F372200

General Info

Members Datasets Scaffolds Average Seq Length
263 209 526 186

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_322274_c1|nmdc:mga09592_322274_c1_426_1082
Length 218
Sequence VRPGPNSPPSSTSQPTSPALGGRNKKDISVRPLRYSINVTLDGCCHHEAGLPPDEESMRYWTAQLERADALVFGRVTYEMMESAWRQPATGVWPDWMDEWQIPFAQTMDRARKYVVSTTLSGVDWNAELIQGDLGQAVQQLKQEPGEGLFVGGVTLPLALADLGLIDEYEFLVQPVLAGHGPTLLAGLRERIQLELVDRHEFRSGAIALRYQPTRDAT

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
52 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
53 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
54 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
96 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
120 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
121 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
124 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
125 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 2643221597 Microbacterium sp. Root180 Isolate Unclassified
202 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
203 2687453737 Frankia sp. BMG5.36 Isolate Nodule
204 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
205 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
206 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
207 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
208 2928153084 Leifsonia sp. 563 Isolate Unclassified
209 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 0.76
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 1.14
Rhizoplane 5.32
Rhizosphere 82.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_322274_c1 3300050508 Bacteria 1339
2 JGI24735J21928_10000386 3300002067 Bacteria 15421
3 JGI24735J21928_10021567 3300002067 Bacteria 1966
4 Ga0006562J51391_1061584 3300003578 Bacteria 5260
5 Ga0070670_100050593 3300005331 Bacteria 3570
6 Ga0068869_100198469 3300005334 Bacteria 1581
7 Ga0070680_100000041 3300005336 Bacteria 66075
8 Ga0070680_100039569 3300005336 Bacteria 3815
9 Ga0070680_100300497 3300005336 Bacteria 1361
10 Ga0070660_100332344 3300005339 Bacteria 1250
11 Ga0070689_100092906 3300005340 Bacteria 2381
12 Ga0070671_100043637 3300005355 Bacteria 3726
13 Ga0070667_100306121 3300005367 Bacteria 1431
14 Ga0070701_10311016 3300005438 Bacteria 972
15 Ga0070700_100020905 3300005441 Bacteria 3799
16 Ga0070700_100085342 3300005441 Bacteria 2048
17 Ga0070681_10309373 3300005458 Bacteria 1489
18 Ga0070681_11189453 3300005458 Bacteria 684
19 Ga0068867_100093565 3300005459 Bacteria 2284
20 Ga0070679_100241795 3300005530 Bacteria 1762
21 Ga0068853_100079176 3300005539 Bacteria 2873
22 Ga0070672_100077925 3300005543 Bacteria 2651
23 Ga0070686_100261107 3300005544 Bacteria 1270
24 Ga0070695_100115838 3300005545 Bacteria 1826
25 Ga0068855_100030959 3300005563 Bacteria 6394
26 Ga0068855_100162137 3300005563 Bacteria 2537
27 Ga0068854_100046404 3300005578 Bacteria 3093
28 Ga0068856_100178434 3300005614 Bacteria 2136
29 Ga0068852_100235982 3300005616 Bacteria 1746
30 Ga0068859_100690552 3300005617 Bacteria 1112
