F371660

General Info

Members Datasets Scaffolds Average Seq Length
263 194 526 88

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100226274|Ga0070714_1002262743
Length 98
Sequence MEAAICSHLDQIEVDRPEEVAGCEECLKIGGHWMHLRVCRKCGQVLCCDSSPNQHASKHAAASGHPIVSSLEPGEDWSWCYLDEVAFILTTDAPETQN

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.6
Nodule 0
Rhizoplane 8.37
Rhizosphere 81.37
Stem 0
Stem Tuber 0
Unclassified 5.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100226274 3300005435 Bacteria 1721
2 JGI25407J50210_10124496 3300003373 Bacteria 635
3 Ga0065704_10160215 3300005289 Bacteria 1360
4 Ga0065707_10082291 3300005295 Bacteria 17356
5 Ga0070690_100163699 3300005330 Bacteria 1526
6 Ga0068869_100015760 3300005334 Bacteria 5079
7 Ga0070666_10975682 3300005335 Unclassified 628
8 Ga0070682_101854778 3300005337 Bacteria 527
9 Ga0070689_100563359 3300005340 Bacteria 983
10 Ga0070687_101095631 3300005343 Bacteria 582
11 Ga0070669_101518936 3300005353 Bacteria 582
12 Ga0070675_101594909 3300005354 Bacteria 602
13 Ga0070673_100575392 3300005364 Bacteria 1025
14 Ga0070673_101041574 3300005364 Bacteria 763
15 Ga0070703_10018890 3300005406 Bacteria 1997
16 Ga0070709_10199652 3300005434 Bacteria 1416
17 Ga0070713_100000307 3300005436 Bacteria 32297
18 Ga0070710_10302596 3300005437 Bacteria 1044
19 Ga0070711_100012008 3300005439 Bacteria 5397
20 Ga0070705_100052621 3300005440 Bacteria 2380
21 Ga0070705_100904524 3300005440 Bacteria 710
22 Ga0070694_100199482 3300005444 Bacteria 1491
23 Ga0070694_100471149 3300005444 Bacteria 995
24 Ga0070708_100887243 3300005445 Bacteria 837
25 Ga0070678_100054660 3300005456 Bacteria 2911
26 Ga0070681_11448685 3300005458 Bacteria 611
27 Ga0070706_100074654 3300005467 Bacteria 3138
28 Ga0070706_100348118 3300005467 Bacteria 1381
29 Ga0070707_100083395 3300005468 Bacteria 3088
30 Ga0070698_100676728 3300005471 Bacteria 973
31 Ga0070699_100037018 3300005518 Bacteria 4222
32 Ga0070699_101489019 3300005518 Unclassified 621
33 Ga0070679_100015885 3300005530 Bacteria 7247
34 Ga0070697_100106965 3300005536 Bacteria 2327
35 Ga0070697_101468729 3300005536 Bacteria 609
36 Ga0068853_100032616 3300005539 Bacteria 4413
37 Ga0070672_101454495 3300005543 Bacteria 614
38 Ga0070686_100046509 3300005544 Bacteria 2739
39 Ga0070686_101052067 3300005544 Bacteria 670
40 Ga0070696_101766087 3300005546 Unclassified 534
41 Ga0070704_100095470 3300005549 Bacteria 2227
42 Ga0070702_100585051 3300005615 Bacteria 834
43 Ga0068852_101453065 3300005616 Bacteria 708
44 Ga0068852_101893884 3300005616 Bacteria 619
45 Ga0068864_100414821 3300005618 Bacteria 1282
46 Ga0068861_100758661 3300005719 Bacteria 907
47 Ga0068858_100199838 3300005842 Bacteria 1890
48 Ga0068860_100236738 3300005843 Bacteria 1775
49 Ga0068860_102189743 3300005843 Bacteria 574
50 Ga0068862_101200432 3300005844 Bacteria 757
51 Ga0081455_10010809 3300005937 Bacteria 9223
52 Ga0081455_10278341 3300005937 Bacteria 1210
