F372182

General Info

Members Datasets Scaffolds Average Seq Length
263 195 526 137

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0352764|Ga0501069_0352764_13_522
Length 169
Sequence MAAASGSGSKPPPEARLAARAIRIWGVKIHSLPVFGRIDHIGVAVADLEAAIALHEGTYGMPLVHRETVEAQGVEAVLLDVGESHVELLRPLSEDTPVGKFLAKRGPGLHHVAYGVDDVESTLAELRERGVRLIDETPRIGIRGSRVAFLHPAASGGVLTEIVQPAEHS

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.51
Nodule 0
Rhizoplane 8.75
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0352764 3300049585 Bacteria 867
2 Ga0070683_100940243 3300005329 Bacteria 829
3 Ga0070682_100056595 3300005337 Bacteria 2467
4 Ga0068868_100095826 3300005338 Bacteria 2396
5 Ga0070660_100091147 3300005339 Bacteria 2404
6 Ga0070692_10002055 3300005345 Bacteria 7657
7 Ga0070659_100000002 3300005366 Bacteria 369239
8 Ga0070659_100075274 3300005366 Bacteria 2690
9 Ga0070714_100000170 3300005435 Bacteria 52761
10 Ga0070714_100036595 3300005435 Bacteria 4117
11 Ga0070714_100139430 3300005435 Bacteria 2175
12 Ga0070710_10403999 3300005437 Bacteria 916
13 Ga0070701_10058776 3300005438 Bacteria 2019
14 Ga0070711_100654270 3300005439 Bacteria 881
15 Ga0070705_100002415 3300005440 Bacteria 9402
16 Ga0070705_101387202 3300005440 Bacteria 585
17 Ga0070708_100702756 3300005445 Bacteria 952
18 Ga0070678_100322142 3300005456 Bacteria 1320
19 Ga0070706_100928783 3300005467 Bacteria 803
20 Ga0070707_100446300 3300005468 Bacteria 1254
21 Ga0070684_100105921 3300005535 Bacteria 2517
22 Ga0070686_100661603 3300005544 Bacteria 829
23 Ga0070693_100350193 3300005547 Bacteria 1010
24 Ga0068859_100973721 3300005617 Bacteria 931
25 Ga0068863_100342689 3300005841 Bacteria 1454
26 Ga0068862_102452716 3300005844 Bacteria 533
27 Ga0081538_10001249 3300005981 Bacteria 26524
28 Ga0081538_10002055 3300005981 Bacteria 20085
29 Ga0081539_10086307 3300005985 Bacteria 1634
30 Ga0081539_10156089 3300005985 Bacteria 1093
31 Ga0070717_10000005 3300006028 Bacteria 357819
32 Ga0075365_10149209 3300006038 Bacteria 1626
33 Ga0075365_10482601 3300006038 Bacteria 876
34 Ga0075365_10863671 3300006038 Bacteria 638
35 Ga0075363_100502102 3300006048 Bacteria 720
36 Ga0075364_10129904 3300006051 Bacteria 1690
37 Ga0075364_10179417 3300006051 Bacteria 1432
38 Ga0075364_10527277 3300006051 Bacteria 807
39 Ga0070715_10156683 3300006163 Bacteria 1121
40 Ga0070716_100009586 3300006173 Bacteria 4829
41 Ga0070712_100000036 3300006175 Bacteria 67602
42 Ga0075367_10068986 3300006178 Bacteria 2122
43 Ga0075367_10127919 3300006178 Bacteria 1569
44 Ga0075367_10343352 3300006178 Bacteria 942
45 Ga0075429_100010275 3300006880 Bacteria 8101
46 Ga0068865_100276349 3300006881 Bacteria 1336
47 Ga0097620_100973851 3300006931 Bacteria 931
48 Ga0105240_10141499 3300009093 Bacteria 2876
49 Ga0105245_10078545 3300009098 Bacteria 3012
50 Ga0105247_10352808 3300009101 Bacteria 1035
51 Ga0114129_10418127 3300009147 Unclassified 1764
