F371438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 262 | 200 | 257 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0306844|Ga0501035_0306844_120_1265 |
| Length | 381 |
| Sequence | MLVVESWRLSRLKRHGIRIMSDAKRAAAQPIRLSYFSVQDHYPDRERTIPQLYEQVIQQAELAERLRYDSFLVAEHHFHEYGTVPNPAVMLAAIAQRTKALRLGPAISVLTFHDPLTVAENYAIVDILSNGRLVLGVGSGYLKHEFEGYAVAPSEKRARFDENLAILRLALAGERFSYQGAFRNVDQVKLNITPIQQRVPIYVAVLAKEAAYHVGRAGNDIISVPYASLDRFEEIGPLMKAFKQGRDESRSPPDSGDHIFTFHTHVAETDAQCRKNVEAAFNLYVATRLYAKRQTYDDIMRSQLALFGSVETVVDKIVALYGMGIRHVLTLQNFGLLAAEKVQRSMTLMAEEVMPRVHKRIGAGAPSFVAQHEQPHPPAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 2 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 3 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 4 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 5 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 6 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 142 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 143 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 144 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 187 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 196 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 197 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 198 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 200 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0.38 |
| Isolates | 1.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.6 |
| Nodule | 0.38 |
| Rhizoplane | 0.38 |
| Rhizosphere | 81.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000023 | 3300001915 | Bacteria | 36306 |
| 2 | JGI24740J21852_10007801 | 3300001979 | Bacteria | 4323 |
| 3 | JGI25156J39149_1013411 | 3300002705 | Bacteria | 1739 |
| 4 | rootH1_10076303 | 3300003316 | Bacteria | 3495 |
| 5 | Ga0006562J51391_1094042 | 3300003578 | Bacteria | 4423 |
| 6 | Ga0055538_1001994 | 3300003751 | Bacteria | 3316 |
| 7 | Ga0055539_1000149 | 3300003752 | Bacteria | 70006 |
| 8 | Ga0055533_1002667 | 3300003756 | Bacteria | 3944 |
| 9 | Ga0055532_1000006 | 3300003758 | Bacteria | 451244 |
| 10 | Ga0055525_1000386 | 3300003759 | Bacteria | 28350 |
| 11 | Ga0055527_1001133 | 3300003760 | Bacteria | 6116 |
| 12 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 13 | Ga0055529_1000118 | 3300003763 | Bacteria | 117058 |
| 14 | Ga0070658_10012053 | 3300005327 | Bacteria | 6943 |
| 15 | Ga0070680_100001410 | 3300005336 | Bacteria | 17375 |
| 16 | Ga0070660_100007654 | 3300005339 | Bacteria | 7527 |
| 17 | Ga0070660_100058731 | 3300005339 | Bacteria | 2982 |
| 18 | Ga0070691_10005671 | 3300005341 | Bacteria | 5694 |
| 19 | Ga0070661_100000059 | 3300005344 | Bacteria | 87006 |
| 20 | Ga0070692_10000832 | 3300005345 | Bacteria | 10332 |
| 21 | Ga0070659_100007638 | 3300005366 | Bacteria | 7861 |
| 22 | Ga0070659_100045557 | 3300005366 | Bacteria | 3436 |
| 23 | Ga0070703_10001649 | 3300005406 | Bacteria | 6634 |
| 24 | Ga0070714_100054928 | 3300005435 | Bacteria | 3403 |
| 25 | Ga0070710_10086718 | 3300005437 | Unclassified | 1839 |
| 26 | Ga0070701_10020907 | 3300005438 | Bacteria | 3114 |
| 27 | Ga0070711_100163192 | 3300005439 | Bacteria | 1691 |
| 28 | Ga0070711_100341958 | 3300005439 | Bacteria | 1201 |
| 29 | Ga0070705_100014149 | 3300005440 | Bacteria | 4098 |
| 30 | Ga0070705_100037542 | 3300005440 | Bacteria | 2733 |
| 31 | Ga0070700_100018699 | 3300005441 | Bacteria | 3987 |
| 32 | Ga0070694_100009738 | 3300005444 | Bacteria | 5902 |
| 33 | Ga0070708_100095056 | 3300005445 | Unclassified | 2720 |
| 34 | Ga0070663_100000003 | 3300005455 | Bacteria | 260492 |
| 35 | Ga0070662_100026177 | 3300005457 | Bacteria | 4038 |
| 36 | Ga0070681_10003269 | 3300005458 | Bacteria | 15121 |
| 37 | Ga0070681_10037950 | 3300005458 | Bacteria | 4831 |
| 38 | Ga0068867_100144413 | 3300005459 | Bacteria | 1863 |
| 39 | Ga0070706_100417919 | 3300005467 | Unclassified | 1248 |
| 40 | Ga0070698_100304280 | 3300005471 | Bacteria | 1525 |
| 41 | Ga0070699_100014029 | 3300005518 | Bacteria | 6893 |
| 42 | Ga0070699_100074460 | 3300005518 | Bacteria | 2954 |
| 43 | Ga0070679_100018648 | 3300005530 | Bacteria | 6736 |
| 44 | Ga0070679_100130824 | 3300005530 | Bacteria | 2491 |
| 45 | Ga0070697_100017064 | 3300005536 | Bacteria | 5710 |
| 46 | Ga0070697_100038533 | 3300005536 | Bacteria | 3862 |
| 47 | Ga0070697_100181210 | 3300005536 | Bacteria | 1785 |
| 48 | Ga0070695_100003332 | 3300005545 | Bacteria | 9395 |
| 49 | Ga0070695_100016614 | 3300005545 | Bacteria | 4457 |
| 50 | Ga0070695_100047073 | 3300005545 | Bacteria | 2753 |
| 51 | Ga0070696_100140623 | 3300005546 | Bacteria | 1764 |