31 Ga0068866_10002359 3300005718 Bacteria 7832
32 Ga0068861_100490371 3300005719 Bacteria 1109
33 Ga0068858_100099707 3300005842 Bacteria 2708
34 Ga0068862_100098332 3300005844 Bacteria 2556
35 Ga0081538_10043696 3300005981 Bacteria 2808
36 Ga0081538_10218801 3300005981 Bacteria 758
37 Ga0081539_10049274 3300005985 Bacteria 2391
38 Ga0081539_10168193 3300005985 Bacteria 1039
39 Ga0075363_100008796 3300006048 Bacteria 4722
40 Ga0075363_100462314 3300006048 Bacteria 750
41 Ga0075364_10005329 3300006051 Bacteria 7464
42 Ga0075364_10080628 3300006051 Bacteria 2151
43 Ga0070715_10366013 3300006163 Bacteria 792
44 Ga0075367_10144656 3300006178 Bacteria 1474
45 Ga0075370_10261437 3300006353 Bacteria 1026
46 Ga0068871_100058178 3300006358 Bacteria 3147
47 Ga0075428_100083996 3300006844 Bacteria 3474
48 Ga0075430_100045624 3300006846 Bacteria 3702
49 Ga0075430_100069825 3300006846 Bacteria 2947
50 Ga0075430_100624333 3300006846 Bacteria 889
51 Ga0075430_100744377 3300006846 Bacteria 808
52 Ga0075431_100013339 3300006847 Bacteria 8303
53 Ga0075431_100067299 3300006847 Bacteria 3697
54 Ga0075431_100078601 3300006847 Bacteria 3405
55 Ga0075433_10009624 3300006852 Bacteria 7734
56 Ga0075429_100107557 3300006880 Bacteria 2437
57 Ga0075436_100066374 3300006914 Bacteria 2493
58 Ga0075436_100232827 3300006914 Bacteria 1309
59 Ga0097620_100690529 3300006931 Bacteria 1112
60 Ga0097620_101574481 3300006931 Bacteria 726
61 Ga0075435_100002407 3300007076 Bacteria 12410
62 Ga0105240_10437615 3300009093 Bacteria 1466
63 Ga0111539_10388559 3300009094 Bacteria 1625
64 Ga0105245_10190983 3300009098 Bacteria 1962
65 Ga0114129_10173093 3300009147 Bacteria 2942
66 Ga0105243_10056321 3300009148 Bacteria 3126
67 Ga0105238_10215958 3300009551 Bacteria 1894
68 Ga0157336_1007196 3300012477 Bacteria 780
69 Ga0157346_1008370 3300012480 Bacteria 711
70 Ga0157347_1022734 3300012502 Bacteria 744
71 Ga0157338_1016878 3300012515 Bacteria 811
72 Ga0157371_10023147 3300013102 Bacteria 4542
73 Ga0157371_10403772 3300013102 Bacteria 1000
74 Ga0157370_10263194 3300013104 Bacteria 1594
75 Ga0157378_10019080 3300013297 Bacteria 6025
76 Ga0163162_10058334 3300013306 Bacteria 3888
77 Ga0163162_11167080 3300013306 Bacteria 873
78 Ga0157375_10032025 3300013308 Bacteria 4982
79 Ga0157375_11854161 3300013308 Bacteria 715
80 Ga0157379_10291479 3300014968 Bacteria 1486
81 Ga0206350_10985512 3300020080 Bacteria 816
82 Ga0207656_10134745 3300025321 Bacteria 1160
83 Ga0207642_10005781 3300025899 Bacteria 4065
84 Ga0207647_10296408 3300025904 Bacteria 921
85 Ga0207685_10227374 3300025905 Bacteria 891
86 Ga0207645_10038568 3300025907 Bacteria 3063
87 Ga0207645_10593775 3300025907 Bacteria 752
88 Ga0207705_10079327 3300025909 Bacteria 2390
89 Ga0207707_10388705 3300025912 Bacteria 1199
90 Ga0207695_10330518 3300025913 Bacteria 1413
91 Ga0207660_10008583 3300025917 Bacteria 6610
92 Ga0207660_10052505 3300025917 Bacteria 2902
93 Ga0207649_10337699 3300025920 Bacteria 1111
94 Ga0207652_10126618 3300025921 Bacteria 2276