52 Ga0105243_10247514 3300009148 Bacteria 1590
53 Ga0105243_11129864 3300009148 Bacteria 793
54 Ga0105249_10848622 3300009553 Bacteria 979
55 Ga0105239_10019708 3300010375 Bacteria 7445
56 Ga0105246_10028385 3300011119 Bacteria 3676
57 Ga0157371_10004276 3300013102 Bacteria 12531
58 Ga0157378_11847286 3300013297 Bacteria 653
59 Ga0163162_10604167 3300013306 Bacteria 1223
60 Ga0163162_11136423 3300013306 Bacteria 885
61 Ga0157372_12639626 3300013307 Bacteria 576
62 Ga0157375_11026999 3300013308 Bacteria 963
63 Ga0157375_11812477 3300013308 Unclassified 724
64 Ga0157377_10365084 3300014745 Bacteria 973
65 Ga0157376_10290085 3300014969 Bacteria 1544
66 Ga0157376_10618272 3300014969 Bacteria 1080
67 Ga0206354_11134798 3300020081 Bacteria 710
68 Ga0213876_10006056 3300021384 Bacteria 6610
69 Ga0213875_10139542 3300021388 Unclassified 1134
70 Ga0207647_10428051 3300025904 Bacteria 743
71 Ga0207699_10853387 3300025906 Bacteria 671
72 Ga0207684_11369666 3300025910 Bacteria 580
73 Ga0207695_10147282 3300025913 Bacteria 2297
74 Ga0207693_10000001 3300025915 Bacteria 469535
75 Ga0207663_10069936 3300025916 Bacteria 2260
76 Ga0207657_10088092 3300025919 Bacteria 2595
77 Ga0207694_10466949 3300025924 Bacteria 1055
78 Ga0207687_10000350 3300025927 Bacteria 30682
79 Ga0207664_10000035 3300025929 Bacteria 173780
80 Ga0207664_10058730 3300025929 Bacteria 3061
81 Ga0207664_10116794 3300025929 Bacteria 2227
82 Ga0207664_10357651 3300025929 Bacteria 1293
83 Ga0207664_10532063 3300025929 Bacteria 1054
84 Ga0207690_10000024 3300025932 Bacteria 194416
85 Ga0207670_10129878 3300025936 Bacteria 1844
86 Ga0207704_10129943 3300025938 Bacteria 1742
87 Ga0207704_10403850 3300025938 Bacteria 1079
88 Ga0207665_10023383 3300025939 Bacteria 4072
89 Ga0207665_10234190 3300025939 Bacteria 1351
90 Ga0207661_10899259 3300025944 Bacteria 815
91 Ga0207703_10558221 3300026035 Bacteria 1080
92 Ga0207703_10652534 3300026035 Bacteria 998
93 Ga0207639_10275063 3300026041 Bacteria 1479
94 Ga0207676_11604121 3300026095 Unclassified 648
95 Ga0207675_100836825 3300026118 Unclassified 935
96 Ga0207683_10023271 3300026121 Bacteria 5327
97 Ga0207683_10077280 3300026121 Bacteria 2948
98 Ga0207698_10782363 3300026142 Bacteria 955
99 Ga0268265_10634768 3300028380 Bacteria 1025
100 Ga0268264_12460043 3300028381 Bacteria 526
101 Ga0265326_10000004 3300028558 Bacteria 283947
102 Ga0265326_10055075 3300028558 Bacteria 1125
103 Ga0265319_1001220 3300028563 Bacteria 15881
104 Ga0265334_10000019 3300028573 Bacteria 143921
105 Ga0265322_10103033 3300028654 Bacteria 812
106 Ga0265336_10009001 3300028666 Bacteria 3471
107 Ga0265338_10010536 3300028800 Bacteria 10813
108 Ga0265324_10000344 3300029957 Bacteria 33865
109 Ga0265320_10031974 3300031240 Bacteria 2699
110 Ga0265340_10391445 3300031247 Bacteria 613
111 Ga0265327_10015415 3300031251 Bacteria 4936
112 Ga0307405_10410897 3300031731 Bacteria 1062
113 Ga0307410_10353939 3300031852 Bacteria 1174