| 52 | Ga0070696_100146213 | 3300005546 | Bacteria | 1731 |
| 53 | Ga0070704_100012536 | 3300005549 | Bacteria | 5237 |
| 54 | Ga0070704_100194410 | 3300005549 | Bacteria | 1633 |
| 55 | Ga0068855_100048123 | 3300005563 | Bacteria | 5034 |
| 56 | Ga0068855_100061348 | 3300005563 | Bacteria | 4394 |
| 57 | Ga0070664_100000050 | 3300005564 | Bacteria | 71168 |
| 58 | Ga0068857_100002514 | 3300005577 | Bacteria | 15010 |
| 59 | Ga0068857_100043658 | 3300005577 | Bacteria | 3976 |
| 60 | Ga0068854_100000254 | 3300005578 | Bacteria | 36338 |
| 61 | Ga0068856_100000779 | 3300005614 | Bacteria | 34631 |
| 62 | Ga0068856_100153154 | 3300005614 | Bacteria | 2315 |
| 63 | Ga0068852_100072249 | 3300005616 | Bacteria | 3032 |
| 64 | Ga0068859_100030580 | 3300005617 | Bacteria | 5405 |
| 65 | Ga0068860_100101481 | 3300005843 | Bacteria | 2745 |
| 66 | Ga0068862_100007790 | 3300005844 | Bacteria | 8856 |
| 67 | Ga0081539_10001147 | 3300005985 | Bacteria | 47975 |
| 68 | Ga0075365_10152217 | 3300006038 | Bacteria | 1609 |
| 69 | Ga0075368_10003485 | 3300006042 | Bacteria | 5261 |
| 70 | Ga0075363_100063530 | 3300006048 | Bacteria | 1993 |
| 71 | Ga0075362_10054486 | 3300006177 | Bacteria | 1797 |
| 72 | Ga0075367_10021749 | 3300006178 | Bacteria | 3589 |
| 73 | Ga0075369_10051171 | 3300006186 | Unclassified | 1788 |
| 74 | Ga0075366_10020013 | 3300006195 | Bacteria | 3880 |
| 75 | Ga0075428_100000130 | 3300006844 | Bacteria | 65814 |
| 76 | Ga0075428_100006155 | 3300006844 | Bacteria | 13353 |
| 77 | Ga0075428_100135459 | 3300006844 | Bacteria | 2678 |
| 78 | Ga0075430_100098034 | 3300006846 | Bacteria | 2449 |
| 79 | Ga0075431_100001861 | 3300006847 | Bacteria | 19979 |
| 80 | Ga0075431_100037779 | 3300006847 | Bacteria | 4972 |
| 81 | Ga0075433_10273847 | 3300006852 | Bacteria | 1496 |
| 82 | Ga0075434_100000003 | 3300006871 | Bacteria | 134839 |
| 83 | Ga0075434_100018721 | 3300006871 | Bacteria | 6692 |
| 84 | Ga0075429_100000188 | 3300006880 | Bacteria | 40765 |
| 85 | Ga0075429_100001959 | 3300006880 | Bacteria | 17088 |
| 86 | Ga0075436_100001339 | 3300006914 | Bacteria | 16761 |
| 87 | Ga0075436_100021156 | 3300006914 | Bacteria | 4463 |
| 88 | Ga0075436_100140657 | 3300006914 | Bacteria | 1696 |
| 89 | Ga0097620_100030580 | 3300006931 | Bacteria | 5405 |
| 90 | Ga0075435_100024561 | 3300007076 | Bacteria | 4680 |
| 91 | Ga0075435_100039705 | 3300007076 | Bacteria | 3756 |
| 92 | Ga0075435_100430475 | 3300007076 | Unclassified | 1137 |
| 93 | Ga0105240_10077613 | 3300009093 | Bacteria | 4091 |
| 94 | Ga0105240_10198013 | 3300009093 | Bacteria | 2356 |
| 95 | Ga0111539_10003310 | 3300009094 | Bacteria | 21272 |
| 96 | Ga0111539_10012837 | 3300009094 | Bacteria | 10484 |
| 97 | Ga0111539_10137800 | 3300009094 | Bacteria | 2858 |
| 98 | Ga0114129_10000199 | 3300009147 | Bacteria | 66704 |
| 99 | Ga0114129_10000604 | 3300009147 | Bacteria | 44388 |
| 100 | Ga0114129_10202961 | 3300009147 | Bacteria | 2684 |
| 101 | Ga0105242_10001865 | 3300009176 | Bacteria | 16551 |
| 102 | Ga0105238_10024963 | 3300009551 | Bacteria | 6092 |
| 103 | Ga0105249_10105742 | 3300009553 | Bacteria | 2654 |
| 104 | Ga0157373_10018984 | 3300013100 | Bacteria | 5004 |
| 105 | Ga0157371_10000160 | 3300013102 | Bacteria | 98616 |
| 106 | Ga0157370_10000031 | 3300013104 | Bacteria | 139879 |
| 107 | Ga0157369_10013208 | 3300013105 | Bacteria | 9347 |
| 108 | Ga0157372_10000104 | 3300013307 | Bacteria | 88067 |
| 109 | Ga0157372_10351338 | 3300013307 | Bacteria | 1718 |
| 110 | Ga0182008_10071794 | 3300014497 | Bacteria | 1703 |
| 111 | Ga0182006_1001454 | 3300015261 | Bacteria | 14275 |
| 112 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 113 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 114 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 115 | Ga0209674_102144 | 3300025226 | Bacteria | 4450 |
| 116 | Ga0209672_100182 | 3300025228 | Bacteria | 51148 |
| 117 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 118 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 119 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 120 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 121 | Ga0209759_1001964 | 3300025256 | Bacteria | 9889 |
| 122 | Ga0209759_1022903 | 3300025256 | Bacteria | 1388 |
| 123 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 124 | Ga0207653_10001645 | 3300025885 | Bacteria | 7167 |
| 125 | Ga0207705_10035210 | 3300025909 | Bacteria | 3581 |
| 126 | Ga0207707_10004890 | 3300025912 | Bacteria | 11771 |
| 127 | Ga0207707_10114518 | 3300025912 | Bacteria | 2357 |
| 128 | Ga0207695_10006721 | 3300025913 | Bacteria | 14845 |
| 129 | Ga0207663_10088465 | 3300025916 | Bacteria | 2048 |
