F371438

General Info

Members Datasets Scaffolds Average Seq Length
262 200 257 335

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0306844|Ga0501035_0306844_120_1265
Length 381
Sequence MLVVESWRLSRLKRHGIRIMSDAKRAAAQPIRLSYFSVQDHYPDRERTIPQLYEQVIQQAELAERLRYDSFLVAEHHFHEYGTVPNPAVMLAAIAQRTKALRLGPAISVLTFHDPLTVAENYAIVDILSNGRLVLGVGSGYLKHEFEGYAVAPSEKRARFDENLAILRLALAGERFSYQGAFRNVDQVKLNITPIQQRVPIYVAVLAKEAAYHVGRAGNDIISVPYASLDRFEEIGPLMKAFKQGRDESRSPPDSGDHIFTFHTHVAETDAQCRKNVEAAFNLYVATRLYAKRQTYDDIMRSQLALFGSVETVVDKIVALYGMGIRHVLTLQNFGLLAAEKVQRSMTLMAEEVMPRVHKRIGAGAPSFVAQHEQPHPPAPR

Samples

Sample ID Description Type Environment
1 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
2 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
3 2885266251 Ralstonia sp. SET104 Isolate Nodule
4 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
5 2928058823 Ralstonia sp. 1138 Isolate Unclassified
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.38
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 0.38
Rhizoplane 0.38
Rhizosphere 81.3
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000023 3300001915 Bacteria 36306
2 JGI24740J21852_10007801 3300001979 Bacteria 4323
3 JGI25156J39149_1013411 3300002705 Bacteria 1739
4 rootH1_10076303 3300003316 Bacteria 3495
5 Ga0006562J51391_1094042 3300003578 Bacteria 4423
6 Ga0055538_1001994 3300003751 Bacteria 3316
7 Ga0055539_1000149 3300003752 Bacteria 70006
8 Ga0055533_1002667 3300003756 Bacteria 3944
9 Ga0055532_1000006 3300003758 Bacteria 451244
10 Ga0055525_1000386 3300003759 Bacteria 28350
11 Ga0055527_1001133 3300003760 Bacteria 6116
12 Ga0055535_1000004 3300003761 Bacteria 451244
13 Ga0055529_1000118 3300003763 Bacteria 117058
14 Ga0070658_10012053 3300005327 Bacteria 6943
15 Ga0070680_100001410 3300005336 Bacteria 17375
16 Ga0070660_100007654 3300005339 Bacteria 7527
17 Ga0070660_100058731 3300005339 Bacteria 2982
18 Ga0070691_10005671 3300005341 Bacteria 5694
19 Ga0070661_100000059 3300005344 Bacteria 87006
20 Ga0070692_10000832 3300005345 Bacteria 10332
21 Ga0070659_100007638 3300005366 Bacteria 7861
22 Ga0070659_100045557 3300005366 Bacteria 3436
23 Ga0070703_10001649 3300005406 Bacteria 6634
24 Ga0070714_100054928 3300005435 Bacteria 3403
25 Ga0070710_10086718 3300005437 Unclassified 1839
26 Ga0070701_10020907 3300005438 Bacteria 3114
27 Ga0070711_100163192 3300005439 Bacteria 1691
28 Ga0070711_100341958 3300005439 Bacteria 1201
29 Ga0070705_100014149 3300005440 Bacteria 4098
30 Ga0070705_100037542 3300005440 Bacteria 2733
31 Ga0070700_100018699 3300005441 Bacteria 3987
32 Ga0070694_100009738 3300005444 Bacteria 5902
33 Ga0070708_100095056 3300005445 Unclassified 2720
34 Ga0070663_100000003 3300005455 Bacteria 260492
35 Ga0070662_100026177 3300005457 Bacteria 4038
36 Ga0070681_10003269 3300005458 Bacteria 15121
37 Ga0070681_10037950 3300005458 Bacteria 4831
38 Ga0068867_100144413 3300005459 Bacteria 1863
39 Ga0070706_100417919 3300005467 Unclassified 1248
40 Ga0070698_100304280 3300005471 Bacteria 1525
41 Ga0070699_100014029 3300005518 Bacteria 6893
42 Ga0070699_100074460 3300005518 Bacteria 2954
43 Ga0070679_100018648 3300005530 Bacteria 6736
44 Ga0070679_100130824 3300005530 Bacteria 2491
45 Ga0070697_100017064 3300005536 Bacteria 5710
46 Ga0070697_100038533 3300005536 Bacteria 3862
47 Ga0070697_100181210 3300005536 Bacteria 1785
48 Ga0070695_100003332 3300005545 Bacteria 9395
49 Ga0070695_100016614 3300005545 Bacteria 4457
50 Ga0070695_100047073 3300005545 Bacteria 2753
51 Ga0070696_100140623 3300005546 Bacteria 1764
52 Ga0070696_100146213 3300005546 Bacteria 1731
53 Ga0070704_100012536 3300005549 Bacteria 5237
54 Ga0070704_100194410 3300005549 Bacteria 1633
55 Ga0068855_100048123 3300005563 Bacteria 5034
56 Ga0068855_100061348 3300005563 Bacteria 4394
57 Ga0070664_100000050 3300005564 Bacteria 71168
58 Ga0068857_100002514 3300005577 Bacteria 15010