114 Ga0326468_10043920 3300031889 Bacteria 650
115 Ga0307406_10685317 3300031901 Bacteria 854
116 Ga0307406_10882636 3300031901 Bacteria 760
117 Ga0307416_100623956 3300032002 Bacteria 1160
118 Ga0307415_100172092 3300032126 Bacteria 1690
119 Ga0373943_0286877 3300035170 Bacteria 932
120 Ga0373937_0518251 3300036401 Bacteria 1133
121 Ga0395900_0010194 3300037418 Bacteria 9612
122 Ga0395900_0727683 3300037418 Bacteria 924
123 Ga0395905_0056790 3300037471 Bacteria 3661
124 Ga0436364_1479716 3300037853 Bacteria 3362
125 Ga0395901_0012828 3300038443 Bacteria 8501
126 Ga0436365_1652791 3300039437 Bacteria 22443
127 Ga0436363_1075476 3300039450 Bacteria 560
128 Ga0436362_0503690 3300039453 Unclassified 1068
129 Ga0451802_0792536 3300041460 Bacteria 532
130 Ga0466969_0280995 3300044656 Bacteria 754
131 Ga0466966_0306182 3300044684 Bacteria 955
132 Ga0466966_0446490 3300044684 Bacteria 777
133 Ga0466966_0522906 3300044684 Bacteria 714
134 Ga0466961_0610510 3300044693 Archaea 656
135 Ga0466961_0838480 3300044693 Bacteria 548
136 Ga0466961_0887024 3300044693 Bacteria 531
137 Ga0466964_0066477 3300044706 Bacteria 1513
138 Ga0466964_0420828 3300044706 Bacteria 702
139 Ga0466971_0380575 3300044719 Bacteria 686
140 Ga0466968_0073918 3300044735 Bacteria 1488
141 Ga0466970_0747478 3300044765 Bacteria 571
142 Ga0466957_0675986 3300044842 Bacteria 727
143 Ga0466960_0016798 3300044901 Bacteria 3181
144 Ga0466958_0071667 3300045836 Bacteria 2122
145 Ga0466958_0076419 3300045836 Bacteria 2055
146 Ga0466958_0400427 3300045836 Bacteria 886
147 Ga0466967_0020715 3300045976 Bacteria 5323
148 Ga0466967_0883500 3300045976 Bacteria 889
149 Ga0466967_0899064 3300045976 Bacteria 880
150 Ga0466967_1456249 3300045976 Bacteria 682
151 Ga0466967_1559723 3300045976 Bacteria 658
152 Ga0495603_0147565 3300046455 Bacteria 1367
153 Ga0495603_0387079 3300046455 Unclassified 802
154 Ga0495629_0088598 3300046459 Bacteria 2159
155 Ga0495629_0368621 3300046459 Bacteria 978
156 Ga0495641_0004850 3300046461 Bacteria 9346
157 Ga0495641_0022622 3300046461 Bacteria 3140
158 Ga0495641_0273869 3300046461 Unclassified 759
159 Ga0495582_0241119 3300046473 Unclassified 1036
160 Ga0495662_0051726 3300046476 Bacteria 1983
161 Ga0495594_0214253 3300046499 Bacteria 1098
162 Ga0495620_0001840 3300046515 Bacteria 12507
163 Ga0495620_0019184 3300046515 Bacteria 3371
164 Ga0495631_0101248 3300046518 Bacteria 1239
165 Ga0495631_0235973 3300046518 Bacteria 780
166 Ga0495644_0006704 3300046523 Bacteria 4458
167 Ga0495609_0161429 3300046538 Bacteria 950
168 Ga0495656_0098159 3300046615 Bacteria 1350
169 Ga0495588_0484829 3300046674 Bacteria 648
170 Ga0495657_0352865 3300046675 Bacteria 870
171 Ga0495647_0525553 3300046681 Unclassified 552
172 Ga0495649_0384511 3300046694 Bacteria 706
173 Ga0495589_0066325 3300046794 Bacteria 1768
174 Ga0495676_0021047 3300047321 Bacteria 5708
175 Ga0495680_0507468 3300047322 Bacteria 818