| 130 | Ga0207660_10112744 | 3300025917 | Bacteria | 2049 |
| 131 | Ga0207657_10032095 | 3300025919 | Bacteria | 4749 |
| 132 | Ga0207649_10000345 | 3300025920 | Bacteria | 35114 |
| 133 | Ga0207652_10028460 | 3300025921 | Bacteria | 4662 |
| 134 | Ga0207652_10053557 | 3300025921 | Bacteria | 3466 |
| 135 | Ga0207694_10024203 | 3300025924 | Bacteria | 4610 |
| 136 | Ga0207690_10001318 | 3300025932 | Bacteria | 15609 |
| 137 | Ga0207706_10018344 | 3300025933 | Bacteria | 6296 |
| 138 | Ga0207686_10028245 | 3300025934 | Bacteria | 3296 |
| 139 | Ga0207679_10000007 | 3300025945 | Bacteria | 460140 |
| 140 | Ga0207667_10124957 | 3300025949 | Bacteria | 2650 |
| 141 | Ga0207712_10092458 | 3300025961 | Bacteria | 2230 |
| 142 | Ga0207640_10000267 | 3300025981 | Bacteria | 35142 |
| 143 | Ga0207678_10000029 | 3300026067 | Bacteria | 112885 |
| 144 | Ga0207708_10015026 | 3300026075 | Bacteria | 5802 |
| 145 | Ga0207702_10000018 | 3300026078 | Bacteria | 212617 |
| 146 | Ga0207702_10024709 | 3300026078 | Bacteria | 4985 |
| 147 | Ga0207702_10125247 | 3300026078 | Bacteria | 2306 |
| 148 | Ga0207674_10020517 | 3300026116 | Bacteria | 7137 |
| 149 | Ga0207698_10213365 | 3300026142 | Bacteria | 1738 |
| 150 | Ga0209969_1000529 | 3300027360 | Bacteria | 5176 |
| 151 | Ga0209967_1002226 | 3300027364 | Bacteria | 2516 |
| 152 | Ga0209981_1000591 | 3300027378 | Bacteria | 4574 |
| 153 | Ga0209996_1001809 | 3300027395 | Bacteria | 2617 |
| 154 | Ga0210000_1000081 | 3300027462 | Bacteria | 13652 |
| 155 | Ga0209995_1000402 | 3300027471 | Bacteria | 6745 |
| 156 | Ga0209968_1004569 | 3300027526 | Bacteria | 2075 |
| 157 | Ga0209999_1002715 | 3300027543 | Bacteria | 3130 |
| 158 | Ga0209998_10004647 | 3300027717 | Unclassified | 2908 |
| 159 | Ga0209813_10005235 | 3300027866 | Bacteria | 3139 |
| 160 | Ga0207428_10000744 | 3300027907 | Bacteria | 37270 |
| 161 | Ga0207428_10002520 | 3300027907 | Bacteria | 18284 |
| 162 | Ga0207428_10003318 | 3300027907 | Bacteria | 15655 |
| 163 | Ga0268265_10004863 | 3300028380 | Bacteria | 9261 |
| 164 | Ga0265340_10034635 | 3300031247 | Bacteria | 2510 |
| 165 | Ga0265339_10068399 | 3300031249 | Bacteria | 1898 |
| 166 | Ga0265327_10006377 | 3300031251 | Bacteria | 9449 |
| 167 | Ga0307408_100093081 | 3300031548 | Bacteria | 2280 |
| 168 | Ga0265342_10000319 | 3300031712 | Bacteria | 54575 |
| 169 | Ga0373962_0033316 | 3300035242 | Bacteria | 1421 |
| 170 | Ga0373935_0024783 | 3300035692 | Bacteria | 3694 |
| 171 | Ga0373927_0097769 | 3300035695 | Unclassified | 1908 |
| 172 | Ga0373925_0026536 | 3300037068 | Bacteria | 4239 |
| 173 | Ga0395900_0516472 | 3300037418 | Bacteria | 1143 |
| 174 | Ga0395905_0001159 | 3300037471 | Bacteria | 32949 |
| 175 | Ga0436364_0186530 | 3300037853 | Bacteria | 2014 |
| 176 | Ga0436360_0206886 | 3300039438 | Bacteria | 4721 |
| 177 | Ga0439434_0001969 | 3300042435 | Bacteria | 5949 |
| 178 | Ga0439435_0001593 | 3300042436 | Bacteria | 4253 |
| 179 | Ga0451577_0006037 | 3300042876 | Bacteria | 12191 |
| 180 | Ga0451577_0425276 | 3300042876 | Bacteria | 1206 |
| 181 | Ga0466986_0058207 | 3300044650 | Bacteria | 2674 |
| 182 | Ga0466969_0052231 | 3300044656 | Bacteria | 2008 |
| 183 | Ga0466982_0120660 | 3300044672 | Bacteria | 1617 |
| 184 | Ga0466965_0015941 | 3300044683 | Bacteria | 3570 |
| 185 | Ga0466961_0000951 | 3300044693 | Bacteria | 17939 |
| 186 | Ga0466963_0142109 | 3300044694 | Bacteria | 1663 |
| 187 | Ga0453684_0161274 | 3300044712 | Bacteria | 2652 |
| 188 | Ga0466971_0055600 | 3300044719 | Bacteria | 1784 |
| 189 | Ga0466970_0003585 | 3300044765 | Bacteria | 7568 |
| 190 | Ga0466957_0020062 | 3300044842 | Bacteria | 3933 |
| 191 | Ga0466960_0023949 | 3300044901 | Bacteria | 2748 |
| 192 | Ga0466959_0004328 | 3300045049 | Bacteria | 9485 |
| 193 | Ga0451576_0022894 | 3300045051 | Bacteria | 6769 |
| 194 | Ga0451576_0035415 | 3300045051 | Bacteria | 5295 |
| 195 | Ga0451576_0277795 | 3300045051 | Bacteria | 1751 |
| 196 | Ga0466967_0015961 | 3300045976 | Bacteria | 5905 |
| 197 | Ga0466967_0385869 | 3300045976 | Unclassified | 1361 |
| 198 | Ga0495642_0020955 | 3300046528 | Bacteria | 2570 |
| 199 | Ga0496117_0023677 | 3300048920 | Bacteria | 4883 |
| 200 | Ga0496118_0009250 | 3300048921 | Bacteria | 10001 |
| 201 | Ga0496119_0081941 | 3300048922 | Bacteria | 1856 |
| 202 | Ga0496125_0016831 | 3300048928 | Bacteria | 7006 |
| 203 | Ga0501032_0060376 | 3300049569 | Bacteria | 2543 |
| 204 | Ga0501033_0026097 | 3300049570 | Bacteria | 4398 |
| 205 | Ga0501036_0184276 | 3300049572 | Bacteria | 1757 |
| 206 | Ga0501036_0358335 | 3300049572 | Bacteria | 1218 |
