F372113

General Info

Members Datasets Scaffolds Average Seq Length
263 165 526 299

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0078399|Ga0495623_0078399_732_1751
Length 339
Sequence MSVSLRGYDRSGVHFRNNRSSDRIFWRASIVFQVEGVMSNPPVPAELVAAREQFLALVAELRPDLHRYCARLVGSAIDGEDVVQEALAKAFYAISLQPELPPLKPWLFRIAHNTAIDFLRRYERRFVEPMADPPEPVLADPGADPDVMRAALSSFVALPVSQRSAVILKDVLGHSLEEIATSTGTTVAAVKAALVRGRANLRARNQPDFTPWRDRAETSPEERALVSRYVSLFNARDWQGVRDMLLEECRLDLVSKSARRGKAVGLYFDRYAKEHELRFAVGVAEGRDVIGVFRGDGARPEYVILVDFDGDRVALIRDYRYVTYVAEELQFDAHDGGAR

Samples

Sample ID Description Type Environment
1 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
160 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 5.32
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 14.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495623_0078399 3300046679 Bacteria 2048
2 rootL2_10142956 3300003322 Unclassified 2366
3 rootH1_10036714 3300003323 Bacteria 8453
4 rootH1_10040618 3300003323 Bacteria 8083
5 rootH1_10149343 3300003323 Bacteria 6407
6 rootH1_10313642 3300003323 Unclassified 2215
7 Ga0065707_10107689 3300005295 Bacteria 2544
8 Ga0070683_100223573 3300005329 Bacteria 1789
9 Ga0070670_100128888 3300005331 Unclassified 2184
10 Ga0070670_100159520 3300005331 Bacteria 1954
11 Ga0070666_10186223 3300005335 Bacteria 1458
12 Ga0070680_100012257 3300005336 Bacteria 6658
13 Ga0070680_100177613 3300005336 Bacteria 1793
14 Ga0070660_100207972 3300005339 Bacteria 1588
15 Ga0070689_100034725 3300005340 Bacteria 3848
16 Ga0070689_100055260 3300005340 Bacteria 3076
17 Ga0070689_100457853 3300005340 Bacteria 1086
18 Ga0070668_100116780 3300005347 Bacteria 2128
19 Ga0070675_100027211 3300005354 Bacteria 4593
20 Ga0070671_100006429 3300005355 Bacteria 9389
21 Ga0070667_100019182 3300005367 Bacteria 5671
22 Ga0070667_100046083 3300005367 Bacteria 3667
23 Ga0070713_100082378 3300005436 Unclassified 2747
24 Ga0070711_100060308 3300005439 Unclassified 2637
25 Ga0070694_100035739 3300005444 Bacteria 3287
26 Ga0070681_10216031 3300005458 Unclassified 1833
27 Ga0070698_100078758 3300005471 Bacteria 3294
28 Ga0070698_100135795 3300005471 Bacteria 2413
29 Ga0070699_100153038 3300005518 Bacteria 2040
30 Ga0070679_100162395 3300005530 Unclassified 2208
31 Ga0070684_100139973 3300005535 Bacteria 2188
32 Ga0068853_100054219 3300005539 Bacteria 3455
33 Ga0070665_100010244 3300005548 Bacteria 9486
34 Ga0070665_100022086 3300005548 Bacteria 6401
35 Ga0070665_100033767 3300005548 Bacteria 5146
36 Ga0070665_100103737 3300005548 Bacteria 2846
37 Ga0070665_100129422 3300005548 Unclassified 2526
38 Ga0070665_100248239 3300005548 Bacteria 1780
39 Ga0070665_100328553 3300005548 Bacteria 1534
40 Ga0070704_100197627 3300005549 Bacteria 1621
41 Ga0068855_100010142 3300005563 Bacteria 11353
42 Ga0068855_100488936 3300005563 Bacteria 1339
43 Ga0068856_100158061 3300005614 Bacteria 2277
44 Ga0068859_100000036 3300005617 Bacteria 169326
45 Ga0068859_100027775 3300005617 Bacteria 5675
46 Ga0068859_100100120 3300005617 Bacteria 2954