176 Ga0495673_0056907 3300047469 Bacteria 1690
177 Ga0495681_0094167 3300047470 Bacteria 1318
178 Ga0495686_0000003 3300047472 Bacteria 899502
179 Ga0495686_0015164 3300047472 Bacteria 5277
180 Ga0495686_0031443 3300047472 Bacteria 3441
181 Ga0495686_0551718 3300047472 Bacteria 601
182 Ga0495614_0060947 3300048089 Bacteria 1621
183 Ga0495615_0046463 3300048090 Bacteria 1103
184 Ga0496100_0001713 3300048903 Bacteria 10914
185 Ga0496100_0003315 3300048903 Bacteria 8379
186 Ga0496100_0386454 3300048903 Bacteria 1064
187 Ga0496101_0000505 3300048904 Bacteria 24566
188 Ga0496101_0164761 3300048904 Bacteria 1701
189 Ga0496102_0006785 3300048905 Bacteria 9770
190 Ga0496103_0000683 3300048906 Bacteria 25335
191 Ga0496103_0784992 3300048906 Bacteria 601
192 Ga0496104_1003987 3300048907 Bacteria 738
193 Ga0496105_0153986 3300048908 Bacteria 1888
194 Ga0496106_0008812 3300048909 Bacteria 7455
195 Ga0496107_0003466 3300048910 Bacteria 10540
196 Ga0496108_0055885 3300048911 Bacteria 3315
197 Ga0496109_0007683 3300048912 Bacteria 9141
198 Ga0496110_0569648 3300048913 Bacteria 1028
199 Ga0496111_0007391 3300048914 Bacteria 7195
200 Ga0496112_0019800 3300048915 Bacteria 6364
201 Ga0496113_0062171 3300048916 Bacteria 2819
202 Ga0496113_0303023 3300048916 Bacteria 1279
203 Ga0496113_0830119 3300048916 Bacteria 733
204 Ga0496114_0002914 3300048917 Bacteria 13116
205 Ga0496115_0020621 3300048918 Bacteria 5085
206 Ga0501031_0020260 3300049568 Bacteria 4336
207 Ga0501032_0015594 3300049569 Bacteria 5359
208 Ga0501033_0019472 3300049570 Bacteria 5133
209 Ga0501034_0064138 3300049571 Bacteria 3687
210 Ga0501036_0006769 3300049572 Bacteria 9310
211 Ga0501037_0005038 3300049573 Bacteria 9612
212 Ga0501038_0022323 3300049574 Bacteria 5673
213 Ga0501039_0079414 3300049575 Bacteria 2552
214 Ga0501039_0477283 3300049575 Bacteria 979
215 Ga0501040_0452953 3300049576 Bacteria 924
216 Ga0501041_0519820 3300049577 Bacteria 758
217 Ga0501042_0018710 3300049578 Bacteria 4800
218 Ga0501043_0012112 3300049579 Bacteria 6744
219 Ga0501046_0005818 3300049580 Bacteria 10999
220 Ga0501047_0050740 3300049581 Bacteria 4006
221 Ga0501048_0017172 3300049582 Bacteria 5333
222 Ga0501048_0310805 3300049582 Bacteria 1122
223 Ga0501068_0005991 3300049584 Bacteria 6675
224 Ga0501070_0041157 3300049586 Bacteria 3849
225 Ga0501070_0370045 3300049586 Bacteria 1162
226 Ga0501071_0024262 3300049587 Bacteria 4241
227 Ga0501072_0045044 3300049588 Bacteria 3468
228 Ga0501072_0117361 3300049588 Bacteria 2120
229 Ga0501073_0064612 3300049589 Bacteria 2552
230 Ga0501075_0007890 3300049591 Bacteria 7391
231 Ga0501075_0204329 3300049591 Bacteria 1507
232 Ga0501076_0076134 3300049592 Bacteria 2691
233 Ga0501076_0561433 3300049592 Bacteria 941
234 Ga0501077_0367996 3300049593 Bacteria 918
235 Ga0501077_1084639 3300049593 Bacteria 515
236 Ga0501079_0269940 3300049741 Bacteria 1330
237 Ga0501079_0388109 3300049741 Bacteria 1095