53 Ga0081455_10358521 3300005937 Bacteria 1026
54 Ga0081455_10423266 3300005937 Bacteria 918
55 Ga0081538_10005737 3300005981 Bacteria 11094
56 Ga0081538_10006537 3300005981 Bacteria 10240
57 Ga0081538_10322257 3300005981 Bacteria 563
58 Ga0081540_1041704 3300005983 Bacteria 2376
59 Ga0075365_10000241 3300006038 Bacteria 18688
60 Ga0075365_10160556 3300006038 Bacteria 1566
61 Ga0075365_10475650 3300006038 Bacteria 883
62 Ga0075365_10772978 3300006038 Bacteria 678
63 Ga0075364_10085761 3300006051 Bacteria 2086
64 Ga0075364_10193150 3300006051 Bacteria 1379
65 Ga0070716_100059896 3300006173 Bacteria 2196
66 Ga0070712_100008590 3300006175 Bacteria 6427
67 Ga0075362_10152536 3300006177 Bacteria 1109
68 Ga0075367_10244737 3300006178 Bacteria 1124
69 Ga0075366_10150840 3300006195 Bacteria 1408
70 Ga0075370_10205215 3300006353 Bacteria 1163
71 Ga0075430_100647973 3300006846 Bacteria 871
72 Ga0075431_100569160 3300006847 Unclassified 1119
73 Ga0075431_100772960 3300006847 Bacteria 935
74 Ga0075431_101077130 3300006847 Bacteria 769
75 Ga0075433_10039977 3300006852 Bacteria 4058
76 Ga0075434_100033336 3300006871 Bacteria 5082
77 Ga0075429_101795889 3300006880 Bacteria 532
78 Ga0068865_100321851 3300006881 Bacteria 1244
79 Ga0075435_100019214 3300007076 Bacteria 5212
80 Ga0075435_100990992 3300007076 Bacteria 734
81 Ga0099795_10260899 3300007788 Bacteria 750
82 Ga0105245_10002992 3300009098 Bacteria 15150
83 Ga0105245_10042260 3300009098 Bacteria 4067
84 Ga0105245_10150478 3300009098 Bacteria 2200
85 Ga0105247_10131298 3300009101 Bacteria 1633
86 Ga0105243_10108119 3300009148 Bacteria 2321
87 Ga0105241_10239194 3300009174 Bacteria 1534
88 Ga0105241_11124600 3300009174 Bacteria 741
89 Ga0105242_10118578 3300009176 Bacteria 2267
90 Ga0105248_13157738 3300009177 Bacteria 524
91 Ga0105249_10635134 3300009553 Bacteria 1124
92 Ga0105239_10127541 3300010375 Bacteria 2829
93 Ga0157378_11073703 3300013297 Bacteria 841
94 Ga0157378_12222230 3300013297 Bacteria 600
95 Ga0163162_10599242 3300013306 Bacteria 1228
96 Ga0163162_12883366 3300013306 Bacteria 553
97 Ga0157375_11597314 3300013308 Bacteria 771
98 Ga0163163_13173135 3300014325 Bacteria 513
99 Ga0157379_10829136 3300014968 Bacteria 874
100 Ga0157376_10033571 3300014969 Bacteria 4132
101 Ga0157376_10642709 3300014969 Bacteria 1060
102 Ga0157376_11007192 3300014969 Bacteria 856
103 Ga0157376_11425577 3300014969 Bacteria 725
104 Ga0213876_10018339 3300021384 Bacteria 3696
105 Ga0213875_10075920 3300021388 Bacteria 1568
106 Ga0207653_10052414 3300025885 Bacteria 1361
107 Ga0207692_10181981 3300025898 Bacteria 1225
108 Ga0207710_10144837 3300025900 Bacteria 1149
109 Ga0207688_10026761 3300025901 Bacteria 3173
110 Ga0207680_11326851 3300025903 Unclassified 511
111 Ga0207699_10152298 3300025906 Bacteria 1531
112 Ga0207684_10390050 3300025910 Bacteria 1197
113 Ga0207684_10398474 3300025910 Bacteria 1183