47 Ga0068864_100154742 3300005618 Bacteria 2080
48 Ga0068863_100023966 3300005841 Bacteria 5824
49 Ga0068863_100128487 3300005841 Bacteria 2418
50 Ga0068858_100000418 3300005842 Bacteria 44177
51 Ga0068858_100085979 3300005842 Bacteria 2926
52 Ga0068858_100237201 3300005842 Bacteria 1730
53 Ga0068860_100002002 3300005843 Bacteria 21489
54 Ga0068860_100080546 3300005843 Bacteria 3096
55 Ga0068862_100000058 3300005844 Bacteria 138649
56 Ga0068862_100034217 3300005844 Bacteria 4298
57 Ga0068862_100105811 3300005844 Bacteria 2466
58 Ga0070717_10168026 3300006028 Bacteria 1906
59 Ga0070717_10333572 3300006028 Bacteria 1353
60 Ga0075366_10010931 3300006195 Bacteria 5108
61 Ga0097621_100180503 3300006237 Bacteria 1824
62 Ga0075430_100073991 3300006846 Unclassified 2856
63 Ga0075431_100007796 3300006847 Bacteria 10662
64 Ga0075429_100090704 3300006880 Unclassified 2665
65 Ga0075429_100272703 3300006880 Bacteria 1482
66 Ga0068865_100012021 3300006881 Bacteria 5439
67 Ga0075436_100056392 3300006914 Bacteria 2713
68 Ga0097620_100000036 3300006931 Bacteria 169326
69 Ga0097620_100027775 3300006931 Bacteria 5675
70 Ga0097620_100100118 3300006931 Bacteria 2954
71 Ga0097620_100266423 3300006931 Bacteria 1805
72 Ga0075435_100171942 3300007076 Bacteria 1828
73 Ga0075435_100375045 3300007076 Bacteria 1222
74 Ga0099794_10025692 3300007265 Bacteria 2715
75 Ga0099794_10043305 3300007265 Bacteria 2148
76 Ga0099794_10078018 3300007265 Bacteria 1630
77 Ga0099795_10005677 3300007788 Bacteria 3343
78 Ga0105250_10029200 3300009092 Bacteria 2219
79 Ga0105240_10031436 3300009093 Bacteria 6885
80 Ga0105240_10050251 3300009093 Bacteria 5258
81 Ga0105240_10072973 3300009093 Unclassified 4239
82 Ga0105240_10101701 3300009093 Bacteria 3495
83 Ga0105240_10243704 3300009093 Unclassified 2082
84 Ga0111539_10269824 3300009094 Bacteria 1981
85 Ga0105245_10000009 3300009098 Bacteria 279713
86 Ga0105247_10000267 3300009101 Bacteria 48481
87 Ga0105247_10002330 3300009101 Bacteria 12976
88 Ga0105247_10023223 3300009101 Bacteria 3736
89 Ga0105248_10018835 3300009177 Bacteria 7635
90 Ga0105248_10067163 3300009177 Bacteria 4025
91 Ga0105248_10097027 3300009177 Unclassified 3321
92 Ga0105237_10044650 3300009545 Bacteria 4462
93 Ga0105237_10178336 3300009545 Bacteria 2125
94 Ga0105237_10406585 3300009545 Bacteria 1366
95 Ga0105237_10438730 3300009545 Bacteria 1311
96 Ga0105238_10038748 3300009551 Bacteria 4839
97 Ga0105238_10117555 3300009551 Unclassified 2639
98 Ga0105238_10185709 3300009551 Bacteria 2055
99 Ga0105238_10194522 3300009551 Unclassified 2004
100 Ga0105238_10252395 3300009551 Bacteria 1742
101 Ga0105249_10087517 3300009553 Bacteria 2907
102 Ga0105249_10152641 3300009553 Bacteria 2225
103 Ga0099796_10003240 3300010159 Bacteria 3739
104 Ga0099796_10004526 3300010159 Bacteria 3376
105 Ga0105239_10277647 3300010375 Bacteria 1886
106 Ga0157370_10031127 3300013104 Bacteria 5222
107 Ga0157374_10276187 3300013296 Unclassified 1658
108 Ga0163162_10000030 3300013306 Bacteria 163717