59 Ga0068857_100043658 3300005577 Bacteria 3976
60 Ga0068854_100000254 3300005578 Bacteria 36338
61 Ga0068856_100000779 3300005614 Bacteria 34631
62 Ga0068856_100153154 3300005614 Bacteria 2315
63 Ga0068852_100072249 3300005616 Bacteria 3032
64 Ga0068859_100030580 3300005617 Bacteria 5405
65 Ga0068860_100101481 3300005843 Bacteria 2745
66 Ga0068862_100007790 3300005844 Bacteria 8856
67 Ga0081539_10001147 3300005985 Bacteria 47975
68 Ga0075365_10152217 3300006038 Bacteria 1609
69 Ga0075368_10003485 3300006042 Bacteria 5261
70 Ga0075363_100063530 3300006048 Bacteria 1993
71 Ga0075362_10054486 3300006177 Bacteria 1797
72 Ga0075367_10021749 3300006178 Bacteria 3589
73 Ga0075369_10051171 3300006186 Unclassified 1788
74 Ga0075366_10020013 3300006195 Bacteria 3880
75 Ga0075428_100000130 3300006844 Bacteria 65814
76 Ga0075428_100006155 3300006844 Bacteria 13353
77 Ga0075428_100135459 3300006844 Bacteria 2678
78 Ga0075430_100098034 3300006846 Bacteria 2449
79 Ga0075431_100001861 3300006847 Bacteria 19979
80 Ga0075431_100037779 3300006847 Bacteria 4972
81 Ga0075433_10273847 3300006852 Bacteria 1496
82 Ga0075434_100000003 3300006871 Bacteria 134839
83 Ga0075434_100018721 3300006871 Bacteria 6692
84 Ga0075429_100000188 3300006880 Bacteria 40765
85 Ga0075429_100001959 3300006880 Bacteria 17088
86 Ga0075436_100001339 3300006914 Bacteria 16761
87 Ga0075436_100021156 3300006914 Bacteria 4463
88 Ga0075436_100140657 3300006914 Bacteria 1696
89 Ga0097620_100030580 3300006931 Bacteria 5405
90 Ga0075435_100024561 3300007076 Bacteria 4680
91 Ga0075435_100039705 3300007076 Bacteria 3756
92 Ga0075435_100430475 3300007076 Unclassified 1137
93 Ga0105240_10077613 3300009093 Bacteria 4091
94 Ga0105240_10198013 3300009093 Bacteria 2356
95 Ga0111539_10003310 3300009094 Bacteria 21272
96 Ga0111539_10012837 3300009094 Bacteria 10484
97 Ga0111539_10137800 3300009094 Bacteria 2858
98 Ga0114129_10000199 3300009147 Bacteria 66704
99 Ga0114129_10000604 3300009147 Bacteria 44388
100 Ga0114129_10202961 3300009147 Bacteria 2684
101 Ga0105242_10001865 3300009176 Bacteria 16551
102 Ga0105238_10024963 3300009551 Bacteria 6092
103 Ga0105249_10105742 3300009553 Bacteria 2654
104 Ga0157373_10018984 3300013100 Bacteria 5004
105 Ga0157371_10000160 3300013102 Bacteria 98616
106 Ga0157370_10000031 3300013104 Bacteria 139879
107 Ga0157369_10013208 3300013105 Bacteria 9347
108 Ga0157372_10000104 3300013307 Bacteria 88067
109 Ga0157372_10351338 3300013307 Bacteria 1718
110 Ga0182008_10071794 3300014497 Bacteria 1703
111 Ga0182006_1001454 3300015261 Bacteria 14275
112 Ga0209784_100006 3300025224 Bacteria 930704
113 Ga0209566_100002 3300025225 Bacteria 2614868
114 Ga0209674_100010 3300025226 Bacteria 1038638
115 Ga0209674_102144 3300025226 Bacteria 4450
116 Ga0209672_100182 3300025228 Bacteria 51148
117 Ga0209147_100015 3300025229 Bacteria 565073
118 Ga0209563_100004 3300025230 Bacteria 1814108
119 Ga0209258_100021 3300025242 Bacteria 565073
120 Ga0209677_100007 3300025253 Bacteria 1021332
121 Ga0209759_1001964 3300025256 Bacteria 9889
122 Ga0209759_1022903 3300025256 Bacteria 1388
123 Ga0209455_1000028 3300025272 Bacteria 565073
124 Ga0207653_10001645 3300025885 Bacteria 7167
125 Ga0207705_10035210 3300025909 Bacteria 3581
126 Ga0207707_10004890 3300025912 Bacteria 11771
127 Ga0207707_10114518 3300025912 Bacteria 2357
128 Ga0207695_10006721 3300025913 Bacteria 14845
129 Ga0207663_10088465 3300025916 Bacteria 2048
130 Ga0207660_10112744 3300025917 Bacteria 2049
131 Ga0207657_10032095 3300025919 Bacteria 4749
132 Ga0207649_10000345 3300025920 Bacteria 35114
133 Ga0207652_10028460 3300025921 Bacteria 4662
134 Ga0207652_10053557 3300025921 Bacteria 3466
135 Ga0207694_10024203 3300025924 Bacteria 4610
136 Ga0207690_10001318 3300025932 Bacteria 15609
137 Ga0207706_10018344 3300025933 Bacteria 6296
138 Ga0207686_10028245 3300025934 Bacteria 3296