114 Ga0207684_10521575 3300025910 Bacteria 1018
115 Ga0207707_10860601 3300025912 Bacteria 752
116 Ga0207693_10003468 3300025915 Bacteria 13457
117 Ga0207657_11145136 3300025919 Unclassified 593
118 Ga0207652_10033013 3300025921 Bacteria 4357
119 Ga0207646_10056125 3300025922 Bacteria 3521
120 Ga0207659_11417170 3300025926 Bacteria 595
121 Ga0207687_10417082 3300025927 Bacteria 1107
122 Ga0207687_10708518 3300025927 Bacteria 855
123 Ga0207687_11149171 3300025927 Unclassified 667
124 Ga0207664_10435256 3300025929 Bacteria 1169
125 Ga0207664_10912616 3300025929 Bacteria 788
126 Ga0207690_10705554 3300025932 Bacteria 830
127 Ga0207686_10649663 3300025934 Bacteria 834
128 Ga0207709_10324447 3300025935 Bacteria 1154
129 Ga0207670_11784882 3300025936 Bacteria 523
130 Ga0207704_10228242 3300025938 Bacteria 1383
131 Ga0207689_11413490 3300025942 Bacteria 583
132 Ga0207651_10282755 3300025960 Bacteria 1372
133 Ga0207677_10453446 3300026023 Bacteria 1099
134 Ga0207703_10131302 3300026035 Bacteria 2163
135 Ga0207639_10153707 3300026041 Bacteria 1930
136 Ga0207676_10516680 3300026095 Bacteria 1136
137 Ga0207676_11353030 3300026095 Bacteria 707
138 Ga0207675_100370379 3300026118 Bacteria 1407
139 Ga0207675_101357058 3300026118 Bacteria 732
140 Ga0207683_10114489 3300026121 Bacteria 2416
141 Ga0207698_11929945 3300026142 Bacteria 605
142 Ga0209813_10442847 3300027866 Bacteria 530
143 Ga0268265_11447111 3300028380 Bacteria 690
144 Ga0268264_10627779 3300028381 Bacteria 1061
145 Ga0307515_10728424 3300028794 Bacteria 609
146 Ga0265313_10201185 3300031595 Bacteria 829
147 Ga0265314_10134461 3300031711 Bacteria 1538
148 Ga0307416_103432686 3300032002 Bacteria 530
149 Ga0373935_1469272 3300035692 Bacteria 510
150 Ga0373947_0158137 3300035725 Bacteria 1464
151 Ga0373937_0110289 3300036401 Bacteria 2559
152 Ga0395899_0188934 3300037312 Bacteria 1442
153 Ga0395899_0740956 3300037312 Bacteria 613
154 Ga0395900_0024600 3300037418 Bacteria 6164
155 Ga0395900_0669592 3300037418 Bacteria 973
156 Ga0395900_0931734 3300037418 Bacteria 791
157 Ga0395900_1334783 3300037418 Bacteria 631
158 Ga0395900_1588122 3300037418 Bacteria 566
159 Ga0395898_0005417 3300037466 Bacteria 13783
160 Ga0395898_0228074 3300037466 Bacteria 1776
161 Ga0395898_0272566 3300037466 Bacteria 1614
162 Ga0395905_0031510 3300037471 Bacteria 4992
163 Ga0395905_0390224 3300037471 Bacteria 1287
164 Ga0395905_0535221 3300037471 Bacteria 1072
165 Ga0436364_0279176 3300037853 Bacteria 7398
166 Ga0395901_0133982 3300038443 Bacteria 2604
167 Ga0395901_0397332 3300038443 Bacteria 1416
168 Ga0395901_0433003 3300038443 Bacteria 1347
169 Ga0395901_1759817 3300038443 Unclassified 570
170 Ga0436365_1084975 3300039437 Bacteria 2845
171 Ga0451839_0457347 3300041496 Bacteria 727
172 Ga0451839_0606645 3300041496 Bacteria 708
173 Ga0466969_0001067 3300044656 Bacteria 14806
174 Ga0466969_0252963 3300044656 Unclassified 798
175 Ga0466966_0002856 3300044684 Bacteria 11370