| 207 | Ga0501038_0026208 | 3300049574 | Bacteria | 5193 |
| 208 | Ga0501039_0232064 | 3300049575 | Bacteria | 1451 |
| 209 | Ga0501040_0061142 | 3300049576 | Bacteria | 2590 |
| 210 | Ga0501040_0104839 | 3300049576 | Bacteria | 1975 |
| 211 | Ga0501043_0063550 | 3300049579 | Bacteria | 2899 |
| 212 | Ga0501046_0028282 | 3300049580 | Bacteria | 4567 |
| 213 | Ga0501047_0005106 | 3300049581 | Bacteria | 12316 |
| 214 | Ga0501047_0174762 | 3300049581 | Bacteria | 2015 |
| 215 | Ga0501047_0253795 | 3300049581 | Bacteria | 1607 |
| 216 | Ga0501069_0075116 | 3300049585 | Bacteria | 1898 |
| 217 | Ga0501072_0099845 | 3300049588 | Bacteria | 2307 |
| 218 | Ga0501075_0023131 | 3300049591 | Bacteria | 4548 |
| 219 | Ga0501076_0135341 | 3300049592 | Unclassified | 2000 |
| 220 | Ga0501080_0152141 | 3300049742 | Bacteria | 2138 |
| 221 | Ga0501081_0002379 | 3300049743 | Bacteria | 11846 |
| 222 | Ga0501035_0306844 | 3300049822 | Unclassified | 1336 |
| 223 | Ga0501044_0014563 | 3300049823 | Bacteria | 8483 |
| 224 | Ga0501044_0079274 | 3300049823 | Bacteria | 3328 |
| 225 | Ga0501045_0067225 | 3300049824 | Bacteria | 2632 |
| 226 | nmdc:mga03683_5341_c1 | 3300050489 | Bacteria | 4336 |
| 227 | nmdc:mga00v17_57500_c1 | 3300050491 | Bacteria | 2380 |
| 228 | nmdc:mga0yw44_56098_c1 | 3300050492 | Bacteria | 2399 |
| 229 | nmdc:mga0k408_68192_c1 | 3300050493 | Bacteria | 2075 |
| 230 | nmdc:mga05p37_383_c1 | 3300050507 | Bacteria | 47792 |
| 231 | nmdc:mga05p37_49025_c1 | 3300050507 | Bacteria | 5194 |
| 232 | nmdc:mga09592_2774_c1 | 3300050508 | Bacteria | 14180 |
| 233 | nmdc:mga09592_4666_c1 | 3300050508 | Bacteria | 11094 |
| 234 | nmdc:mga06r32_250017_c1 | 3300050510 | Bacteria | 1760 |
| 235 | nmdc:mga06r32_57555_c1 | 3300050510 | Bacteria | 3734 |
| 236 | nmdc:mga06r32_711_c2 | 3300050510 | Bacteria | 27826 |
| 237 | nmdc:mga08y16_1988_c1 | 3300050511 | Bacteria | 20869 |
| 238 | nmdc:mga08y16_369_c1 | 3300050511 | Bacteria | 40785 |
| 239 | nmdc:mga08y16_43862_c1 | 3300050511 | Bacteria | 4687 |
| 240 | nmdc:mga0n895_1936_c1 | 3300050512 | Bacteria | 15884 |
| 241 | nmdc:mga0n895_26585_c1 | 3300050512 | Bacteria | 5484 |
| 242 | nmdc:mga0n895_84997_c1 | 3300050512 | Bacteria | 3158 |
| 243 | nmdc:mga0rr50_143325_c1 | 3300050513 | Bacteria | 1924 |
| 244 | nmdc:mga0rr50_400171_c1 | 3300050513 | Bacteria | 1160 |
| 245 | nmdc:mga0rr50_7116_c1 | 3300050513 | Bacteria | 6871 |
| 246 | nmdc:mga08x19_18497_c1 | 3300050514 | Bacteria | 4270 |
| 247 | nmdc:mga08x19_49131_c2 | 3300050514 | Bacteria | 1634 |
| 248 | nmdc:mga08x19_5722_c1 | 3300050514 | Bacteria | 7347 |
| 249 | nmdc:mga0a205_219385_c1 | 3300050515 | Bacteria | 1788 |
| 250 | nmdc:mga0a205_2406_c1 | 3300050515 | Bacteria | 16504 |
| 251 | nmdc:mga0sz30_56269_c1 | 3300050516 | Unclassified | 1675 |
| 252 | Ga0500594_0001078 | 3300053118 | Bacteria | 5852 |
| 253 | Ga0500616_0000541 | 3300053153 | Bacteria | 47231 |
| 254 | Ga0501084_0143237 | 3300054114 | Bacteria | 2013 |
| 255 | Ga0466962_0010361 | 3300061719 | Bacteria | 4479 |
| 256 | Ga0530510_0001325 | 3300061734 | Bacteria | 16554 |
| 257 | Ga0530510_0015242 | 3300061734 | Bacteria | 5428 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027526 | Ga0209968_1004569 | Ga0209968_10045692 | 296 |
| 2 | 3300050513 | nmdc:mga0rr50_400171_c1 | nmdc:mga0rr50_400171_c1_203_1135 | 308 |
| 3 | 3300005341 | Ga0070691_10005671 | Ga0070691_100056714 | 313 |
| 4 | 3300005406 | Ga0070703_10001649 | Ga0070703_100016492 | 313 |
| 5 | 3300005440 | Ga0070705_100014149 | Ga0070705_1000141493 | 313 |
| 6 | 3300005441 | Ga0070700_100018699 | Ga0070700_1000186993 | 313 |
| 7 | 3300005843 | Ga0068860_100101481 | Ga0068860_1001014812 | 313 |
| 8 | 3300025885 | Ga0207653_10001645 | Ga0207653_100016456 | 313 |
| 9 | 3300026075 | Ga0207708_10015026 | Ga0207708_100150264 | 313 |
| 10 | 3300053153 | Ga0500616_0000541 | Ga0500616_0000541_14984_15934 | 313 |
| 11 | 3300005546 | Ga0070696_100140623 | Ga0070696_1001406232 | 318 |
| 12 | 3300027360 | Ga0209969_1000529 | Ga0209969_10005292 | 322 |
| 13 | 3300027364 | Ga0209967_1002226 | Ga0209967_10022262 | 322 |
| 14 | 3300027378 | Ga0209981_1000591 | Ga0209981_10005913 | 322 |
| 15 | 3300027395 | Ga0209996_1001809 | Ga0209996_10018093 | 322 |
| 16 | 3300027462 | Ga0210000_1000081 | Ga0210000_10000817 | 322 |
| 17 | 3300027471 | Ga0209995_1000402 | Ga0209995_10004023 | 322 |
| 18 | 3300027543 | Ga0209999_1002715 | Ga0209999_10027152 | 322 |
| 19 | 3300005439 | Ga0070711_100163192 | Ga0070711_1001631921 | 327 |
| 20 | 3300005457 | Ga0070662_100026177 | Ga0070662_1000261773 | 327 |
| 21 | 3300005844 | Ga0068862_100007790 | Ga0068862_1000077902 | 327 |