139 Ga0207679_10000007 3300025945 Bacteria 460140
140 Ga0207667_10124957 3300025949 Bacteria 2650
141 Ga0207712_10092458 3300025961 Bacteria 2230
142 Ga0207640_10000267 3300025981 Bacteria 35142
143 Ga0207678_10000029 3300026067 Bacteria 112885
144 Ga0207708_10015026 3300026075 Bacteria 5802
145 Ga0207702_10000018 3300026078 Bacteria 212617
146 Ga0207702_10024709 3300026078 Bacteria 4985
147 Ga0207702_10125247 3300026078 Bacteria 2306
148 Ga0207674_10020517 3300026116 Bacteria 7137
149 Ga0207698_10213365 3300026142 Bacteria 1738
150 Ga0209969_1000529 3300027360 Bacteria 5176
151 Ga0209967_1002226 3300027364 Bacteria 2516
152 Ga0209981_1000591 3300027378 Bacteria 4574
153 Ga0209996_1001809 3300027395 Bacteria 2617
154 Ga0210000_1000081 3300027462 Bacteria 13652
155 Ga0209995_1000402 3300027471 Bacteria 6745
156 Ga0209968_1004569 3300027526 Bacteria 2075
157 Ga0209999_1002715 3300027543 Bacteria 3130
158 Ga0209998_10004647 3300027717 Unclassified 2908
159 Ga0209813_10005235 3300027866 Bacteria 3139
160 Ga0207428_10000744 3300027907 Bacteria 37270
161 Ga0207428_10002520 3300027907 Bacteria 18284
162 Ga0207428_10003318 3300027907 Bacteria 15655
163 Ga0268265_10004863 3300028380 Bacteria 9261
164 Ga0265340_10034635 3300031247 Bacteria 2510
165 Ga0265339_10068399 3300031249 Bacteria 1898
166 Ga0265327_10006377 3300031251 Bacteria 9449
167 Ga0307408_100093081 3300031548 Bacteria 2280
168 Ga0265342_10000319 3300031712 Bacteria 54575
169 Ga0373962_0033316 3300035242 Bacteria 1421
170 Ga0373935_0024783 3300035692 Bacteria 3694
171 Ga0373927_0097769 3300035695 Unclassified 1908
172 Ga0373925_0026536 3300037068 Bacteria 4239
173 Ga0395900_0516472 3300037418 Bacteria 1143
174 Ga0395905_0001159 3300037471 Bacteria 32949
175 Ga0436364_0186530 3300037853 Bacteria 2014
176 Ga0436360_0206886 3300039438 Bacteria 4721
177 Ga0439434_0001969 3300042435 Bacteria 5949
178 Ga0439435_0001593 3300042436 Bacteria 4253
179 Ga0451577_0006037 3300042876 Bacteria 12191
180 Ga0451577_0425276 3300042876 Bacteria 1206
181 Ga0466986_0058207 3300044650 Bacteria 2674
182 Ga0466969_0052231 3300044656 Bacteria 2008
183 Ga0466982_0120660 3300044672 Bacteria 1617
184 Ga0466965_0015941 3300044683 Bacteria 3570
185 Ga0466961_0000951 3300044693 Bacteria 17939
186 Ga0466963_0142109 3300044694 Bacteria 1663
187 Ga0453684_0161274 3300044712 Bacteria 2652
188 Ga0466971_0055600 3300044719 Bacteria 1784
189 Ga0466970_0003585 3300044765 Bacteria 7568
190 Ga0466957_0020062 3300044842 Bacteria 3933
191 Ga0466960_0023949 3300044901 Bacteria 2748
192 Ga0466959_0004328 3300045049 Bacteria 9485
193 Ga0451576_0022894 3300045051 Bacteria 6769
194 Ga0451576_0035415 3300045051 Bacteria 5295
195 Ga0451576_0277795 3300045051 Bacteria 1751
196 Ga0466967_0015961 3300045976 Bacteria 5905
197 Ga0466967_0385869 3300045976 Unclassified 1361
198 Ga0495642_0020955 3300046528 Bacteria 2570
199 Ga0496117_0023677 3300048920 Bacteria 4883
200 Ga0496118_0009250 3300048921 Bacteria 10001
201 Ga0496119_0081941 3300048922 Bacteria 1856
202 Ga0496125_0016831 3300048928 Bacteria 7006
203 Ga0501032_0060376 3300049569 Bacteria 2543
204 Ga0501033_0026097 3300049570 Bacteria 4398
205 Ga0501036_0184276 3300049572 Bacteria 1757
206 Ga0501036_0358335 3300049572 Bacteria 1218
207 Ga0501038_0026208 3300049574 Bacteria 5193
208 Ga0501039_0232064 3300049575 Bacteria 1451
209 Ga0501040_0061142 3300049576 Bacteria 2590
210 Ga0501040_0104839 3300049576 Bacteria 1975
211 Ga0501043_0063550 3300049579 Bacteria 2899
212 Ga0501046_0028282 3300049580 Bacteria 4567
213 Ga0501047_0005106 3300049581 Bacteria 12316
214 Ga0501047_0174762 3300049581 Bacteria 2015
215 Ga0501047_0253795 3300049581 Bacteria 1607
216 Ga0501069_0075116 3300049585 Bacteria 1898
217 Ga0501072_0099845 3300049588 Bacteria 2307
218 Ga0501075_0023131 3300049591 Bacteria 4548
219 Ga0501076_0135341 3300049592 Unclassified 2000
