381 Ga0207660_10080000
382 Ga0207657_10288252
383 Ga0207652_10026675
384 Ga0207646_10181179
385 Ga0207646_10704882
386 Ga0207646_10933159
387 Ga0207700_10000126
388 Ga0207700_10028349
389 Ga0207700_10028810
390 Ga0207664_10000148
391 Ga0207664_10012292
392 Ga0207664_10368179
393 Ga0207664_10429421
394 Ga0207664_10901064
395 Ga0207664_11002533
396 Ga0207709_11621933
397 Ga0207670_11334268
398 Ga0207704_10059620
399 Ga0207665_10010756
400 Ga0207665_10106574
401 Ga0207665_10297983
402 Ga0207689_10002220
403 Ga0207661_10140252
404 Ga0207661_10580012
405 Ga0207651_11981835
406 Ga0207677_10134201
407 Ga0207703_10006285
408 Ga0207639_11320692
409 Ga0207708_10641055
410 Ga0207702_10215564
411 Ga0207648_10122371
412 Ga0207674_11081611
413 Ga0207675_100018173
414 Ga0207698_11069828
415 Ga0209588_1000059
416 Ga0268266_12385301
417 Ga0268265_10103091
418 Ga0268264_10009423
419 Ga0268264_10065634
420 Ga0265337_1169339
421 Ga0265326_10063763
422 Ga0265319_1030934
423 Ga0265334_10001380
424 Ga0265334_10138713
425 Ga0265318_10000561
426 Ga0265318_10082268
427 Ga0265322_10189047
428 Ga0265338_10015390
429 Ga0265338_10151321
430 Ga0265338_10581409
431 Ga0307511_10437793
432 Ga0307512_10119692
433 Ga0265330_10008861
434 Ga0265330_10326819
435 Ga0265332_10003270
436 Ga0265328_10017023
437 Ga0265328_10177550
438 Ga0265320_10032773
439 Ga0265320_10054466
440 Ga0265325_10003501
441 Ga0265329_10012825
442 Ga0265329_10242868
443 Ga0265340_10002903
444 Ga0265339_10018615
445 Ga0265339_10094732
446 Ga0265327_10018508
447 Ga0265316_10010442
448 Ga0307513_11003539
449 Ga0265313_10053736
450 Ga0265314_10018712
451 Ga0265314_10070461
452 Ga0265342_10017748
453 Ga0307405_10650850
454 Ga0307406_10955369
455 Ga0307409_102810789
456 Ga0307414_10127028
457 Ga0307507_10041454
458 Ga0316214_1011648
459 Ga0316212_1010631
460 Ga0373935_0000232
461 Ga0373947_0000008
462 Ga0373937_0648229
463 Ga0395898_0320771
464 Ga0436364_0025107
465 Ga0436364_1493596
466 Ga0395901_0668673
467 Ga0237819_00458
468 Ga0237816_09849
469 Ga0436363_0530370
470 Ga0436362_0202293
471 Ga0451789_0321697
472 Ga0451847_1018292
473 Ga0451849_1521843
474 Ga0466972_0020075
475 Ga0466968_0705337
476 Ga0466970_0109662
477 Ga0466959_0254988
478 Ga0466967_0003811
479 Ga0495594_0055328
480 Ga0495594_0150339
481 Ga0495608_0100398
482 Ga0495643_0172611
483 Ga0495622_0155021
484 Ga0495668_0000001
485 Ga0495625_0195932
486 Ga0495625_0335157
487 Ga0495658_0904161
488 Ga0495672_0511489
489 Ga0496112_0001076
490 Ga0496115_0466325
491 Ga0501039_1518438
492 Ga0501067_0049528
493 Ga0501069_0295463
494 Ga0501071_0745337
495 Ga0501074_0617055
496 Ga0501074_1107858
497 Ga0501276_016136
498 Ga0501044_0074551
499 Ga0501044_0591135
500 nmdc:mga07m45_50403_c1
501 nmdc:mga0a205_1521069_c1
502 Ga0495655_0216718
503 Ga0495619_1084519
504 Ga0500644_0023358
505 Ga0500646_0059968
506 Ga0500583_0364869
507 Ga0500651_0379861
508 Ga0500650_0398881
509 Ga0500650_0402779
510 Ga0500562_058138
511 Ga0500594_0023212
512 Ga0500642_0071797
513 Ga0500658_0003437
514 Ga0500658_0141619
515 Ga0500658_0375931
516 Ga0500568_0013499
517 Ga0500568_0017314
518 Ga0500577_0109180
519 Ga0500588_0049689
520 Ga0500604_0036769
521 Ga0500604_0077940
522 Ga0500622_0378383
523 Ga0500627_0387233
524 Ga0500627_0482525
525 Ga0500633_0100199
526 Ga0500611_236002
527 Ga0500609_004577
528 Ga0500599_024318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

59

89

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.9394 42 86
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9075 3 99
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9071 44 85
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9011 3 99
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8975 3 96
ID Description Score Start End Superfamily
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9534 42 84 3.30.230.130
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9362 42 77 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9187 3 95 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9071 44 85 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8968 42 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A534P4A4-F1-model_v4 Helix-turn-helix transcriptional regulator 1 17 100 GO:0003700
AF-A0A1Y6BE31-F1-model_v4 Transcriptional regulator, ArsR family 0.9954 3 100 GO:0003700
AF-A0A1I3D8T7-F1-model_v4 Transcriptional regulator, ArsR family 0.9929 3 100 GO:0003700
AF-A0A7W1MSV9-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9927 3 100 GO:0003700
AF-A0A5Q0GU78-F1-model_v4 ArsR family transcriptional regulator 0.9925 5 97 GO:0003700

Map