176 Ga0466961_0000708 3300044693 Bacteria 20977
177 Ga0466961_0046722 3300044693 Bacteria 2768
178 Ga0466963_0000961 3300044694 Bacteria 14791
179 Ga0466964_0001156 3300044706 Bacteria 8921
180 Ga0466971_0004105 3300044719 Bacteria 6270
181 Ga0466971_0041976 3300044719 Bacteria 2055
182 Ga0466970_0003123 3300044765 Bacteria 8045
183 Ga0466970_0020233 3300044765 Bacteria 3456
184 Ga0466957_0027517 3300044842 Bacteria 3380
185 Ga0466959_0001845 3300045049 Bacteria 13305
186 Ga0466959_0025241 3300045049 Bacteria 4403
187 Ga0466958_0000216 3300045836 Bacteria 21669
188 Ga0466967_0182108 3300045976 Bacteria 1982
189 Ga0495603_0820827 3300046455 Bacteria 530
190 Ga0495590_0298347 3300046457 Bacteria 606
191 Ga0495641_0036955 3300046461 Bacteria 2292
192 Ga0495582_0062640 3300046473 Bacteria 2055
193 Ga0495584_0385663 3300046491 Unclassified 712
194 Ga0495583_0221585 3300046506 Bacteria 764
195 Ga0495620_0164122 3300046515 Bacteria 862
196 Ga0495643_0398426 3300046522 Bacteria 608
197 Ga0495663_0212749 3300046525 Bacteria 678
198 Ga0495666_0234202 3300046526 Bacteria 839
199 Ga0495598_0330256 3300046537 Unclassified 583
200 Ga0495656_0429877 3300046615 Unclassified 694
201 Ga0495668_0274845 3300046616 Bacteria 923
202 Ga0495611_0022290 3300046648 Bacteria 2740
203 Ga0495613_0008881 3300046689 Bacteria 7454
204 Ga0495604_0826269 3300047317 Bacteria 582
205 Ga0495636_0580651 3300047318 Unclassified 547
206 Ga0495676_0031157 3300047321 Bacteria 4514
207 Ga0495614_0070455 3300048089 Bacteria 1506
208 Ga0496100_0010468 3300048903 Bacteria 5250
209 Ga0496101_0133127 3300048904 Bacteria 1889
210 Ga0496102_0036966 3300048905 Bacteria 4402
211 Ga0496103_0005381 3300048906 Bacteria 7670
212 Ga0496104_0188319 3300048907 Bacteria 1974
213 Ga0496105_0098415 3300048908 Bacteria 2415
214 Ga0496106_0005493 3300048909 Bacteria 9373
215 Ga0496107_0007317 3300048910 Bacteria 7609
216 Ga0496108_0039245 3300048911 Bacteria 3947
217 Ga0496108_1242579 3300048911 Bacteria 628
218 Ga0496109_0163541 3300048912 Bacteria 2085
219 Ga0496109_0297004 3300048912 Bacteria 1523
220 Ga0496109_1452397 3300048912 Bacteria 621
221 Ga0496110_0059188 3300048913 Bacteria 3375
222 Ga0496111_0094686 3300048914 Bacteria 2190
223 Ga0496111_0595485 3300048914 Bacteria 810
224 Ga0496111_0725742 3300048914 Bacteria 722
225 Ga0496112_0392282 3300048915 Bacteria 1328
226 Ga0496112_0711229 3300048915 Bacteria 932
227 Ga0496113_0161124 3300048916 Bacteria 1773
228 Ga0496114_0139166 3300048917 Bacteria 2100
229 Ga0496115_0016016 3300048918 Bacteria 5701
230 Ga0501031_0629898 3300049568 Bacteria 690
231 Ga0501031_0664866 3300049568 Bacteria 669
232 Ga0501036_1355099 3300049572 Bacteria 577
233 Ga0501040_0074140 3300049576 Bacteria 2352
234 Ga0501040_0138333 3300049576 Bacteria 1715
235 Ga0501042_0237654 3300049578 Bacteria 1315
236 Ga0501043_1141594 3300049579 Bacteria 549
237 Ga0501048_0618829 3300049582 Bacteria 777