220 Ga0501080_0152141 3300049742 Bacteria 2138
221 Ga0501081_0002379 3300049743 Bacteria 11846
222 Ga0501035_0306844 3300049822 Unclassified 1336
223 Ga0501044_0014563 3300049823 Bacteria 8483
224 Ga0501044_0079274 3300049823 Bacteria 3328
225 Ga0501045_0067225 3300049824 Bacteria 2632
226 nmdc:mga03683_5341_c1 3300050489 Bacteria 4336
227 nmdc:mga00v17_57500_c1 3300050491 Bacteria 2380
228 nmdc:mga0yw44_56098_c1 3300050492 Bacteria 2399
229 nmdc:mga0k408_68192_c1 3300050493 Bacteria 2075
230 nmdc:mga05p37_383_c1 3300050507 Bacteria 47792
231 nmdc:mga05p37_49025_c1 3300050507 Bacteria 5194
232 nmdc:mga09592_2774_c1 3300050508 Bacteria 14180
233 nmdc:mga09592_4666_c1 3300050508 Bacteria 11094
234 nmdc:mga06r32_250017_c1 3300050510 Bacteria 1760
235 nmdc:mga06r32_57555_c1 3300050510 Bacteria 3734
236 nmdc:mga06r32_711_c2 3300050510 Bacteria 27826
237 nmdc:mga08y16_1988_c1 3300050511 Bacteria 20869
238 nmdc:mga08y16_369_c1 3300050511 Bacteria 40785
239 nmdc:mga08y16_43862_c1 3300050511 Bacteria 4687
240 nmdc:mga0n895_1936_c1 3300050512 Bacteria 15884
241 nmdc:mga0n895_26585_c1 3300050512 Bacteria 5484
242 nmdc:mga0n895_84997_c1 3300050512 Bacteria 3158
243 nmdc:mga0rr50_143325_c1 3300050513 Bacteria 1924
244 nmdc:mga0rr50_400171_c1 3300050513 Bacteria 1160
245 nmdc:mga0rr50_7116_c1 3300050513 Bacteria 6871
246 nmdc:mga08x19_18497_c1 3300050514 Bacteria 4270
247 nmdc:mga08x19_49131_c2 3300050514 Bacteria 1634
248 nmdc:mga08x19_5722_c1 3300050514 Bacteria 7347
249 nmdc:mga0a205_219385_c1 3300050515 Bacteria 1788
250 nmdc:mga0a205_2406_c1 3300050515 Bacteria 16504
251 nmdc:mga0sz30_56269_c1 3300050516 Unclassified 1675
252 Ga0500594_0001078 3300053118 Bacteria 5852
253 Ga0500616_0000541 3300053153 Bacteria 47231
254 Ga0501084_0143237 3300054114 Bacteria 2013
255 Ga0466962_0010361 3300061719 Bacteria 4479
256 Ga0530510_0001325 3300061734 Bacteria 16554
257 Ga0530510_0015242 3300061734 Bacteria 5428

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027526 Ga0209968_1004569 Ga0209968_10045692 296
2 3300050513 nmdc:mga0rr50_400171_c1 nmdc:mga0rr50_400171_c1_203_1135 308
3 3300005341 Ga0070691_10005671 Ga0070691_100056714 313
4 3300005406 Ga0070703_10001649 Ga0070703_100016492 313
5 3300005440 Ga0070705_100014149 Ga0070705_1000141493 313
6 3300005441 Ga0070700_100018699 Ga0070700_1000186993 313
7 3300005843 Ga0068860_100101481 Ga0068860_1001014812 313
8 3300025885 Ga0207653_10001645 Ga0207653_100016456 313
9 3300026075 Ga0207708_10015026 Ga0207708_100150264 313
10 3300053153 Ga0500616_0000541 Ga0500616_0000541_14984_15934 313
11 3300005546 Ga0070696_100140623 Ga0070696_1001406232 318
12 3300027360 Ga0209969_1000529 Ga0209969_10005292 322
13 3300027364 Ga0209967_1002226 Ga0209967_10022262 322
14 3300027378 Ga0209981_1000591 Ga0209981_10005913 322
15 3300027395 Ga0209996_1001809 Ga0209996_10018093 322
16 3300027462 Ga0210000_1000081 Ga0210000_10000817 322
17 3300027471 Ga0209995_1000402 Ga0209995_10004023 322
18 3300027543 Ga0209999_1002715 Ga0209999_10027152 322
19 3300005439 Ga0070711_100163192 Ga0070711_1001631921 327
20 3300005457 Ga0070662_100026177 Ga0070662_1000261773 327
21 3300005844 Ga0068862_100007790 Ga0068862_1000077902 327
22 3300006844 Ga0075428_100135459 Ga0075428_1001354593 327
23 3300009094 Ga0111539_10137800 Ga0111539_101378002 327
24 3300009147 Ga0114129_10202961 Ga0114129_102029612 327
25 3300025933 Ga0207706_10018344 Ga0207706_100183444 327
26 3300027717 Ga0209998_10004647 Ga0209998_100046472 327
27 3300027907 Ga0207428_10000744 Ga0207428_100007446 327
28 3300028380 Ga0268265_10004863 Ga0268265_100048634 327
29 3300042876 Ga0451577_0006037 Ga0451577_0006037_10096_11085 327
30 3300044712 Ga0453684_0161274 Ga0453684_0161274_1299_2288 327
31 3300045051 Ga0451576_0035415 Ga0451576_0035415_2056_3045 327
32 3300045051 Ga0451576_0277795 Ga0451576_0277795_280_1269 327