| 22 | 3300006844 | Ga0075428_100135459 | Ga0075428_1001354593 | 327 |
| 23 | 3300009094 | Ga0111539_10137800 | Ga0111539_101378002 | 327 |
| 24 | 3300009147 | Ga0114129_10202961 | Ga0114129_102029612 | 327 |
| 25 | 3300025933 | Ga0207706_10018344 | Ga0207706_100183444 | 327 |
| 26 | 3300027717 | Ga0209998_10004647 | Ga0209998_100046472 | 327 |
| 27 | 3300027907 | Ga0207428_10000744 | Ga0207428_100007446 | 327 |
| 28 | 3300028380 | Ga0268265_10004863 | Ga0268265_100048634 | 327 |
| 29 | 3300042876 | Ga0451577_0006037 | Ga0451577_0006037_10096_11085 | 327 |
| 30 | 3300044712 | Ga0453684_0161274 | Ga0453684_0161274_1299_2288 | 327 |
| 31 | 3300045051 | Ga0451576_0035415 | Ga0451576_0035415_2056_3045 | 327 |
| 32 | 3300045051 | Ga0451576_0277795 | Ga0451576_0277795_280_1269 | 327 |
| 33 | 3300050511 | nmdc:mga08y16_43862_c1 | nmdc:mga08y16_43862_c1_2162_3151 | 327 |
| 34 | 3300050512 | nmdc:mga0n895_84997_c1 | nmdc:mga0n895_84997_c1_1931_2920 | 327 |
| 35 | 3300005545 | Ga0070695_100047073 | Ga0070695_1000470732 | 328 |
| 36 | 3300005617 | Ga0068859_100030580 | Ga0068859_1000305802 | 328 |
| 37 | 3300006847 | Ga0075431_100037779 | Ga0075431_1000377794 | 328 |
| 38 | 3300006931 | Ga0097620_100030580 | Ga0097620_1000305802 | 328 |
| 39 | 3300009176 | Ga0105242_10001865 | Ga0105242_1000186512 | 328 |
| 40 | 3300025934 | Ga0207686_10028245 | Ga0207686_100282453 | 328 |
| 41 | 3300049575 | Ga0501039_0232064 | Ga0501039_0232064_301_1341 | 328 |
| 42 | 3300050510 | nmdc:mga06r32_57555_c1 | nmdc:mga06r32_57555_c1_2422_3417 | 328 |
| 43 | 3300050515 | nmdc:mga0a205_2406_c1 | nmdc:mga0a205_2406_c1_1203_2198 | 328 |
| 44 | 3300005445 | Ga0070708_100095056 | Ga0070708_1000950562 | 329 |
| 45 | 3300005518 | Ga0070699_100074460 | Ga0070699_1000744604 | 329 |
| 46 | 3300005536 | Ga0070697_100017064 | Ga0070697_1000170649 | 329 |
| 47 | 3300005345 | Ga0070692_10000832 | Ga0070692_100008328 | 330 |
| 48 | 3300005438 | Ga0070701_10020907 | Ga0070701_100209073 | 330 |
| 49 | 3300005518 | Ga0070699_100014029 | Ga0070699_1000140292 | 330 |
| 50 | 3300005536 | Ga0070697_100181210 | Ga0070697_1001812101 | 330 |
| 51 | 3300005549 | Ga0070704_100012536 | Ga0070704_1000125363 | 330 |
| 52 | 3300005577 | Ga0068857_100043658 | Ga0068857_1000436583 | 330 |
| 53 | 3300009553 | Ga0105249_10105742 | Ga0105249_101057422 | 330 |
| 54 | 3300025961 | Ga0207712_10092458 | Ga0207712_100924582 | 330 |
| 55 | 3300037853 | Ga0436364_0186530 | Ga0436364_0186530_723_1730 | 330 |
| 56 | 3300050510 | nmdc:mga06r32_250017_c1 | nmdc:mga06r32_250017_c1_362_1363 | 330 |
| 57 | iso_pu_bacteria | 2596583598 | 2597031350 | 330 |
| 58 | iso_pu_bacteria | 2599185178 | 2599447235 | 330 |
| 59 | iso_pu_bacteria | 2885266251 | 2885270104 | 330 |
| 60 | iso_pu_bacteria | 2900577576 | 2900577794 | 330 |
| 61 | iso_pu_bacteria | 2928058823 | 2928061062 | 330 |
| 62 | 3300005437 | Ga0070710_10086718 | Ga0070710_100867182 | 331 |
| 63 | 3300006844 | Ga0075428_100000130 | Ga0075428_10000013033 | 331 |
| 64 | 3300006880 | Ga0075429_100000188 | Ga0075429_1000001886 | 331 |
| 65 | 3300009094 | Ga0111539_10012837 | Ga0111539_100128374 | 331 |
| 66 | 3300009147 | Ga0114129_10000604 | Ga0114129_1000060412 | 331 |
| 67 | 3300027907 | Ga0207428_10002520 | Ga0207428_100025206 | 331 |
| 68 | 3300045051 | Ga0451576_0022894 | Ga0451576_0022894_960_1958 | 331 |
| 69 | 3300050507 | nmdc:mga05p37_49025_c1 | nmdc:mga05p37_49025_c1_1721_2719 | 331 |
| 70 | 3300050508 | nmdc:mga09592_2774_c1 | nmdc:mga09592_2774_c1_2579_3577 | 331 |
| 71 | 3300050511 | nmdc:mga08y16_1988_c1 | nmdc:mga08y16_1988_c1_3113_4111 | 331 |
| 72 | 3300005530 | Ga0070679_100130824 | Ga0070679_1001308242 | 332 |
| 73 | 3300006186 | Ga0075369_10051171 | Ga0075369_100511712 | 332 |
| 74 | 3300025916 | Ga0207663_10088465 | Ga0207663_100884652 | 332 |
| 75 | 3300031247 | Ga0265340_10034635 | Ga0265340_100346353 | 332 |
| 76 | 3300037471 | Ga0395905_0001159 | Ga0395905_0001159_25347_26348 | 332 |
| 77 | 3300039438 | Ga0436360_0206886 | Ga0436360_0206886_3378_4412 | 332 |
| 78 | 3300049574 | Ga0501038_0026208 | Ga0501038_0026208_2192_3196 | 332 |
| 79 | 3300049576 | Ga0501040_0061142 | Ga0501040_0061142_1219_2223 | 332 |
| 80 | 3300049580 | Ga0501046_0028282 | Ga0501046_0028282_461_1465 | 332 |
| 81 | 3300049742 | Ga0501080_0152141 | Ga0501080_0152141_359_1363 | 332 |
| 82 | 3300049743 | Ga0501081_0002379 | Ga0501081_0002379_8953_9957 | 332 |
| 83 | 3300050516 | nmdc:mga0sz30_56269_c1 | nmdc:mga0sz30_56269_c1_194_1213 | 332 |
| 84 | 3300061734 | Ga0530510_0001325 | Ga0530510_0001325_7652_8656 | 332 |