238 Ga0501080_0030758 3300049742 Bacteria 5002
239 Ga0501081_0708749 3300049743 Bacteria 756
240 Ga0501083_0014825 3300049744 Bacteria 5451
241 Ga0501035_0003300 3300049822 Bacteria 15468
242 Ga0501044_0143471 3300049823 Bacteria 2375
243 Ga0501045_0352691 3300049824 Bacteria 1095
244 nmdc:mga03n38_337080_c1 3300050490 Bacteria 818
245 nmdc:mga03n38_340707_c1 3300050490 Bacteria 814
246 nmdc:mga00v17_191340_c1 3300050491 Bacteria 1322
247 nmdc:mga00v17_494032_c1 3300050491 Bacteria 793
248 nmdc:mga00v17_99775_c1 3300050491 Bacteria 1832
249 nmdc:mga0yw44_226888_c1 3300050492 Bacteria 1239
250 nmdc:mga0yw44_533551_c1 3300050492 Bacteria 797
251 nmdc:mga06z11_149310_c1 3300050494 Bacteria 1327
252 nmdc:mga06z11_222220_c1 3300050494 Bacteria 1104
253 nmdc:mga06z11_301229_c1 3300050494 Bacteria 953
254 nmdc:mga07m45_441912_c1 3300050496 Bacteria 754
255 nmdc:mga07m45_865447_c1 3300050496 Bacteria 517
256 Ga0495655_0100123 3300053083 Bacteria 857
257 Ga0495619_0156673 3300053085 Bacteria 1572
258 Ga0500556_0001722 3300053104 Bacteria 8278
259 Ga0500616_0012010 3300053153 Bacteria 5086
260 Ga0500599_010337 3300053736 Bacteria 1233
261 Ga0501084_0015007 3300054114 Bacteria 6423
262 Ga0501082_0067616 3300060353 Bacteria 3077
263 Ga0466962_0210380 3300061719 Bacteria 951
264 Ga0501069_0352764
265 Ga0070683_100940243
266 Ga0070682_100056595
267 Ga0068868_100095826
268 Ga0070660_100091147
269 Ga0070692_10002055
270 Ga0070659_100000002
271 Ga0070659_100075274
272 Ga0070714_100000170
273 Ga0070714_100036595
274 Ga0070714_100139430
275 Ga0070710_10403999
276 Ga0070701_10058776
277 Ga0070711_100654270
278 Ga0070705_100002415
279 Ga0070705_101387202
280 Ga0070708_100702756
281 Ga0070678_100322142
282 Ga0070706_100928783
283 Ga0070707_100446300
284 Ga0070684_100105921
285 Ga0070686_100661603
286 Ga0070693_100350193
287 Ga0068859_100973721
288 Ga0068863_100342689
289 Ga0068862_102452716
290 Ga0081538_10001249
291 Ga0081538_10002055
292 Ga0081539_10086307
293 Ga0081539_10156089
294 Ga0070717_10000005
295 Ga0075365_10149209
296 Ga0075365_10482601
297 Ga0075365_10863671
298 Ga0075363_100502102
299 Ga0075364_10129904
300 Ga0075364_10179417
301 Ga0075364_10527277
302 Ga0070715_10156683
303 Ga0070716_100009586
304 Ga0070712_100000036
305 Ga0075367_10068986
306 Ga0075367_10127919
307 Ga0075367_10343352
308 Ga0075429_100010275
309 Ga0068865_100276349
310 Ga0097620_100973851
311 Ga0105240_10141499
312 Ga0105245_10078545
313 Ga0105247_10352808
314 Ga0114129_10418127
315 Ga0105243_10247514
316 Ga0105243_11129864
317 Ga0105249_10848622
318 Ga0105239_10019708
319 Ga0105246_10028385
320 Ga0157371_10004276
321 Ga0157378_11847286
322 Ga0163162_10604167
323 Ga0163162_11136423
324 Ga0157372_12639626
325 Ga0157375_11026999
326 Ga0157375_11812477
327 Ga0157377_10365084
328 Ga0157376_10290085
329 Ga0157376_10618272
330 Ga0206354_11134798
331 Ga0213876_10006056
332 Ga0213875_10139542