109 Ga0163162_10003881 3300013306 Bacteria 14350
110 Ga0163162_10099075 3300013306 Bacteria 3005
111 Ga0163162_10208087 3300013306 Unclassified 2086
112 Ga0157372_10027255 3300013307 Bacteria 6220
113 Ga0157375_10020662 3300013308 Bacteria 6020
114 Ga0163163_10016883 3300014325 Bacteria 6795
115 Ga0163163_10065385 3300014325 Bacteria 3610
116 Ga0157379_10014623 3300014968 Bacteria 6881
117 Ga0157379_10061177 3300014968 Bacteria 3368
118 Ga0157379_10169434 3300014968 Bacteria 1971
119 Ga0157376_10002972 3300014969 Bacteria 11623
120 Ga0157376_10039953 3300014969 Bacteria 3831
121 Ga0157376_10261045 3300014969 Unclassified 1623
122 Ga0157376_10262306 3300014969 Unclassified 1619
123 Ga0213872_10019761 3300021361 Unclassified 3102
124 Ga0207696_1050363 3300025711 Bacteria 1192
125 Ga0207710_10001263 3300025900 Bacteria 12791
126 Ga0207710_10024081 3300025900 Bacteria 2620
127 Ga0207710_10032828 3300025900 Bacteria 2275
128 Ga0207680_10043067 3300025903 Bacteria 2645
129 Ga0207707_10027493 3300025912 Unclassified 4974
130 Ga0207707_10052202 3300025912 Bacteria 3561
131 Ga0207695_10030082 3300025913 Bacteria 5985
132 Ga0207695_10191264 3300025913 Unclassified 1964
133 Ga0207660_10035005 3300025917 Bacteria 3484
134 Ga0207660_10120661 3300025917 Bacteria 1985
135 Ga0207662_10118103 3300025918 Bacteria 1660
136 Ga0207652_10005665 3300025921 Bacteria 10132
137 Ga0207652_10054490 3300025921 Bacteria 3438
138 Ga0207694_10042309 3300025924 Bacteria 3514
139 Ga0207694_10306308 3300025924 Bacteria 1309
140 Ga0207694_10307901 3300025924 Bacteria 1305
141 Ga0207687_10000045 3300025927 Bacteria 99967
142 Ga0207644_10012632 3300025931 Bacteria 5613
143 Ga0207644_10244978 3300025931 Bacteria 1428
144 Ga0207686_10002065 3300025934 Bacteria 11068
145 Ga0207670_10039238 3300025936 Bacteria 3100
146 Ga0207704_10018945 3300025938 Bacteria 3605
147 Ga0207711_10054683 3300025941 Bacteria 3426
148 Ga0207711_10223644 3300025941 Unclassified 1722
149 Ga0207711_10339000 3300025941 Bacteria 1391
150 Ga0207667_10010882 3300025949 Bacteria 10609
151 Ga0207667_10436012 3300025949 Bacteria 1332
152 Ga0207712_10183151 3300025961 Unclassified 1647
153 Ga0207658_10040656 3300025986 Bacteria 3363
154 Ga0207677_10219177 3300026023 Bacteria 1525
155 Ga0207703_10002243 3300026035 Bacteria 16902
156 Ga0207703_10008627 3300026035 Bacteria 8042
157 Ga0207678_10062845 3300026067 Unclassified 3191
158 Ga0207702_10315493 3300026078 Bacteria 1487
159 Ga0207641_10004999 3300026088 Bacteria 11370
160 Ga0207641_10129105 3300026088 Bacteria 2267
161 Ga0207641_10142694 3300026088 Bacteria 2163
162 Ga0207676_10474431 3300026095 Bacteria 1184
163 Ga0207675_100057932 3300026118 Bacteria 3615
164 Ga0207683_10412862 3300026121 Unclassified 1243
165 Ga0209588_1019423 3300027671 Bacteria 2120
166 Ga0265356_1008232 3300028017 Bacteria 1191
167 Ga0268266_10024175 3300028379 Bacteria 5170
168 Ga0268265_10000075 3300028380 Bacteria 126053
169 Ga0268265_10011950 3300028380 Bacteria 5875
170 Ga0268264_10000499 3300028381 Bacteria 51388