| 85 | 3300061734 | Ga0530510_0015242 | Ga0530510_0015242_3471_4475 | 332 |
| 86 | 3300005435 | Ga0070714_100054928 | Ga0070714_1000549282 | 333 |
| 87 | 3300005563 | Ga0068855_100048123 | Ga0068855_1000481234 | 333 |
| 88 | 3300005614 | Ga0068856_100153154 | Ga0068856_1001531542 | 333 |
| 89 | 3300009551 | Ga0105238_10024963 | Ga0105238_100249636 | 333 |
| 90 | 3300013307 | Ga0157372_10351338 | Ga0157372_103513382 | 333 |
| 91 | 3300025924 | Ga0207694_10024203 | Ga0207694_100242032 | 333 |
| 92 | 3300026078 | Ga0207702_10024709 | Ga0207702_100247092 | 333 |
| 93 | 3300026078 | Ga0207702_10125247 | Ga0207702_101252472 | 333 |
| 94 | 3300031548 | Ga0307408_100093081 | Ga0307408_1000930812 | 333 |
| 95 | 3300035692 | Ga0373935_0024783 | Ga0373935_0024783_2482_3513 | 333 |
| 96 | 3300035695 | Ga0373927_0097769 | Ga0373927_0097769_735_1766 | 333 |
| 97 | 3300037068 | Ga0373925_0026536 | Ga0373925_0026536_762_1793 | 333 |
| 98 | 3300049823 | Ga0501044_0079274 | Ga0501044_0079274_2274_3275 | 333 |
| 99 | 3300001915 | JGI24741J21665_1000023 | JGI24741J21665_100002331 | 334 |
| 100 | 3300001979 | JGI24740J21852_10007801 | JGI24740J21852_100078012 | 334 |
| 101 | 3300002705 | JGI25156J39149_1013411 | JGI25156J39149_10134112 | 334 |
| 102 | 3300003316 | rootH1_10076303 | rootH1_100763033 | 334 |
| 103 | 3300003578 | Ga0006562J51391_1094042 | Ga0006562J51391_10940422 | 334 |
| 104 | 3300003751 | Ga0055538_1001994 | Ga0055538_10019943 | 334 |
| 105 | 3300003752 | Ga0055539_1000149 | Ga0055539_100014960 | 334 |
| 106 | 3300003756 | Ga0055533_1002667 | Ga0055533_10026673 | 334 |
| 107 | 3300003758 | Ga0055532_1000006 | Ga0055532_1000006360 | 334 |
| 108 | 3300003759 | Ga0055525_1000386 | Ga0055525_100038611 | 334 |
| 109 | 3300003760 | Ga0055527_1001133 | Ga0055527_10011336 | 334 |
| 110 | 3300003761 | Ga0055535_1000004 | Ga0055535_1000004360 | 334 |
| 111 | 3300003763 | Ga0055529_1000118 | Ga0055529_100011838 | 334 |
| 112 | 3300005327 | Ga0070658_10012053 | Ga0070658_100120537 | 334 |
| 113 | 3300005336 | Ga0070680_100001410 | Ga0070680_10000141011 | 334 |
| 114 | 3300005339 | Ga0070660_100007654 | Ga0070660_1000076542 | 334 |
| 115 | 3300005339 | Ga0070660_100058731 | Ga0070660_1000587313 | 334 |
| 116 | 3300005344 | Ga0070661_100000059 | Ga0070661_10000005958 | 334 |
| 117 | 3300005366 | Ga0070659_100007638 | Ga0070659_1000076382 | 334 |
| 118 | 3300005366 | Ga0070659_100045557 | Ga0070659_1000455573 | 334 |
| 119 | 3300005439 | Ga0070711_100341958 | Ga0070711_1003419582 | 334 |
| 120 | 3300005440 | Ga0070705_100037542 | Ga0070705_1000375423 | 334 |
| 121 | 3300005444 | Ga0070694_100009738 | Ga0070694_1000097387 | 334 |
| 122 | 3300005455 | Ga0070663_100000003 | Ga0070663_10000000332 | 334 |
| 123 | 3300005458 | Ga0070681_10003269 | Ga0070681_1000326912 | 334 |
| 124 | 3300005458 | Ga0070681_10037950 | Ga0070681_100379503 | 334 |
| 125 | 3300005459 | Ga0068867_100144413 | Ga0068867_1001444132 | 334 |
| 126 | 3300005467 | Ga0070706_100417919 | Ga0070706_1004179191 | 334 |
| 127 | 3300005471 | Ga0070698_100304280 | Ga0070698_1003042802 | 334 |
| 128 | 3300005530 | Ga0070679_100018648 | Ga0070679_1000186485 | 334 |
| 129 | 3300005536 | Ga0070697_100038533 | Ga0070697_1000385332 | 334 |
| 130 | 3300005545 | Ga0070695_100003332 | Ga0070695_1000033328 | 334 |
| 131 | 3300005545 | Ga0070695_100016614 | Ga0070695_1000166143 | 334 |
| 132 | 3300005546 | Ga0070696_100146213 | Ga0070696_1001462132 | 334 |
| 133 | 3300005549 | Ga0070704_100194410 | Ga0070704_1001944102 | 334 |
| 134 | 3300005563 | Ga0068855_100061348 | Ga0068855_1000613484 | 334 |
| 135 | 3300005564 | Ga0070664_100000050 | Ga0070664_10000005042 | 334 |
| 136 | 3300005577 | Ga0068857_100002514 | Ga0068857_1000025147 | 334 |
| 137 | 3300005578 | Ga0068854_100000254 | Ga0068854_10000025429 | 334 |
| 138 | 3300005614 | Ga0068856_100000779 | Ga0068856_10000077931 | 334 |
| 139 | 3300005616 | Ga0068852_100072249 | Ga0068852_1000722492 | 334 |
| 140 | 3300005985 | Ga0081539_10001147 | Ga0081539_1000114726 | 334 |
| 141 | 3300006038 | Ga0075365_10152217 | Ga0075365_101522172 | 334 |
| 142 | 3300006042 | Ga0075368_10003485 | Ga0075368_100034852 | 334 |
| 143 | 3300006048 | Ga0075363_100063530 | Ga0075363_1000635301 | 334 |
| 144 | 3300006177 | Ga0075362_10054486 | Ga0075362_100544862 | 334 |
| 145 | 3300006178 | Ga0075367_10021749 | Ga0075367_100217492 | 334 |
| 146 | 3300006195 | Ga0075366_10020013 | Ga0075366_100200132 | 334 |
| 147 | 3300006844 | Ga0075428_100006155 | Ga0075428_10000615516 | 334 |
| 148 | 3300006846 | Ga0075430_100098034 | Ga0075430_1000980341 | 334 |
| 149 | 3300006847 | Ga0075431_100001861 | Ga0075431_1000018614 | 334 |