33 3300050511 nmdc:mga08y16_43862_c1 nmdc:mga08y16_43862_c1_2162_3151 327
34 3300050512 nmdc:mga0n895_84997_c1 nmdc:mga0n895_84997_c1_1931_2920 327
35 3300005545 Ga0070695_100047073 Ga0070695_1000470732 328
36 3300005617 Ga0068859_100030580 Ga0068859_1000305802 328
37 3300006847 Ga0075431_100037779 Ga0075431_1000377794 328
38 3300006931 Ga0097620_100030580 Ga0097620_1000305802 328
39 3300009176 Ga0105242_10001865 Ga0105242_1000186512 328
40 3300025934 Ga0207686_10028245 Ga0207686_100282453 328
41 3300049575 Ga0501039_0232064 Ga0501039_0232064_301_1341 328
42 3300050510 nmdc:mga06r32_57555_c1 nmdc:mga06r32_57555_c1_2422_3417 328
43 3300050515 nmdc:mga0a205_2406_c1 nmdc:mga0a205_2406_c1_1203_2198 328
44 3300005445 Ga0070708_100095056 Ga0070708_1000950562 329
45 3300005518 Ga0070699_100074460 Ga0070699_1000744604 329
46 3300005536 Ga0070697_100017064 Ga0070697_1000170649 329
47 3300005345 Ga0070692_10000832 Ga0070692_100008328 330
48 3300005438 Ga0070701_10020907 Ga0070701_100209073 330
49 3300005518 Ga0070699_100014029 Ga0070699_1000140292 330
50 3300005536 Ga0070697_100181210 Ga0070697_1001812101 330
51 3300005549 Ga0070704_100012536 Ga0070704_1000125363 330
52 3300005577 Ga0068857_100043658 Ga0068857_1000436583 330
53 3300009553 Ga0105249_10105742 Ga0105249_101057422 330
54 3300025961 Ga0207712_10092458 Ga0207712_100924582 330
55 3300037853 Ga0436364_0186530 Ga0436364_0186530_723_1730 330
56 3300050510 nmdc:mga06r32_250017_c1 nmdc:mga06r32_250017_c1_362_1363 330
57 iso_pu_bacteria 2596583598 2597031350 330
58 iso_pu_bacteria 2599185178 2599447235 330
59 iso_pu_bacteria 2885266251 2885270104 330
60 iso_pu_bacteria 2900577576 2900577794 330
61 iso_pu_bacteria 2928058823 2928061062 330
62 3300005437 Ga0070710_10086718 Ga0070710_100867182 331
63 3300006844 Ga0075428_100000130 Ga0075428_10000013033 331
64 3300006880 Ga0075429_100000188 Ga0075429_1000001886 331
65 3300009094 Ga0111539_10012837 Ga0111539_100128374 331
66 3300009147 Ga0114129_10000604 Ga0114129_1000060412 331
67 3300027907 Ga0207428_10002520 Ga0207428_100025206 331
68 3300045051 Ga0451576_0022894 Ga0451576_0022894_960_1958 331
69 3300050507 nmdc:mga05p37_49025_c1 nmdc:mga05p37_49025_c1_1721_2719 331
70 3300050508 nmdc:mga09592_2774_c1 nmdc:mga09592_2774_c1_2579_3577 331
71 3300050511 nmdc:mga08y16_1988_c1 nmdc:mga08y16_1988_c1_3113_4111 331
72 3300005530 Ga0070679_100130824 Ga0070679_1001308242 332
73 3300006186 Ga0075369_10051171 Ga0075369_100511712 332
74 3300025916 Ga0207663_10088465 Ga0207663_100884652 332
75 3300031247 Ga0265340_10034635 Ga0265340_100346353 332
76 3300037471 Ga0395905_0001159 Ga0395905_0001159_25347_26348 332
77 3300039438 Ga0436360_0206886 Ga0436360_0206886_3378_4412 332
78 3300049574 Ga0501038_0026208 Ga0501038_0026208_2192_3196 332
79 3300049576 Ga0501040_0061142 Ga0501040_0061142_1219_2223 332
80 3300049580 Ga0501046_0028282 Ga0501046_0028282_461_1465 332
81 3300049742 Ga0501080_0152141 Ga0501080_0152141_359_1363 332
82 3300049743 Ga0501081_0002379 Ga0501081_0002379_8953_9957 332
83 3300050516 nmdc:mga0sz30_56269_c1 nmdc:mga0sz30_56269_c1_194_1213 332
84 3300061734 Ga0530510_0001325 Ga0530510_0001325_7652_8656 332
85 3300061734 Ga0530510_0015242 Ga0530510_0015242_3471_4475 332
86 3300005435 Ga0070714_100054928 Ga0070714_1000549282 333
87 3300005563 Ga0068855_100048123 Ga0068855_1000481234 333
88 3300005614 Ga0068856_100153154 Ga0068856_1001531542 333
89 3300009551 Ga0105238_10024963 Ga0105238_100249636 333
90 3300013307 Ga0157372_10351338 Ga0157372_103513382 333
91 3300025924 Ga0207694_10024203 Ga0207694_100242032 333
92 3300026078 Ga0207702_10024709 Ga0207702_100247092 333
93 3300026078 Ga0207702_10125247 Ga0207702_101252472 333
94 3300031548 Ga0307408_100093081 Ga0307408_1000930812 333
95 3300035692 Ga0373935_0024783 Ga0373935_0024783_2482_3513 333
96 3300035695 Ga0373927_0097769 Ga0373927_0097769_735_1766 333