171 Ga0268264_10024055 3300028381 Bacteria 4970
172 Ga0265334_10016258 3300028573 Bacteria 3079
173 Ga0265318_10001596 3300028577 Bacteria 13112
174 Ga0307517_10049143 3300028786 Bacteria 4323
175 Ga0307515_10000006 3300028794 Bacteria 725810
176 Ga0307515_10020599 3300028794 Bacteria 11750
177 Ga0265338_10052697 3300028800 Bacteria 3647
178 Ga0265338_10198312 3300028800 Bacteria 1515
179 Ga0307511_10000035 3300030521 Bacteria 104063
180 Ga0265325_10001184 3300031241 Bacteria 18612
181 Ga0265340_10040164 3300031247 Bacteria 2306
182 Ga0265339_10002670 3300031249 Bacteria 12698
183 Ga0265339_10155998 3300031249 Unclassified 1151
184 Ga0265316_10001021 3300031344 Bacteria 30377
185 Ga0265316_10003172 3300031344 Bacteria 16721
186 Ga0307509_10000226 3300031507 Bacteria 90768
187 Ga0307509_10003077 3300031507 Bacteria 25910
188 Ga0307509_10053809 3300031507 Bacteria 4289
189 Ga0307509_10063327 3300031507 Bacteria 3894
190 Ga0307509_10155449 3300031507 Bacteria 2194
191 Ga0265313_10024054 3300031595 Bacteria 3263
192 Ga0265314_10000001 3300031711 Bacteria 3792860
193 Ga0265314_10056599 3300031711 Bacteria 2698
194 Ga0265342_10014781 3300031712 Bacteria 5170
195 Ga0307510_10000010 3300033180 Bacteria 377457
196 Ga0307510_10047305 3300033180 Bacteria 4611
197 Ga0373949_0000494 3300035090 Bacteria 13367
198 Ga0373961_0000003 3300035241 Bacteria 149339
199 Ga0373933_0070944 3300035724 Unclassified 2120
200 Ga0373937_0090286 3300036401 Unclassified 2837
201 Ga0395898_0166690 3300037466 Bacteria 2107
202 Ga0395905_0013795 3300037471 Bacteria 7733
203 Ga0466969_0001104 3300044656 Bacteria 14551
204 Ga0466966_0000078 3300044684 Bacteria 62090
205 Ga0466966_0050870 3300044684 Bacteria 2635
206 Ga0466961_0120228 3300044693 Bacteria 1649
207 Ga0466963_0030682 3300044694 Bacteria 3471
208 Ga0466971_0003602 3300044719 Bacteria 6617
209 Ga0466960_0043549 3300044901 Unclassified 2136
210 Ga0466967_0280778 3300045976 Bacteria 1598
211 Ga0495629_0211910 3300046459 Bacteria 1338
212 Ga0495580_0000595 3300046472 Bacteria 30578
213 Ga0495580_0050918 3300046472 Bacteria 2928
214 Ga0495628_0234089 3300046516 Bacteria 1376
215 Ga0495632_0135371 3300046519 Bacteria 1145
216 Ga0495658_0039095 3300046683 Bacteria 2631
217 Ga0495613_0174280 3300046689 Bacteria 1525
218 Ga0495636_0036846 3300047318 Bacteria 2019
219 Ga0495686_0027796 3300047472 Bacteria 3689
220 Ga0495593_0127726 3300047673 Bacteria 1292
221 Ga0495602_0093942 3300048088 Bacteria 2480
222 Ga0496102_0051666 3300048905 Bacteria 3745
223 Ga0496102_0075455 3300048905 Unclassified 3100
224 Ga0496103_0112683 3300048906 Unclassified 1728
225 Ga0496104_0000057 3300048907 Bacteria 119211
226 Ga0496105_0000037 3300048908 Bacteria 119355
227 Ga0496106_0049727 3300048909 Bacteria 3159
228 Ga0496110_0466448 3300048913 Bacteria 1151
229 Ga0496111_0313313 3300048914 Bacteria 1163
230 Ga0496112_0007912 3300048915 Bacteria 9469
231 Ga0496113_0025370 3300048916 Bacteria 4224
232 Ga0496114_0054347 3300048917 Bacteria 3339