| 150 | 3300006852 | Ga0075433_10273847 | Ga0075433_102738472 | 334 |
| 151 | 3300006871 | Ga0075434_100000003 | Ga0075434_10000000381 | 334 |
| 152 | 3300006871 | Ga0075434_100018721 | Ga0075434_1000187214 | 334 |
| 153 | 3300006880 | Ga0075429_100001959 | Ga0075429_1000019594 | 334 |
| 154 | 3300006914 | Ga0075436_100001339 | Ga0075436_1000013397 | 334 |
| 155 | 3300006914 | Ga0075436_100021156 | Ga0075436_1000211562 | 334 |
| 156 | 3300006914 | Ga0075436_100140657 | Ga0075436_1001406572 | 334 |
| 157 | 3300007076 | Ga0075435_100024561 | Ga0075435_1000245614 | 334 |
| 158 | 3300007076 | Ga0075435_100039705 | Ga0075435_1000397053 | 334 |
| 159 | 3300007076 | Ga0075435_100430475 | Ga0075435_1004304751 | 334 |
| 160 | 3300009093 | Ga0105240_10077613 | Ga0105240_100776132 | 334 |
| 161 | 3300009093 | Ga0105240_10198013 | Ga0105240_101980132 | 334 |
| 162 | 3300009094 | Ga0111539_10003310 | Ga0111539_1000331016 | 334 |
| 163 | 3300009147 | Ga0114129_10000199 | Ga0114129_1000019916 | 334 |
| 164 | 3300013100 | Ga0157373_10018984 | Ga0157373_100189842 | 334 |
| 165 | 3300013102 | Ga0157371_10000160 | Ga0157371_1000016075 | 334 |
| 166 | 3300013104 | Ga0157370_10000031 | Ga0157370_1000003186 | 334 |
| 167 | 3300013105 | Ga0157369_10013208 | Ga0157369_1001320810 | 334 |
| 168 | 3300013307 | Ga0157372_10000104 | Ga0157372_1000010460 | 334 |
| 169 | 3300014497 | Ga0182008_10071794 | Ga0182008_100717941 | 334 |
| 170 | 3300015261 | Ga0182006_1001454 | Ga0182006_10014547 | 334 |
| 171 | 3300025224 | Ga0209784_100006 | Ga0209784_100006694 | 334 |
| 172 | 3300025225 | Ga0209566_100002 | Ga0209566_100002694 | 334 |
| 173 | 3300025226 | Ga0209674_100010 | Ga0209674_100010442 | 334 |
| 174 | 3300025226 | Ga0209674_102144 | Ga0209674_1021445 | 334 |
| 175 | 3300025228 | Ga0209672_100182 | Ga0209672_10018218 | 334 |
| 176 | 3300025229 | Ga0209147_100015 | Ga0209147_100015189 | 334 |
| 177 | 3300025230 | Ga0209563_100004 | Ga0209563_100004105 | 334 |
| 178 | 3300025242 | Ga0209258_100021 | Ga0209258_100021189 | 334 |
| 179 | 3300025253 | Ga0209677_100007 | Ga0209677_100007694 | 334 |
| 180 | 3300025256 | Ga0209759_1001964 | Ga0209759_100196411 | 334 |
| 181 | 3300025256 | Ga0209759_1022903 | Ga0209759_10229031 | 334 |
| 182 | 3300025272 | Ga0209455_1000028 | Ga0209455_1000028189 | 334 |
| 183 | 3300025909 | Ga0207705_10035210 | Ga0207705_100352102 | 334 |
| 184 | 3300025912 | Ga0207707_10004890 | Ga0207707_100048906 | 334 |
| 185 | 3300025912 | Ga0207707_10114518 | Ga0207707_101145182 | 334 |
| 186 | 3300025913 | Ga0207695_10006721 | Ga0207695_100067215 | 334 |
| 187 | 3300025917 | Ga0207660_10112744 | Ga0207660_101127442 | 334 |
| 188 | 3300025919 | Ga0207657_10032095 | Ga0207657_100320952 | 334 |
| 189 | 3300025920 | Ga0207649_10000345 | Ga0207649_100003457 | 334 |
| 190 | 3300025921 | Ga0207652_10028460 | Ga0207652_100284602 | 334 |
| 191 | 3300025921 | Ga0207652_10053557 | Ga0207652_100535572 | 334 |
| 192 | 3300025932 | Ga0207690_10001318 | Ga0207690_100013188 | 334 |
| 193 | 3300025945 | Ga0207679_10000007 | Ga0207679_10000007255 | 334 |
| 194 | 3300025949 | Ga0207667_10124957 | Ga0207667_101249572 | 334 |
| 195 | 3300025981 | Ga0207640_10000267 | Ga0207640_1000026711 | 334 |
| 196 | 3300026067 | Ga0207678_10000029 | Ga0207678_1000002988 | 334 |
| 197 | 3300026078 | Ga0207702_10000018 | Ga0207702_10000018198 | 334 |
| 198 | 3300026116 | Ga0207674_10020517 | Ga0207674_100205172 | 334 |
| 199 | 3300026142 | Ga0207698_10213365 | Ga0207698_102133652 | 334 |
| 200 | 3300027866 | Ga0209813_10005235 | Ga0209813_100052352 | 334 |
| 201 | 3300027907 | Ga0207428_10003318 | Ga0207428_100033183 | 334 |
| 202 | 3300031249 | Ga0265339_10068399 | Ga0265339_100683992 | 334 |
| 203 | 3300031251 | Ga0265327_10006377 | Ga0265327_100063777 | 334 |
| 204 | 3300031712 | Ga0265342_10000319 | Ga0265342_1000031924 | 334 |
| 205 | 3300035242 | Ga0373962_0033316 | Ga0373962_0033316_53_1063 | 334 |
| 206 | 3300037418 | Ga0395900_0516472 | Ga0395900_0516472_11_1015 | 334 |
| 207 | 3300042435 | Ga0439434_0001969 | Ga0439434_0001969_2925_3980 | 334 |
| 208 | 3300042436 | Ga0439435_0001593 | Ga0439435_0001593_2623_3678 | 334 |
| 209 | 3300042876 | Ga0451577_0425276 | Ga0451577_0425276_55_1086 | 334 |
| 210 | 3300044650 | Ga0466986_0058207 | Ga0466986_0058207_1295_2299 | 334 |
| 211 | 3300044656 | Ga0466969_0052231 | Ga0466969_0052231_547_1551 | 334 |
| 212 | 3300044672 | Ga0466982_0120660 | Ga0466982_0120660_182_1186 | 334 |
| 213 | 3300044683 | Ga0466965_0015941 | Ga0466965_0015941_1303_2307 | 334 |
| 214 | 3300044693 | Ga0466961_0000951 | Ga0466961_0000951_10153_11157 | 334 |