333 Ga0207647_10428051
334 Ga0207699_10853387
335 Ga0207684_11369666
336 Ga0207695_10147282
337 Ga0207693_10000001
338 Ga0207663_10069936
339 Ga0207657_10088092
340 Ga0207694_10466949
341 Ga0207687_10000350
342 Ga0207664_10000035
343 Ga0207664_10058730
344 Ga0207664_10116794
345 Ga0207664_10357651
346 Ga0207664_10532063
347 Ga0207690_10000024
348 Ga0207670_10129878
349 Ga0207704_10129943
350 Ga0207704_10403850
351 Ga0207665_10023383
352 Ga0207665_10234190
353 Ga0207661_10899259
354 Ga0207703_10558221
355 Ga0207703_10652534
356 Ga0207639_10275063
357 Ga0207676_11604121
358 Ga0207675_100836825
359 Ga0207683_10023271
360 Ga0207683_10077280
361 Ga0207698_10782363
362 Ga0268265_10634768
363 Ga0268264_12460043
364 Ga0265326_10000004
365 Ga0265326_10055075
366 Ga0265319_1001220
367 Ga0265334_10000019
368 Ga0265322_10103033
369 Ga0265336_10009001
370 Ga0265338_10010536
371 Ga0265324_10000344
372 Ga0265320_10031974
373 Ga0265340_10391445
374 Ga0265327_10015415
375 Ga0307405_10410897
376 Ga0307410_10353939
377 Ga0326468_10043920
378 Ga0307406_10685317
379 Ga0307406_10882636
380 Ga0307416_100623956
381 Ga0307415_100172092
382 Ga0373943_0286877
383 Ga0373937_0518251
384 Ga0395900_0010194
385 Ga0395900_0727683
386 Ga0395905_0056790
387 Ga0436364_1479716
388 Ga0395901_0012828
389 Ga0436365_1652791
390 Ga0436363_1075476
391 Ga0436362_0503690
392 Ga0451802_0792536
393 Ga0466969_0280995
394 Ga0466966_0306182
395 Ga0466966_0446490
396 Ga0466966_0522906
397 Ga0466961_0610510
398 Ga0466961_0838480
399 Ga0466961_0887024
400 Ga0466964_0066477
401 Ga0466964_0420828
402 Ga0466971_0380575
403 Ga0466968_0073918
404 Ga0466970_0747478
405 Ga0466957_0675986
406 Ga0466960_0016798
407 Ga0466958_0071667
408 Ga0466958_0076419
409 Ga0466958_0400427
410 Ga0466967_0020715
411 Ga0466967_0883500
412 Ga0466967_0899064
413 Ga0466967_1456249
414 Ga0466967_1559723
415 Ga0495603_0147565
416 Ga0495603_0387079
417 Ga0495629_0088598
418 Ga0495629_0368621
419 Ga0495641_0004850
420 Ga0495641_0022622
421 Ga0495641_0273869
422 Ga0495582_0241119
423 Ga0495662_0051726
424 Ga0495594_0214253
425 Ga0495620_0001840
426 Ga0495620_0019184
427 Ga0495631_0101248
428 Ga0495631_0235973
429 Ga0495644_0006704
430 Ga0495609_0161429
431 Ga0495656_0098159
432 Ga0495588_0484829
433 Ga0495657_0352865
434 Ga0495647_0525553
435 Ga0495649_0384511
436 Ga0495589_0066325
437 Ga0495676_0021047
438 Ga0495680_0507468
439 Ga0495673_0056907
440 Ga0495681_0094167
441 Ga0495686_0000003
442 Ga0495686_0015164
443 Ga0495686_0031443
444 Ga0495686_0551718
445 Ga0495614_0060947
446 Ga0495615_0046463
447 Ga0496100_0001713
448 Ga0496100_0003315
449 Ga0496100_0386454
450 Ga0496101_0000505
451 Ga0496101_0164761
452 Ga0496102_0006785
453 Ga0496103_0000683
454 Ga0496103_0784992
455 Ga0496104_1003987
456 Ga0496105_0153986
457 Ga0496106_0008812
458 Ga0496107_0003466
459 Ga0496108_0055885
460 Ga0496109_0007683
461 Ga0496110_0569648
462 Ga0496111_0007391
463 Ga0496112_0019800