95 Ga0207694_10065247 3300025924 Bacteria 2838
96 Ga0207644_10247726 3300025931 Bacteria 1420
97 Ga0207709_10196365 3300025935 Bacteria 1438
98 Ga0207665_10286309 3300025939 Bacteria 1228
99 Ga0207691_10016413 3300025940 Bacteria 7031
100 Ga0207691_10542086 3300025940 Bacteria 987
101 Ga0207667_10194063 3300025949 Bacteria 2083
102 Ga0207712_10021881 3300025961 Bacteria 4203
103 Ga0207640_10274251 3300025981 Bacteria 1321
104 Ga0207703_10038611 3300026035 Bacteria 3812
105 Ga0207703_11427051 3300026035 Bacteria 666
106 Ga0207639_10287957 3300026041 Bacteria 1447
107 Ga0207678_10113048 3300026067 Bacteria 2316
108 Ga0207708_10056713 3300026075 Bacteria 2988
109 Ga0207702_10355177 3300026078 Bacteria 1403
110 Ga0207674_11254325 3300026116 Bacteria 711
111 Ga0207675_100016321 3300026118 Bacteria 6932
112 Ga0207675_101016596 3300026118 Bacteria 847
113 Ga0207683_10848965 3300026121 Bacteria 848
114 Ga0265318_10116419 3300028577 Bacteria 982
115 Ga0307413_10309101 3300031824 Bacteria 1202
116 Ga0307410_10222492 3300031852 Bacteria 1453
117 Ga0307412_10298496 3300031911 Bacteria 1272
118 Ga0307416_101351181 3300032002 Bacteria 818
119 Ga0307415_100120205 3300032126 Bacteria 1968
120 Ga0307415_100280465 3300032126 Bacteria 1370
121 Ga0307415_100497399 3300032126 Bacteria 1065
122 Ga0373948_0016276 3300034817 Bacteria 1373
123 Ga0373938_0117734 3300034957 Bacteria 682
124 Ga0373928_0091441 3300035084 Bacteria 782
125 Ga0373940_0139954 3300035088 Bacteria 764
126 Ga0373932_0004598 3300035112 Bacteria 3259
127 Ga0373939_0210144 3300035114 Bacteria 740
128 Ga0373931_0000001 3300035691 Bacteria 634029
129 Ga0373931_0411025 3300035691 Bacteria 858
130 Ga0373935_0010183 3300035692 Bacteria 5632
131 Ga0373927_0106539 3300035695 Bacteria 1825
132 Ga0395898_0696880 3300037466 Bacteria 957
133 Ga0395901_0129409 3300038443 Bacteria 2653
134 Ga0395901_1009617 3300038443 Bacteria 807
135 Ga0242420_033209 3300038996 Bacteria 965
136 Ga0436361_0722868 3300039447 Bacteria 642
137 Ga0439447_059089 3300041407 Bacteria 904
138 Ga0439466_0148480 3300041411 Bacteria 718
139 Ga0451802_1378513 3300041460 Bacteria 634
140 Ga0451833_0381947 3300041491 Bacteria 1736
141 Ga0451837_1621369 3300041494 Bacteria 832
142 Ga0451841_0181803 3300041498 Bacteria 3215
143 Ga0451843_0559816 3300041509 Bacteria 2045
144 Ga0451843_1755491 3300041509 Bacteria 1958
145 Ga0451853_2609193 3300041512 Bacteria 2186
146 Ga0439431_0013535 3300041997 Bacteria 1883
147 Ga0439443_019778 3300042003 Bacteria 1052
148 Ga0439443_064210 3300042003 Bacteria 661
149 Ga0439448_0033750 3300042005 Bacteria 1633
150 Ga0439450_015340 3300042008 Bacteria 1567
151 Ga0439452_060978 3300042010 Bacteria 845
152 Ga0439455_0035863 3300042012 Bacteria 1253
153 Ga0439463_034530 3300042016 Bacteria 1279
154 Ga0450912_011703 3300042116 Bacteria 766
155 Ga0450888_016355 3300042126 Bacteria 913
156 Ga0450896_047407 3300042133 Bacteria 680
157 Ga0439434_0124621 3300042435 Bacteria 842
158 Ga0439444_0011047 3300042437 Bacteria 1455
159 Ga0439464_0190643 3300042439 Bacteria 651