233 Ga0496115_0064976 3300048918 Bacteria 2947
234 Ga0496115_0161293 3300048918 Bacteria 1853
235 Ga0496115_0213959 3300048918 Unclassified 1592
236 Ga0496117_0000152 3300048920 Bacteria 147897
237 Ga0496118_0000052 3300048921 Bacteria 237465
238 Ga0496119_0000275 3300048922 Bacteria 72619
239 Ga0496119_0001275 3300048922 Bacteria 31240
240 Ga0496119_0052678 3300048922 Bacteria 2491
241 Ga0496120_0000286 3300048923 Bacteria 84869
242 Ga0496121_0016441 3300048924 Bacteria 7641
243 Ga0496121_0076314 3300048924 Unclassified 2672
244 Ga0496121_0171077 3300048924 Bacteria 1578
245 Ga0496125_0001192 3300048928 Bacteria 39310
246 Ga0496125_0015552 3300048928 Bacteria 7350
247 Ga0496126_0039757 3300048929 Bacteria 4362
248 Ga0496126_0289426 3300048929 Unclassified 1355
249 nmdc:mga0k408_8593_c1 3300050493 Bacteria 5487
250 nmdc:mga09592_14437_c1 3300050508 Bacteria 6447
251 nmdc:mga09592_23686_c1 3300050508 Bacteria 5071
252 nmdc:mga09592_361121_c1 3300050508 Bacteria 1257
253 nmdc:mga0qj67_86689_c1 3300050509 Bacteria 2512
254 nmdc:mga06r32_332724_c1 3300050510 Unclassified 1504
255 nmdc:mga0rr50_485712_c1 3300050513 Bacteria 1049
256 Ga0500635_0006681 3300053080 Bacteria 3089
257 Ga0500583_0009854 3300053092 Bacteria 3515
258 Ga0500566_0002646 3300053094 Bacteria 10664
259 Ga0500614_003128 3300053123 Unclassified 3592
260 Ga0500568_0028441 3300053139 Bacteria 2330
261 Ga0500603_001852 3300053150 Bacteria 4733
262 Ga0500622_0067249 3300053156 Bacteria 1818
263 Ga0466962_0003230 3300061719 Bacteria 7746
264 Ga0495623_0078399
265 rootL2_10142956
266 rootH1_10036714
267 rootH1_10040618
268 rootH1_10149343
269 rootH1_10313642
270 Ga0065707_10107689
271 Ga0070683_100223573
272 Ga0070670_100128888
273 Ga0070670_100159520
274 Ga0070666_10186223
275 Ga0070680_100012257
276 Ga0070680_100177613
277 Ga0070660_100207972
278 Ga0070689_100034725
279 Ga0070689_100055260
280 Ga0070689_100457853
281 Ga0070668_100116780
282 Ga0070675_100027211
283 Ga0070671_100006429
284 Ga0070667_100019182
285 Ga0070667_100046083
286 Ga0070713_100082378
287 Ga0070711_100060308
288 Ga0070694_100035739
289 Ga0070681_10216031
290 Ga0070698_100078758
291 Ga0070698_100135795
292 Ga0070699_100153038
293 Ga0070679_100162395
294 Ga0070684_100139973
295 Ga0068853_100054219
296 Ga0070665_100010244
297 Ga0070665_100022086
298 Ga0070665_100033767
299 Ga0070665_100103737
300 Ga0070665_100129422
301 Ga0070665_100248239
302 Ga0070665_100328553
303 Ga0070704_100197627
304 Ga0068855_100010142
305 Ga0068855_100488936
306 Ga0068856_100158061
307 Ga0068859_100000036
308 Ga0068859_100027775
309 Ga0068859_100100120
310 Ga0068864_100154742
311 Ga0068863_100023966
312 Ga0068863_100128487
313 Ga0068858_100000418
314 Ga0068858_100085979
315 Ga0068858_100237201
316 Ga0068860_100002002
317 Ga0068860_100080546
318 Ga0068862_100000058
319 Ga0068862_100034217
320 Ga0068862_100105811
321 Ga0070717_10168026
322 Ga0070717_10333572
323 Ga0075366_10010931
324 Ga0097621_100180503
325 Ga0075430_100073991
326 Ga0075431_100007796