464 Ga0496113_0062171
465 Ga0496113_0303023
466 Ga0496113_0830119
467 Ga0496114_0002914
468 Ga0496115_0020621
469 Ga0501031_0020260
470 Ga0501032_0015594
471 Ga0501033_0019472
472 Ga0501034_0064138
473 Ga0501036_0006769
474 Ga0501037_0005038
475 Ga0501038_0022323
476 Ga0501039_0079414
477 Ga0501039_0477283
478 Ga0501040_0452953
479 Ga0501041_0519820
480 Ga0501042_0018710
481 Ga0501043_0012112
482 Ga0501046_0005818
483 Ga0501047_0050740
484 Ga0501048_0017172
485 Ga0501048_0310805
486 Ga0501068_0005991
487 Ga0501070_0041157
488 Ga0501070_0370045
489 Ga0501071_0024262
490 Ga0501072_0045044
491 Ga0501072_0117361
492 Ga0501073_0064612
493 Ga0501075_0007890
494 Ga0501075_0204329
495 Ga0501076_0076134
496 Ga0501076_0561433
497 Ga0501077_0367996
498 Ga0501077_1084639
499 Ga0501079_0269940
500 Ga0501079_0388109
501 Ga0501080_0030758
502 Ga0501081_0708749
503 Ga0501083_0014825
504 Ga0501035_0003300
505 Ga0501044_0143471
506 Ga0501045_0352691
507 nmdc:mga03n38_337080_c1
508 nmdc:mga03n38_340707_c1
509 nmdc:mga00v17_191340_c1
510 nmdc:mga00v17_494032_c1
511 nmdc:mga00v17_99775_c1
512 nmdc:mga0yw44_226888_c1
513 nmdc:mga0yw44_533551_c1
514 nmdc:mga06z11_149310_c1
515 nmdc:mga06z11_222220_c1
516 nmdc:mga06z11_301229_c1
517 nmdc:mga07m45_441912_c1
518 nmdc:mga07m45_865447_c1
519 Ga0495655_0100123
520 Ga0495619_0156673
521 Ga0500556_0001722
522 Ga0500616_0012010
523 Ga0500599_010337
524 Ga0501084_0015007
525 Ga0501082_0067616
526 Ga0466962_0210380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

39

149

0.97

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

37

162

0.91

PF13468

Glyoxalase_3

Glyoxalase-like domain

38

162

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9769 4 137
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.957 2 134
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9491 4 137
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9488 1 134
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.9484 1 133
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9855 4 133 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9709 2 134 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9564 4 133 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9365 2 134 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9055 1 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V9PNI7-F1-model_v4 VOC family protein 0.9986 3 79 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9MI44-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9953 1 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A537XEP2-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.99 1 135 GO:0004493
GO:0046491
GO:0046872
AF-A0A536R733-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9892 4 132 GO:0004493
GO:0046491
GO:0046872
AF-A0A2V8HZV4-F1-model_v4 Methylmalonyl Co-A mutase-associated GTPase MeaB 0.9883 4 134 GO:0003924
GO:0005525
GO:0016887

Map