160 Ga0439460_0013931 3300042461 Bacteria 2109
161 Ga0439440_0006510 3300042993 Bacteria 2354
162 Ga0453683_0303921 3300044673 Bacteria 1021
163 Ga0466960_0055706 3300044901 Bacteria 1923
164 Ga0495582_0196515 3300046473 Bacteria 1151
165 Ga0495605_0252962 3300046474 Bacteria 753
166 Ga0495664_0269667 3300046477 Bacteria 1029
167 Ga0495596_0163472 3300046500 Bacteria 865
168 Ga0495616_0173953 3300046513 Bacteria 961
169 Ga0495644_0269977 3300046523 Bacteria 662
170 Ga0495648_0018619 3300046524 Bacteria 4908
171 Ga0495663_0105638 3300046525 Bacteria 931
172 Ga0495666_0282357 3300046526 Bacteria 753
173 Ga0495586_0138270 3300046535 Bacteria 1366
174 Ga0495668_0322413 3300046616 Bacteria 847
175 Ga0495588_0063040 3300046674 Bacteria 1922
176 Ga0495613_0655578 3300046689 Bacteria 694
177 Ga0495671_0278851 3300046692 Bacteria 805
178 Ga0495649_0232352 3300046694 Bacteria 951
179 Ga0495676_0005489 3300047321 Bacteria 11631
180 Ga0495675_0071488 3300047444 Bacteria 2190
181 Ga0495684_0279546 3300047471 Bacteria 1205
182 Ga0495684_0351422 3300047471 Bacteria 1046
183 Ga0495615_0162993 3300048090 Bacteria 670
184 Ga0496100_0045678 3300048903 Bacteria 2812
185 Ga0496101_0006592 3300048904 Bacteria 7481
186 Ga0496102_0294755 3300048905 Bacteria 1529
187 Ga0496103_0601647 3300048906 Bacteria 700
188 Ga0496104_0011001 3300048907 Bacteria 8094
189 Ga0496104_0882694 3300048907 Bacteria 799
190 Ga0496105_0011266 3300048908 Bacteria 7058
191 Ga0496106_0506903 3300048909 Bacteria 969
192 Ga0496109_0084655 3300048912 Bacteria 2926
193 Ga0496110_0033075 3300048913 Bacteria 4471
194 Ga0496111_0379546 3300048914 Bacteria 1045
195 Ga0496112_0066030 3300048915 Bacteria 3570
196 Ga0496114_0061535 3300048917 Bacteria 3140
197 Ga0496120_0351734 3300048923 Bacteria 662
198 Ga0496124_0369131 3300048927 Bacteria 1008
199 Ga0495678_141907 3300049459 Bacteria 785
200 Ga0501034_0000361 3300049571 Bacteria 77566
201 Ga0501034_0052641 3300049571 Bacteria 4101
202 Ga0501034_0062697 3300049571 Bacteria 3733
203 Ga0501034_0456023 3300049571 Bacteria 1196
204 Ga0501036_0310769 3300049572 Bacteria 1318
205 Ga0501037_0065604 3300049573 Bacteria 2645
206 Ga0501040_0054256 3300049576 Bacteria 2748
207 Ga0501043_0007291 3300049579 Bacteria 8779
208 Ga0501047_0026689 3300049581 Bacteria 5559
209 Ga0501068_0001821 3300049584 Bacteria 11319
210 Ga0501069_0019774 3300049585 Bacteria 3643
211 Ga0501070_0000980 3300049586 Bacteria 25623
212 Ga0501073_0021904 3300049589 Bacteria 4604
213 Ga0501079_0024324 3300049741 Bacteria 4647
214 Ga0501079_0056514 3300049741 Bacteria 3028
215 Ga0501080_0006757 3300049742 Bacteria 10335
216 Ga0501080_0271534 3300049742 Bacteria 1543
217 Ga0501081_0134302 3300049743 Bacteria 1770
218 Ga0501083_0074268 3300049744 Bacteria 2259
219 Ga0501035_1088296 3300049822 Bacteria 625
220 Ga0501044_0275552 3300049823 Bacteria 1617
221 nmdc:mga00v17_5647_c1 3300050491 Bacteria 6599
222 nmdc:mga07m45_395940_c1 3300050496 Bacteria 802
223 nmdc:mga05p37_256618_c1 3300050507 Bacteria 2095