327 Ga0075429_100090704
328 Ga0075429_100272703
329 Ga0068865_100012021
330 Ga0075436_100056392
331 Ga0097620_100000036
332 Ga0097620_100027775
333 Ga0097620_100100118
334 Ga0097620_100266423
335 Ga0075435_100171942
336 Ga0075435_100375045
337 Ga0099794_10025692
338 Ga0099794_10043305
339 Ga0099794_10078018
340 Ga0099795_10005677
341 Ga0105250_10029200
342 Ga0105240_10031436
343 Ga0105240_10050251
344 Ga0105240_10072973
345 Ga0105240_10101701
346 Ga0105240_10243704
347 Ga0111539_10269824
348 Ga0105245_10000009
349 Ga0105247_10000267
350 Ga0105247_10002330
351 Ga0105247_10023223
352 Ga0105248_10018835
353 Ga0105248_10067163
354 Ga0105248_10097027
355 Ga0105237_10044650
356 Ga0105237_10178336
357 Ga0105237_10406585
358 Ga0105237_10438730
359 Ga0105238_10038748
360 Ga0105238_10117555
361 Ga0105238_10185709
362 Ga0105238_10194522
363 Ga0105238_10252395
364 Ga0105249_10087517
365 Ga0105249_10152641
366 Ga0099796_10003240
367 Ga0099796_10004526
368 Ga0105239_10277647
369 Ga0157370_10031127
370 Ga0157374_10276187
371 Ga0163162_10000030
372 Ga0163162_10003881
373 Ga0163162_10099075
374 Ga0163162_10208087
375 Ga0157372_10027255
376 Ga0157375_10020662
377 Ga0163163_10016883
378 Ga0163163_10065385
379 Ga0157379_10014623
380 Ga0157379_10061177
381 Ga0157379_10169434
382 Ga0157376_10002972
383 Ga0157376_10039953
384 Ga0157376_10261045
385 Ga0157376_10262306
386 Ga0213872_10019761
387 Ga0207696_1050363
388 Ga0207710_10001263
389 Ga0207710_10024081
390 Ga0207710_10032828
391 Ga0207680_10043067
392 Ga0207707_10027493
393 Ga0207707_10052202
394 Ga0207695_10030082
395 Ga0207695_10191264
396 Ga0207660_10035005
397 Ga0207660_10120661
398 Ga0207662_10118103
399 Ga0207652_10005665
400 Ga0207652_10054490
401 Ga0207694_10042309
402 Ga0207694_10306308
403 Ga0207694_10307901
404 Ga0207687_10000045
405 Ga0207644_10012632
406 Ga0207644_10244978
407 Ga0207686_10002065
408 Ga0207670_10039238
409 Ga0207704_10018945
410 Ga0207711_10054683
411 Ga0207711_10223644
412 Ga0207711_10339000
413 Ga0207667_10010882
414 Ga0207667_10436012
415 Ga0207712_10183151
416 Ga0207658_10040656
417 Ga0207677_10219177
418 Ga0207703_10002243
419 Ga0207703_10008627
420 Ga0207678_10062845
421 Ga0207702_10315493
422 Ga0207641_10004999
423 Ga0207641_10129105
424 Ga0207641_10142694
425 Ga0207676_10474431
426 Ga0207675_100057932
427 Ga0207683_10412862
428 Ga0209588_1019423
429 Ga0265356_1008232
430 Ga0268266_10024175
431 Ga0268265_10000075
432 Ga0268265_10011950
433 Ga0268264_10000499
434 Ga0268264_10024055
435 Ga0265334_10016258
436 Ga0265318_10001596
437 Ga0307517_10049143
438 Ga0307515_10000006
439 Ga0307515_10020599
440 Ga0265338_10052697
441 Ga0265338_10198312
442 Ga0307511_10000035
443 Ga0265325_10001184
444 Ga0265340_10040164
445 Ga0265339_10002670
446 Ga0265339_10155998
447 Ga0265316_10001021
448 Ga0265316_10003172
449 Ga0307509_10000226
450 Ga0307509_10003077
451 Ga0307509_10053809
452 Ga0307509_10063327
453 Ga0307509_10155449
454 Ga0265313_10024054
455 Ga0265314_10000001
456 Ga0265314_10056599