97 3300037068 Ga0373925_0026536 Ga0373925_0026536_762_1793 333
98 3300049823 Ga0501044_0079274 Ga0501044_0079274_2274_3275 333
99 3300001915 JGI24741J21665_1000023 JGI24741J21665_100002331 334
100 3300001979 JGI24740J21852_10007801 JGI24740J21852_100078012 334
101 3300002705 JGI25156J39149_1013411 JGI25156J39149_10134112 334
102 3300003316 rootH1_10076303 rootH1_100763033 334
103 3300003578 Ga0006562J51391_1094042 Ga0006562J51391_10940422 334
104 3300003751 Ga0055538_1001994 Ga0055538_10019943 334
105 3300003752 Ga0055539_1000149 Ga0055539_100014960 334
106 3300003756 Ga0055533_1002667 Ga0055533_10026673 334
107 3300003758 Ga0055532_1000006 Ga0055532_1000006360 334
108 3300003759 Ga0055525_1000386 Ga0055525_100038611 334
109 3300003760 Ga0055527_1001133 Ga0055527_10011336 334
110 3300003761 Ga0055535_1000004 Ga0055535_1000004360 334
111 3300003763 Ga0055529_1000118 Ga0055529_100011838 334
112 3300005327 Ga0070658_10012053 Ga0070658_100120537 334
113 3300005336 Ga0070680_100001410 Ga0070680_10000141011 334
114 3300005339 Ga0070660_100007654 Ga0070660_1000076542 334
115 3300005339 Ga0070660_100058731 Ga0070660_1000587313 334
116 3300005344 Ga0070661_100000059 Ga0070661_10000005958 334
117 3300005366 Ga0070659_100007638 Ga0070659_1000076382 334
118 3300005366 Ga0070659_100045557 Ga0070659_1000455573 334
119 3300005439 Ga0070711_100341958 Ga0070711_1003419582 334
120 3300005440 Ga0070705_100037542 Ga0070705_1000375423 334
121 3300005444 Ga0070694_100009738 Ga0070694_1000097387 334
122 3300005455 Ga0070663_100000003 Ga0070663_10000000332 334
123 3300005458 Ga0070681_10003269 Ga0070681_1000326912 334
124 3300005458 Ga0070681_10037950 Ga0070681_100379503 334
125 3300005459 Ga0068867_100144413 Ga0068867_1001444132 334
126 3300005467 Ga0070706_100417919 Ga0070706_1004179191 334
127 3300005471 Ga0070698_100304280 Ga0070698_1003042802 334
128 3300005530 Ga0070679_100018648 Ga0070679_1000186485 334
129 3300005536 Ga0070697_100038533 Ga0070697_1000385332 334
130 3300005545 Ga0070695_100003332 Ga0070695_1000033328 334
131 3300005545 Ga0070695_100016614 Ga0070695_1000166143 334
132 3300005546 Ga0070696_100146213 Ga0070696_1001462132 334
133 3300005549 Ga0070704_100194410 Ga0070704_1001944102 334
134 3300005563 Ga0068855_100061348 Ga0068855_1000613484 334
135 3300005564 Ga0070664_100000050 Ga0070664_10000005042 334
136 3300005577 Ga0068857_100002514 Ga0068857_1000025147 334
137 3300005578 Ga0068854_100000254 Ga0068854_10000025429 334
138 3300005614 Ga0068856_100000779 Ga0068856_10000077931 334
139 3300005616 Ga0068852_100072249 Ga0068852_1000722492 334
140 3300005985 Ga0081539_10001147 Ga0081539_1000114726 334
141 3300006038 Ga0075365_10152217 Ga0075365_101522172 334
142 3300006042 Ga0075368_10003485 Ga0075368_100034852 334
143 3300006048 Ga0075363_100063530 Ga0075363_1000635301 334
144 3300006177 Ga0075362_10054486 Ga0075362_100544862 334
145 3300006178 Ga0075367_10021749 Ga0075367_100217492 334
146 3300006195 Ga0075366_10020013 Ga0075366_100200132 334
147 3300006844 Ga0075428_100006155 Ga0075428_10000615516 334
148 3300006846 Ga0075430_100098034 Ga0075430_1000980341 334
149 3300006847 Ga0075431_100001861 Ga0075431_1000018614 334
150 3300006852 Ga0075433_10273847 Ga0075433_102738472 334
151 3300006871 Ga0075434_100000003 Ga0075434_10000000381 334
152 3300006871 Ga0075434_100018721 Ga0075434_1000187214 334
153 3300006880 Ga0075429_100001959 Ga0075429_1000019594 334
154 3300006914 Ga0075436_100001339 Ga0075436_1000013397 334
155 3300006914 Ga0075436_100021156 Ga0075436_1000211562 334
156 3300006914 Ga0075436_100140657 Ga0075436_1001406572 334
157 3300007076 Ga0075435_100024561 Ga0075435_1000245614 334
158 3300007076 Ga0075435_100039705 Ga0075435_1000397053 334
159 3300007076 Ga0075435_100430475 Ga0075435_1004304751 334
160 3300009093 Ga0105240_10077613 Ga0105240_100776132 334
161 3300009093 Ga0105240_10198013 Ga0105240_101980132 334