224 nmdc:mga05p37_346400_c1 3300050507 Bacteria 1750
225 nmdc:mga05p37_36411_c1 3300050507 Bacteria 6037
226 nmdc:mga09592_1086951_c1 3300050508 Bacteria 665
227 nmdc:mga09592_24048_c1 3300050508 Bacteria 5036
228 nmdc:mga0qj67_139402_c1 3300050509 Bacteria 1966
229 nmdc:mga0qj67_294282_c1 3300050509 Bacteria 1316
230 nmdc:mga0qj67_42038_c1 3300050509 Bacteria 3597
231 nmdc:mga0qj67_5626_c1 3300050509 Bacteria 9164
232 nmdc:mga0qj67_59689_c1 3300050509 Bacteria 3025
233 nmdc:mga0qj67_706146_c1 3300050509 Bacteria 802
234 nmdc:mga0qj67_862874_c1 3300050509 Bacteria 715
235 nmdc:mga06r32_1546_c1 3300050510 Bacteria 20726
236 nmdc:mga06r32_28000_c1 3300050510 Bacteria 5271
237 nmdc:mga06r32_992605_c1 3300050510 Bacteria 793
238 nmdc:mga0n895_1336946_c1 3300050512 Bacteria 687
239 nmdc:mga0rr50_1203523_c1 3300050513 Bacteria 644
240 nmdc:mga0rr50_213724_c1 3300050513 Bacteria 1590
241 nmdc:mga08x19_18347_c1 3300050514 Bacteria 4288
242 nmdc:mga08x19_500710_c1 3300050514 Bacteria 858
243 Ga0500635_0000234 3300053080 Bacteria 24552
244 Ga0495655_0074744 3300053083 Bacteria 955
245 Ga0500566_0001028 3300053094 Bacteria 16123
246 Ga0500650_0196552 3300053098 Bacteria 920
247 Ga0500554_093301 3300053102 Bacteria 1002
248 Ga0500573_0051731 3300053140 Bacteria 2362
249 Ga0501084_0109654 3300054114 Bacteria 2319
250 Ga0590077_041108 3300059426 Bacteria 1027
251 Ga0501082_0114418 3300060353 Bacteria 2336
252 Ga0501082_0209904 3300060353 Bacteria 1694
253 Ga0530510_0053115 3300061734 Bacteria 2928
254 2643997375 2643221597 Bacteria 3347721
255 2645724382 2643221962 Bacteria 3874254
256 2689955844 2687453737 Bacteria 11203906
257 2689993021 2687453743 Bacteria 8361025
258 2689995703 2687453743 Bacteria 8361025
259 2808631510 2808606306 Bacteria 3608896
260 2895885176 2895880812 Bacteria 11255272
261 2915362514 2915358134 Bacteria 6050864
262 2928153258 2928153084 Bacteria 4020257
263 8057347667 8057345674 Bacteria 4160394
264 nmdc:mga09592_322274_c1
265 JGI24735J21928_10000386
266 JGI24735J21928_10021567
267 Ga0006562J51391_1061584
268 Ga0070670_100050593
269 Ga0068869_100198469
270 Ga0070680_100000041
271 Ga0070680_100039569
272 Ga0070680_100300497
273 Ga0070660_100332344
274 Ga0070689_100092906
275 Ga0070671_100043637
276 Ga0070667_100306121
277 Ga0070701_10311016
278 Ga0070700_100020905
279 Ga0070700_100085342
280 Ga0070681_10309373
281 Ga0070681_11189453
282 Ga0068867_100093565
283 Ga0070679_100241795
284 Ga0068853_100079176
285 Ga0070672_100077925
286 Ga0070686_100261107
287 Ga0070695_100115838
288 Ga0068855_100030959
289 Ga0068855_100162137
290 Ga0068854_100046404
291 Ga0068856_100178434
292 Ga0068852_100235982
293 Ga0068859_100690552
294 Ga0068866_10002359
295 Ga0068861_100490371
296 Ga0068858_100099707
297 Ga0068862_100098332
298 Ga0081538_10043696
299 Ga0081538_10218801
300 Ga0081539_10049274
301 Ga0081539_10168193
302 Ga0075363_100008796
303 Ga0075363_100462314
304 Ga0075364_10005329
305 Ga0075364_10080628
306 Ga0070715_10366013
307 Ga0075367_10144656
308 Ga0075370_10261437