457 Ga0265342_10014781
458 Ga0307510_10000010
459 Ga0307510_10047305
460 Ga0373949_0000494
461 Ga0373961_0000003
462 Ga0373933_0070944
463 Ga0373937_0090286
464 Ga0395898_0166690
465 Ga0395905_0013795
466 Ga0466969_0001104
467 Ga0466966_0000078
468 Ga0466966_0050870
469 Ga0466961_0120228
470 Ga0466963_0030682
471 Ga0466971_0003602
472 Ga0466960_0043549
473 Ga0466967_0280778
474 Ga0495629_0211910
475 Ga0495580_0000595
476 Ga0495580_0050918
477 Ga0495628_0234089
478 Ga0495632_0135371
479 Ga0495658_0039095
480 Ga0495613_0174280
481 Ga0495636_0036846
482 Ga0495686_0027796
483 Ga0495593_0127726
484 Ga0495602_0093942
485 Ga0496102_0051666
486 Ga0496102_0075455
487 Ga0496103_0112683
488 Ga0496104_0000057
489 Ga0496105_0000037
490 Ga0496106_0049727
491 Ga0496110_0466448
492 Ga0496111_0313313
493 Ga0496112_0007912
494 Ga0496113_0025370
495 Ga0496114_0054347
496 Ga0496115_0064976
497 Ga0496115_0161293
498 Ga0496115_0213959
499 Ga0496117_0000152
500 Ga0496118_0000052
501 Ga0496119_0000275
502 Ga0496119_0001275
503 Ga0496119_0052678
504 Ga0496120_0000286
505 Ga0496121_0016441
506 Ga0496121_0076314
507 Ga0496121_0171077
508 Ga0496125_0001192
509 Ga0496125_0015552
510 Ga0496126_0039757
511 Ga0496126_0289426
512 nmdc:mga0k408_8593_c1
513 nmdc:mga09592_14437_c1
514 nmdc:mga09592_23686_c1
515 nmdc:mga09592_361121_c1
516 nmdc:mga0qj67_86689_c1
517 nmdc:mga06r32_332724_c1
518 nmdc:mga0rr50_485712_c1
519 Ga0500635_0006681
520 Ga0500583_0009854
521 Ga0500566_0002646
522 Ga0500614_003128
523 Ga0500568_0028441
524 Ga0500603_001852
525 Ga0500622_0067249
526 Ga0466962_0003230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

57

125

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

150

201

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9827 117 167
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9811 112 168
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9659 112 169
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9641 119 169
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9632 113 170
ID Description Score Start End Superfamily
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9827 117 167 1.10.10.10
4cxfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9812 119 169 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9811 112 168 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9678 119 168 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9659 112 169 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0Q7TRW0-F1-model_v4 RNA polymerase subunit sigma-70 0.844 15 299 GO:0003677
GO:0006352
GO:0016987
AF-A0A1E5XTP0-F1-model_v4 RNA polymerase subunit sigma-70 0.8294 17 301 GO:0003677
GO:0006352
GO:0016987
AF-A0A0Q7TRW0-F1-model_v4 RNA polymerase subunit sigma-70 0.8143 15 299 GO:0003677
GO:0006352
GO:0016987
AF-A0A6A7M8E9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.806 12 297 GO:0003677
GO:0006352
GO:0016987
AF-A0A7C3MLF6-F1-model_v4 RNA polymerase sigma factor 0.806 20 171 GO:0003677
GO:0006352
GO:0016987

Map