162 3300009094 Ga0111539_10003310 Ga0111539_1000331016 334
163 3300009147 Ga0114129_10000199 Ga0114129_1000019916 334
164 3300013100 Ga0157373_10018984 Ga0157373_100189842 334
165 3300013102 Ga0157371_10000160 Ga0157371_1000016075 334
166 3300013104 Ga0157370_10000031 Ga0157370_1000003186 334
167 3300013105 Ga0157369_10013208 Ga0157369_1001320810 334
168 3300013307 Ga0157372_10000104 Ga0157372_1000010460 334
169 3300014497 Ga0182008_10071794 Ga0182008_100717941 334
170 3300015261 Ga0182006_1001454 Ga0182006_10014547 334
171 3300025224 Ga0209784_100006 Ga0209784_100006694 334
172 3300025225 Ga0209566_100002 Ga0209566_100002694 334
173 3300025226 Ga0209674_100010 Ga0209674_100010442 334
174 3300025226 Ga0209674_102144 Ga0209674_1021445 334
175 3300025228 Ga0209672_100182 Ga0209672_10018218 334
176 3300025229 Ga0209147_100015 Ga0209147_100015189 334
177 3300025230 Ga0209563_100004 Ga0209563_100004105 334
178 3300025242 Ga0209258_100021 Ga0209258_100021189 334
179 3300025253 Ga0209677_100007 Ga0209677_100007694 334
180 3300025256 Ga0209759_1001964 Ga0209759_100196411 334
181 3300025256 Ga0209759_1022903 Ga0209759_10229031 334
182 3300025272 Ga0209455_1000028 Ga0209455_1000028189 334
183 3300025909 Ga0207705_10035210 Ga0207705_100352102 334
184 3300025912 Ga0207707_10004890 Ga0207707_100048906 334
185 3300025912 Ga0207707_10114518 Ga0207707_101145182 334
186 3300025913 Ga0207695_10006721 Ga0207695_100067215 334
187 3300025917 Ga0207660_10112744 Ga0207660_101127442 334
188 3300025919 Ga0207657_10032095 Ga0207657_100320952 334
189 3300025920 Ga0207649_10000345 Ga0207649_100003457 334
190 3300025921 Ga0207652_10028460 Ga0207652_100284602 334
191 3300025921 Ga0207652_10053557 Ga0207652_100535572 334
192 3300025932 Ga0207690_10001318 Ga0207690_100013188 334
193 3300025945 Ga0207679_10000007 Ga0207679_10000007255 334
194 3300025949 Ga0207667_10124957 Ga0207667_101249572 334
195 3300025981 Ga0207640_10000267 Ga0207640_1000026711 334
196 3300026067 Ga0207678_10000029 Ga0207678_1000002988 334
197 3300026078 Ga0207702_10000018 Ga0207702_10000018198 334
198 3300026116 Ga0207674_10020517 Ga0207674_100205172 334
199 3300026142 Ga0207698_10213365 Ga0207698_102133652 334
200 3300027866 Ga0209813_10005235 Ga0209813_100052352 334
201 3300027907 Ga0207428_10003318 Ga0207428_100033183 334
202 3300031249 Ga0265339_10068399 Ga0265339_100683992 334
203 3300031251 Ga0265327_10006377 Ga0265327_100063777 334
204 3300031712 Ga0265342_10000319 Ga0265342_1000031924 334
205 3300035242 Ga0373962_0033316 Ga0373962_0033316_53_1063 334
206 3300037418 Ga0395900_0516472 Ga0395900_0516472_11_1015 334
207 3300042435 Ga0439434_0001969 Ga0439434_0001969_2925_3980 334
208 3300042436 Ga0439435_0001593 Ga0439435_0001593_2623_3678 334
209 3300042876 Ga0451577_0425276 Ga0451577_0425276_55_1086 334
210 3300044650 Ga0466986_0058207 Ga0466986_0058207_1295_2299 334
211 3300044656 Ga0466969_0052231 Ga0466969_0052231_547_1551 334
212 3300044672 Ga0466982_0120660 Ga0466982_0120660_182_1186 334
213 3300044683 Ga0466965_0015941 Ga0466965_0015941_1303_2307 334
214 3300044693 Ga0466961_0000951 Ga0466961_0000951_10153_11157 334
215 3300044694 Ga0466963_0142109 Ga0466963_0142109_366_1370 334
216 3300044719 Ga0466971_0055600 Ga0466971_0055600_251_1255 334
217 3300044765 Ga0466970_0003585 Ga0466970_0003585_5185_6189 334
218 3300044842 Ga0466957_0020062 Ga0466957_0020062_1786_2790 334
219 3300044901 Ga0466960_0023949 Ga0466960_0023949_267_1271 334
220 3300045049 Ga0466959_0004328 Ga0466959_0004328_6776_7780 334
221 3300045976 Ga0466967_0015961 Ga0466967_0015961_2044_3048 334
222 3300045976 Ga0466967_0385869 Ga0466967_0385869_286_1344 334
223 3300046528 Ga0495642_0020955 Ga0495642_0020955_1284_2300 334
224 3300048920 Ga0496117_0023677 Ga0496117_0023677_2985_3998 334
225 3300048921 Ga0496118_0009250 Ga0496118_0009250_3412_4425 334