238 Ga0501068_0124897 3300049584 Bacteria 1606
239 Ga0501074_0579894 3300049590 Bacteria 794
240 Ga0501075_0647160 3300049591 Bacteria 806
241 Ga0501079_0236147 3300049741 Bacteria 1428
242 Ga0501044_0074109 3300049823 Bacteria 3459
243 Ga0501044_0608024 3300049823 Bacteria 986
244 nmdc:mga03n38_403977_c1 3300050490 Bacteria 752
245 nmdc:mga00v17_48424_c1 3300050491 Bacteria 2576
246 nmdc:mga0yw44_1095545_c1 3300050492 Bacteria 538
247 nmdc:mga0yw44_193121_c1 3300050492 Bacteria 1343
248 nmdc:mga0yw44_29103_c1 3300050492 Bacteria 3186
249 nmdc:mga0yw44_411021_c1 3300050492 Bacteria 915
250 nmdc:mga0k408_889152_c1 3300050493 Bacteria 517
251 nmdc:mga05p37_2220791_c1 3300050507 Bacteria 509
252 nmdc:mga09592_1477173_c1 3300050508 Bacteria 554
253 nmdc:mga06r32_542631_c1 3300050510 Unclassified 1137
254 nmdc:mga06r32_762492_c1 3300050510 Bacteria 930
255 nmdc:mga0rr50_15500_c1 3300050513 Bacteria 5033
256 nmdc:mga0rr50_277811_c1 3300050513 Bacteria 1397
257 nmdc:mga0rr50_964413_c1 3300050513 Bacteria 727
258 nmdc:mga0a205_33910_c1 3300050515 Bacteria 4896
259 nmdc:mga0sz30_360372_c1 3300050516 Bacteria 650
260 Ga0500583_0005998 3300053092 Bacteria 4134
261 Ga0501084_0641690 3300054114 Bacteria 896
262 Ga0466962_0012143 3300061719 Bacteria 4140
263 Ga0530510_0737951 3300061734 Bacteria 751
264 Ga0070714_100226274
265 JGI25407J50210_10124496
266 Ga0065704_10160215
267 Ga0065707_10082291
268 Ga0070690_100163699
269 Ga0068869_100015760
270 Ga0070666_10975682
271 Ga0070682_101854778
272 Ga0070689_100563359
273 Ga0070687_101095631
274 Ga0070669_101518936
275 Ga0070675_101594909
276 Ga0070673_100575392
277 Ga0070673_101041574
278 Ga0070703_10018890
279 Ga0070709_10199652
280 Ga0070713_100000307
281 Ga0070710_10302596
282 Ga0070711_100012008
283 Ga0070705_100052621
284 Ga0070705_100904524
285 Ga0070694_100199482
286 Ga0070694_100471149
287 Ga0070708_100887243
288 Ga0070678_100054660
289 Ga0070681_11448685
290 Ga0070706_100074654
291 Ga0070706_100348118
292 Ga0070707_100083395
293 Ga0070698_100676728
294 Ga0070699_100037018
295 Ga0070699_101489019
296 Ga0070679_100015885
297 Ga0070697_100106965
298 Ga0070697_101468729
299 Ga0068853_100032616
300 Ga0070672_101454495
301 Ga0070686_100046509
302 Ga0070686_101052067
303 Ga0070696_101766087
304 Ga0070704_100095470
305 Ga0070702_100585051
306 Ga0068852_101453065
307 Ga0068852_101893884
308 Ga0068864_100414821
309 Ga0068861_100758661
310 Ga0068858_100199838
311 Ga0068860_100236738
312 Ga0068860_102189743
313 Ga0068862_101200432
314 Ga0081455_10010809
315 Ga0081455_10278341
316 Ga0081455_10358521
317 Ga0081455_10423266
318 Ga0081538_10005737
319 Ga0081538_10006537
320 Ga0081538_10322257
321 Ga0081540_1041704
322 Ga0075365_10000241
323 Ga0075365_10160556
324 Ga0075365_10475650
325 Ga0075365_10772978
326 Ga0075364_10085761
327 Ga0075364_10193150
328 Ga0070716_100059896
329 Ga0070712_100008590
330 Ga0075362_10152536
331 Ga0075367_10244737