309 Ga0068871_100058178
310 Ga0075428_100083996
311 Ga0075430_100045624
312 Ga0075430_100069825
313 Ga0075430_100624333
314 Ga0075430_100744377
315 Ga0075431_100013339
316 Ga0075431_100067299
317 Ga0075431_100078601
318 Ga0075433_10009624
319 Ga0075429_100107557
320 Ga0075436_100066374
321 Ga0075436_100232827
322 Ga0097620_100690529
323 Ga0097620_101574481
324 Ga0075435_100002407
325 Ga0105240_10437615
326 Ga0111539_10388559
327 Ga0105245_10190983
328 Ga0114129_10173093
329 Ga0105243_10056321
330 Ga0105238_10215958
331 Ga0157336_1007196
332 Ga0157346_1008370
333 Ga0157347_1022734
334 Ga0157338_1016878
335 Ga0157371_10023147
336 Ga0157371_10403772
337 Ga0157370_10263194
338 Ga0157378_10019080
339 Ga0163162_10058334
340 Ga0163162_11167080
341 Ga0157375_10032025
342 Ga0157375_11854161
343 Ga0157379_10291479
344 Ga0206350_10985512
345 Ga0207656_10134745
346 Ga0207642_10005781
347 Ga0207647_10296408
348 Ga0207685_10227374
349 Ga0207645_10038568
350 Ga0207645_10593775
351 Ga0207705_10079327
352 Ga0207707_10388705
353 Ga0207695_10330518
354 Ga0207660_10008583
355 Ga0207660_10052505
356 Ga0207649_10337699
357 Ga0207652_10126618
358 Ga0207694_10065247
359 Ga0207644_10247726
360 Ga0207709_10196365
361 Ga0207665_10286309
362 Ga0207691_10016413
363 Ga0207691_10542086
364 Ga0207667_10194063
365 Ga0207712_10021881
366 Ga0207640_10274251
367 Ga0207703_10038611
368 Ga0207703_11427051
369 Ga0207639_10287957
370 Ga0207678_10113048
371 Ga0207708_10056713
372 Ga0207702_10355177
373 Ga0207674_11254325
374 Ga0207675_100016321
375 Ga0207675_101016596
376 Ga0207683_10848965
377 Ga0265318_10116419
378 Ga0307413_10309101
379 Ga0307410_10222492
380 Ga0307412_10298496
381 Ga0307416_101351181
382 Ga0307415_100120205
383 Ga0307415_100280465
384 Ga0307415_100497399
385 Ga0373948_0016276
386 Ga0373938_0117734
387 Ga0373928_0091441
388 Ga0373940_0139954
389 Ga0373932_0004598
390 Ga0373939_0210144
391 Ga0373931_0000001
392 Ga0373931_0411025
393 Ga0373935_0010183
394 Ga0373927_0106539
395 Ga0395898_0696880
396 Ga0395901_0129409
397 Ga0395901_1009617
398 Ga0242420_033209
399 Ga0436361_0722868
400 Ga0439447_059089
401 Ga0439466_0148480
402 Ga0451802_1378513
403 Ga0451833_0381947
404 Ga0451837_1621369
405 Ga0451841_0181803
406 Ga0451843_0559816
407 Ga0451843_1755491
408 Ga0451853_2609193
409 Ga0439431_0013535
410 Ga0439443_019778
411 Ga0439443_064210
412 Ga0439448_0033750
413 Ga0439450_015340
414 Ga0439452_060978
415 Ga0439455_0035863
416 Ga0439463_034530
417 Ga0450912_011703
418 Ga0450888_016355
419 Ga0450896_047407
420 Ga0439434_0124621
421 Ga0439444_0011047
422 Ga0439464_0190643
423 Ga0439460_0013931
424 Ga0439440_0006510
425 Ga0453683_0303921
426 Ga0466960_0055706
427 Ga0495582_0196515
428 Ga0495605_0252962
429 Ga0495664_0269667
430 Ga0495596_0163472
431 Ga0495616_0173953
432 Ga0495644_0269977
433 Ga0495648_0018619
434 Ga0495663_0105638
435 Ga0495666_0282357
436 Ga0495586_0138270
437 Ga0495668_0322413
438 Ga0495588_0063040
439 Ga0495613_0655578
440 Ga0495671_0278851
441 Ga0495649_0232352
442 Ga0495676_0005489