226 3300048922 Ga0496119_0081941 Ga0496119_0081941_434_1447 334
227 3300048928 Ga0496125_0016831 Ga0496125_0016831_5569_6573 334
228 3300049569 Ga0501032_0060376 Ga0501032_0060376_795_1844 334
229 3300049570 Ga0501033_0026097 Ga0501033_0026097_2589_3638 334
230 3300049572 Ga0501036_0184276 Ga0501036_0184276_600_1649 334
231 3300049572 Ga0501036_0358335 Ga0501036_0358335_19_1041 334
232 3300049576 Ga0501040_0104839 Ga0501040_0104839_187_1209 334
233 3300049579 Ga0501043_0063550 Ga0501043_0063550_891_1940 334
234 3300049581 Ga0501047_0005106 Ga0501047_0005106_1129_2148 334
235 3300049581 Ga0501047_0174762 Ga0501047_0174762_346_1362 334
236 3300049581 Ga0501047_0253795 Ga0501047_0253795_189_1238 334
237 3300049585 Ga0501069_0075116 Ga0501069_0075116_74_1084 334
238 3300049588 Ga0501072_0099845 Ga0501072_0099845_1239_2261 334
239 3300049591 Ga0501075_0023131 Ga0501075_0023131_3477_4523 334
240 3300049592 Ga0501076_0135341 Ga0501076_0135341_730_1788 334
241 3300049822 Ga0501035_0306844 Ga0501035_0306844_120_1265 334
242 3300049823 Ga0501044_0014563 Ga0501044_0014563_635_1654 334
243 3300049824 Ga0501045_0067225 Ga0501045_0067225_920_1978 334
244 3300050489 nmdc:mga03683_5341_c1 nmdc:mga03683_5341_c1_2551_3582 334
245 3300050491 nmdc:mga00v17_57500_c1 nmdc:mga00v17_57500_c1_831_1862 334
246 3300050492 nmdc:mga0yw44_56098_c1 nmdc:mga0yw44_56098_c1_757_1788 334
247 3300050493 nmdc:mga0k408_68192_c1 nmdc:mga0k408_68192_c1_767_1798 334
248 3300050507 nmdc:mga05p37_383_c1 nmdc:mga05p37_383_c1_30890_31906 334
249 3300050508 nmdc:mga09592_4666_c1 nmdc:mga09592_4666_c1_1146_2162 334
250 3300050510 nmdc:mga06r32_711_c2 nmdc:mga06r32_711_c2_12169_13185 334
251 3300050511 nmdc:mga08y16_369_c1 nmdc:mga08y16_369_c1_26977_27993 334
252 3300050512 nmdc:mga0n895_1936_c1 nmdc:mga0n895_1936_c1_12157_13164 334
253 3300050512 nmdc:mga0n895_26585_c1 nmdc:mga0n895_26585_c1_2581_3588 334
254 3300050513 nmdc:mga0rr50_143325_c1 nmdc:mga0rr50_143325_c1_278_1285 334
255 3300050513 nmdc:mga0rr50_7116_c1 nmdc:mga0rr50_7116_c1_143_1150 334
256 3300050514 nmdc:mga08x19_18497_c1 nmdc:mga08x19_18497_c1_2583_3593 334
257 3300050514 nmdc:mga08x19_49131_c2 nmdc:mga08x19_49131_c2_332_1339 334
258 3300050514 nmdc:mga08x19_5722_c1 nmdc:mga08x19_5722_c1_3133_4155 334
259 3300050515 nmdc:mga0a205_219385_c1 nmdc:mga0a205_219385_c1_472_1479 334
260 3300053118 Ga0500594_0001078 Ga0500594_0001078_3623_4654 334
261 3300054114 Ga0501084_0143237 Ga0501084_0143237_894_1952 334
262 3300061719 Ga0466962_0010361 Ga0466962_0010361_3096_4100 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

31

327

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8868 1 325
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.8821 1 328
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8741 1 325
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.8649 1 328
1xkj-assembly1.cif.gz_B bacterial luciferase beta2 homodimer 0.8552 1 314
ID Description Score Start End Superfamily
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9042 1 327 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8837 1 327 3.20.20.30
1bslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8665 1 314 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8618 1 328 3.20.20.30
6friA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8462 1 321 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1F3ZHA3-F1-model_v4 Luciferase 0.9656 1 328 GO:0005829
GO:0016705
AF-A0A1F3ZHA3-F1-model_v4 Luciferase 0.9458 1 328 GO:0005829
GO:0016705
AF-G5LU41-F1-model_v4 Luciferase-like monooxygenase 0.9423 1 108 GO:0004497
GO:0005829
GO:0016705
AF-A0A3D2XZF9-F1-model_v4 Alkane 1-monooxygenase 0.9394 1 108 GO:0004497
GO:0005829
GO:0016705
AF-A0A3R9TDX2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9369 1 107 GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
91.36 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map