332 Ga0075366_10150840
333 Ga0075370_10205215
334 Ga0075430_100647973
335 Ga0075431_100569160
336 Ga0075431_100772960
337 Ga0075431_101077130
338 Ga0075433_10039977
339 Ga0075434_100033336
340 Ga0075429_101795889
341 Ga0068865_100321851
342 Ga0075435_100019214
343 Ga0075435_100990992
344 Ga0099795_10260899
345 Ga0105245_10002992
346 Ga0105245_10042260
347 Ga0105245_10150478
348 Ga0105247_10131298
349 Ga0105243_10108119
350 Ga0105241_10239194
351 Ga0105241_11124600
352 Ga0105242_10118578
353 Ga0105248_13157738
354 Ga0105249_10635134
355 Ga0105239_10127541
356 Ga0157378_11073703
357 Ga0157378_12222230
358 Ga0163162_10599242
359 Ga0163162_12883366
360 Ga0157375_11597314
361 Ga0163163_13173135
362 Ga0157379_10829136
363 Ga0157376_10033571
364 Ga0157376_10642709
365 Ga0157376_11007192
366 Ga0157376_11425577
367 Ga0213876_10018339
368 Ga0213875_10075920
369 Ga0207653_10052414
370 Ga0207692_10181981
371 Ga0207710_10144837
372 Ga0207688_10026761
373 Ga0207680_11326851
374 Ga0207699_10152298
375 Ga0207684_10390050
376 Ga0207684_10398474
377 Ga0207684_10521575
378 Ga0207707_10860601
379 Ga0207693_10003468
380 Ga0207657_11145136
381 Ga0207652_10033013
382 Ga0207646_10056125
383 Ga0207659_11417170
384 Ga0207687_10417082
385 Ga0207687_10708518
386 Ga0207687_11149171
387 Ga0207664_10435256
388 Ga0207664_10912616
389 Ga0207690_10705554
390 Ga0207686_10649663
391 Ga0207709_10324447
392 Ga0207670_11784882
393 Ga0207704_10228242
394 Ga0207689_11413490
395 Ga0207651_10282755
396 Ga0207677_10453446
397 Ga0207703_10131302
398 Ga0207639_10153707
399 Ga0207676_10516680
400 Ga0207676_11353030
401 Ga0207675_100370379
402 Ga0207675_101357058
403 Ga0207683_10114489
404 Ga0207698_11929945
405 Ga0209813_10442847
406 Ga0268265_11447111
407 Ga0268264_10627779
408 Ga0307515_10728424
409 Ga0265313_10201185
410 Ga0265314_10134461
411 Ga0307416_103432686
412 Ga0373935_1469272
413 Ga0373947_0158137
414 Ga0373937_0110289
415 Ga0395899_0188934
416 Ga0395899_0740956
417 Ga0395900_0024600
418 Ga0395900_0669592
419 Ga0395900_0931734
420 Ga0395900_1334783
421 Ga0395900_1588122
422 Ga0395898_0005417
423 Ga0395898_0228074
424 Ga0395898_0272566
425 Ga0395905_0031510
426 Ga0395905_0390224
427 Ga0395905_0535221
428 Ga0436364_0279176
429 Ga0395901_0133982
430 Ga0395901_0397332
431 Ga0395901_0433003
432 Ga0395901_1759817
433 Ga0436365_1084975
434 Ga0451839_0457347
435 Ga0451839_0606645
436 Ga0466969_0001067
437 Ga0466969_0252963
438 Ga0466966_0002856
439 Ga0466961_0000708
440 Ga0466961_0046722
441 Ga0466963_0000961
442 Ga0466964_0001156
443 Ga0466971_0004105
444 Ga0466971_0041976
445 Ga0466970_0003123
446 Ga0466970_0020233
447 Ga0466957_0027517
448 Ga0466959_0001845
449 Ga0466959_0025241
450 Ga0466958_0000216
451 Ga0466967_0182108
452 Ga0495603_0820827
453 Ga0495590_0298347
454 Ga0495641_0036955
455 Ga0495582_0062640
456 Ga0495584_0385663
457 Ga0495583_0221585
458 Ga0495620_0164122
459 Ga0495643_0398426
460 Ga0495663_0212749