443 Ga0495675_0071488
444 Ga0495684_0279546
445 Ga0495684_0351422
446 Ga0495615_0162993
447 Ga0496100_0045678
448 Ga0496101_0006592
449 Ga0496102_0294755
450 Ga0496103_0601647
451 Ga0496104_0011001
452 Ga0496104_0882694
453 Ga0496105_0011266
454 Ga0496106_0506903
455 Ga0496109_0084655
456 Ga0496110_0033075
457 Ga0496111_0379546
458 Ga0496112_0066030
459 Ga0496114_0061535
460 Ga0496120_0351734
461 Ga0496124_0369131
462 Ga0495678_141907
463 Ga0501034_0000361
464 Ga0501034_0052641
465 Ga0501034_0062697
466 Ga0501034_0456023
467 Ga0501036_0310769
468 Ga0501037_0065604
469 Ga0501040_0054256
470 Ga0501043_0007291
471 Ga0501047_0026689
472 Ga0501068_0001821
473 Ga0501069_0019774
474 Ga0501070_0000980
475 Ga0501073_0021904
476 Ga0501079_0024324
477 Ga0501079_0056514
478 Ga0501080_0006757
479 Ga0501080_0271534
480 Ga0501081_0134302
481 Ga0501083_0074268
482 Ga0501035_1088296
483 Ga0501044_0275552
484 nmdc:mga00v17_5647_c1
485 nmdc:mga07m45_395940_c1
486 nmdc:mga05p37_256618_c1
487 nmdc:mga05p37_346400_c1
488 nmdc:mga05p37_36411_c1
489 nmdc:mga09592_1086951_c1
490 nmdc:mga09592_24048_c1
491 nmdc:mga0qj67_139402_c1
492 nmdc:mga0qj67_294282_c1
493 nmdc:mga0qj67_42038_c1
494 nmdc:mga0qj67_5626_c1
495 nmdc:mga0qj67_59689_c1
496 nmdc:mga0qj67_706146_c1
497 nmdc:mga0qj67_862874_c1
498 nmdc:mga06r32_1546_c1
499 nmdc:mga06r32_28000_c1
500 nmdc:mga06r32_992605_c1
501 nmdc:mga0n895_1336946_c1
502 nmdc:mga0rr50_1203523_c1
503 nmdc:mga0rr50_213724_c1
504 nmdc:mga08x19_18347_c1
505 nmdc:mga08x19_500710_c1
506 Ga0500635_0000234
507 Ga0495655_0074744
508 Ga0500566_0001028
509 Ga0500650_0196552
510 Ga0500554_093301
511 Ga0500573_0051731
512 Ga0501084_0109654
513 Ga0590077_041108
514 Ga0501082_0114418
515 Ga0501082_0209904
516 Ga0530510_0053115
517 2643997375
518 2645724382
519 2689955844
520 2689993021
521 2689995703
522 2808631510
523 2895885176
524 2915362514
525 2928153258
526 8057347667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

31

208

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7896 4 185
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7835 3 185
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7809 4 185
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7799 3 185
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7776 2 185
ID Description Score Start End Superfamily
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8086 3 185 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7929 4 183 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7896 4 185 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.783 2 181 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7825 3 185 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6M1QQK5-F1-model_v4 deleted 0.9914 1 185
AF-A0A7V9GHA7-F1-model_v4 Dihydrofolate reductase family protein 0.9898 1 185 GO:0008703
GO:0009231
AF-A0A6M1QQK5-F1-model_v4 deleted 0.9861 1 185
AF-A0A2T7X0M1-F1-model_v4 Deaminase 0.9855 1 185 GO:0008703
GO:0009231
AF-A0A2U0H8I2-F1-model_v4 Deaminase 0.9817 2 185 GO:0008703
GO:0009231

Map