461 Ga0495666_0234202
462 Ga0495598_0330256
463 Ga0495656_0429877
464 Ga0495668_0274845
465 Ga0495611_0022290
466 Ga0495613_0008881
467 Ga0495604_0826269
468 Ga0495636_0580651
469 Ga0495676_0031157
470 Ga0495614_0070455
471 Ga0496100_0010468
472 Ga0496101_0133127
473 Ga0496102_0036966
474 Ga0496103_0005381
475 Ga0496104_0188319
476 Ga0496105_0098415
477 Ga0496106_0005493
478 Ga0496107_0007317
479 Ga0496108_0039245
480 Ga0496108_1242579
481 Ga0496109_0163541
482 Ga0496109_0297004
483 Ga0496109_1452397
484 Ga0496110_0059188
485 Ga0496111_0094686
486 Ga0496111_0595485
487 Ga0496111_0725742
488 Ga0496112_0392282
489 Ga0496112_0711229
490 Ga0496113_0161124
491 Ga0496114_0139166
492 Ga0496115_0016016
493 Ga0501031_0629898
494 Ga0501031_0664866
495 Ga0501036_1355099
496 Ga0501040_0074140
497 Ga0501040_0138333
498 Ga0501042_0237654
499 Ga0501043_1141594
500 Ga0501048_0618829
501 Ga0501068_0124897
502 Ga0501074_0579894
503 Ga0501075_0647160
504 Ga0501079_0236147
505 Ga0501044_0074109
506 Ga0501044_0608024
507 nmdc:mga03n38_403977_c1
508 nmdc:mga00v17_48424_c1
509 nmdc:mga0yw44_1095545_c1
510 nmdc:mga0yw44_193121_c1
511 nmdc:mga0yw44_29103_c1
512 nmdc:mga0yw44_411021_c1
513 nmdc:mga0k408_889152_c1
514 nmdc:mga05p37_2220791_c1
515 nmdc:mga09592_1477173_c1
516 nmdc:mga06r32_542631_c1
517 nmdc:mga06r32_762492_c1
518 nmdc:mga0rr50_15500_c1
519 nmdc:mga0rr50_277811_c1
520 nmdc:mga0rr50_964413_c1
521 nmdc:mga0a205_33910_c1
522 nmdc:mga0sz30_360372_c1
523 Ga0500583_0005998
524 Ga0501084_0641690
525 Ga0466962_0012143
526 Ga0530510_0737951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

23

90

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8905 1 85
3m99-assembly1.cif.gz_A structure of the ubp8-sgf11-sgf73-sus1 saga dub module 0.851 32 85
4w4u-assembly1.cif.gz_A structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution 0.844 33 85
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8438 1 85
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.8354 3 84
ID Description Score Start End Superfamily
af_I1ME85_192_270_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9282 33 46 3.30.40.10
af_Q10N73_174_281_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8969 33 46 3.30.40.10
af_Q0J492_27_131_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8902 34 88 3.30.40.10
af_Q55EJ1_913_1015_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8876 20 84 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8854 1 88 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A5N8YYI3-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9965 20 85 GO:0008270
AF-A0A1H3IX77-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9874 32 84 GO:0008270
GO:0016787
AF-A0A3N5V2X7-F1-model_v4 UBP-type domain-containing protein 0.9854 20 85 GO:0008270
AF-A0A850D0C0-F1-model_v4 deleted 0.9786 19 84
AF-A0A2V5UKL3-F1-model_v4 UBP-type domain-containing protein 0.9773 21 87 GO:0008270

Map