| 215 | 3300044694 | Ga0466963_0142109 | Ga0466963_0142109_366_1370 | 334 |
| 216 | 3300044719 | Ga0466971_0055600 | Ga0466971_0055600_251_1255 | 334 |
| 217 | 3300044765 | Ga0466970_0003585 | Ga0466970_0003585_5185_6189 | 334 |
| 218 | 3300044842 | Ga0466957_0020062 | Ga0466957_0020062_1786_2790 | 334 |
| 219 | 3300044901 | Ga0466960_0023949 | Ga0466960_0023949_267_1271 | 334 |
| 220 | 3300045049 | Ga0466959_0004328 | Ga0466959_0004328_6776_7780 | 334 |
| 221 | 3300045976 | Ga0466967_0015961 | Ga0466967_0015961_2044_3048 | 334 |
| 222 | 3300045976 | Ga0466967_0385869 | Ga0466967_0385869_286_1344 | 334 |
| 223 | 3300046528 | Ga0495642_0020955 | Ga0495642_0020955_1284_2300 | 334 |
| 224 | 3300048920 | Ga0496117_0023677 | Ga0496117_0023677_2985_3998 | 334 |
| 225 | 3300048921 | Ga0496118_0009250 | Ga0496118_0009250_3412_4425 | 334 |
| 226 | 3300048922 | Ga0496119_0081941 | Ga0496119_0081941_434_1447 | 334 |
| 227 | 3300048928 | Ga0496125_0016831 | Ga0496125_0016831_5569_6573 | 334 |
| 228 | 3300049569 | Ga0501032_0060376 | Ga0501032_0060376_795_1844 | 334 |
| 229 | 3300049570 | Ga0501033_0026097 | Ga0501033_0026097_2589_3638 | 334 |
| 230 | 3300049572 | Ga0501036_0184276 | Ga0501036_0184276_600_1649 | 334 |
| 231 | 3300049572 | Ga0501036_0358335 | Ga0501036_0358335_19_1041 | 334 |
| 232 | 3300049576 | Ga0501040_0104839 | Ga0501040_0104839_187_1209 | 334 |
| 233 | 3300049579 | Ga0501043_0063550 | Ga0501043_0063550_891_1940 | 334 |
| 234 | 3300049581 | Ga0501047_0005106 | Ga0501047_0005106_1129_2148 | 334 |
| 235 | 3300049581 | Ga0501047_0174762 | Ga0501047_0174762_346_1362 | 334 |
| 236 | 3300049581 | Ga0501047_0253795 | Ga0501047_0253795_189_1238 | 334 |
| 237 | 3300049585 | Ga0501069_0075116 | Ga0501069_0075116_74_1084 | 334 |
| 238 | 3300049588 | Ga0501072_0099845 | Ga0501072_0099845_1239_2261 | 334 |
| 239 | 3300049591 | Ga0501075_0023131 | Ga0501075_0023131_3477_4523 | 334 |
| 240 | 3300049592 | Ga0501076_0135341 | Ga0501076_0135341_730_1788 | 334 |
| 241 | 3300049822 | Ga0501035_0306844 | Ga0501035_0306844_120_1265 | 334 |
| 242 | 3300049823 | Ga0501044_0014563 | Ga0501044_0014563_635_1654 | 334 |
| 243 | 3300049824 | Ga0501045_0067225 | Ga0501045_0067225_920_1978 | 334 |
| 244 | 3300050489 | nmdc:mga03683_5341_c1 | nmdc:mga03683_5341_c1_2551_3582 | 334 |
| 245 | 3300050491 | nmdc:mga00v17_57500_c1 | nmdc:mga00v17_57500_c1_831_1862 | 334 |
| 246 | 3300050492 | nmdc:mga0yw44_56098_c1 | nmdc:mga0yw44_56098_c1_757_1788 | 334 |
| 247 | 3300050493 | nmdc:mga0k408_68192_c1 | nmdc:mga0k408_68192_c1_767_1798 | 334 |
| 248 | 3300050507 | nmdc:mga05p37_383_c1 | nmdc:mga05p37_383_c1_30890_31906 | 334 |
| 249 | 3300050508 | nmdc:mga09592_4666_c1 | nmdc:mga09592_4666_c1_1146_2162 | 334 |
| 250 | 3300050510 | nmdc:mga06r32_711_c2 | nmdc:mga06r32_711_c2_12169_13185 | 334 |
| 251 | 3300050511 | nmdc:mga08y16_369_c1 | nmdc:mga08y16_369_c1_26977_27993 | 334 |
| 252 | 3300050512 | nmdc:mga0n895_1936_c1 | nmdc:mga0n895_1936_c1_12157_13164 | 334 |
| 253 | 3300050512 | nmdc:mga0n895_26585_c1 | nmdc:mga0n895_26585_c1_2581_3588 | 334 |
| 254 | 3300050513 | nmdc:mga0rr50_143325_c1 | nmdc:mga0rr50_143325_c1_278_1285 | 334 |
| 255 | 3300050513 | nmdc:mga0rr50_7116_c1 | nmdc:mga0rr50_7116_c1_143_1150 | 334 |
| 256 | 3300050514 | nmdc:mga08x19_18497_c1 | nmdc:mga08x19_18497_c1_2583_3593 | 334 |
| 257 | 3300050514 | nmdc:mga08x19_49131_c2 | nmdc:mga08x19_49131_c2_332_1339 | 334 |
| 258 | 3300050514 | nmdc:mga08x19_5722_c1 | nmdc:mga08x19_5722_c1_3133_4155 | 334 |
| 259 | 3300050515 | nmdc:mga0a205_219385_c1 | nmdc:mga0a205_219385_c1_472_1479 | 334 |
| 260 | 3300053118 | Ga0500594_0001078 | Ga0500594_0001078_3623_4654 | 334 |
| 261 | 3300054114 | Ga0501084_0143237 | Ga0501084_0143237_894_1952 | 334 |
| 262 | 3300061719 | Ga0466962_0010361 | Ga0466962_0010361_3096_4100 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8868 | 1 | 325 |
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.8821 | 1 | 328 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8741 | 1 | 325 |
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.8649 | 1 | 328 |
| 1xkj-assembly1.cif.gz_B | bacterial luciferase beta2 homodimer | 0.8552 | 1 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9042 | 1 | 327 | 3.20.20.30 |
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8837 | 1 | 327 | 3.20.20.30 |
| 1bslA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8665 | 1 | 314 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8618 | 1 | 328 | 3.20.20.30 |
| 6friA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8462 | 1 | 321 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3ZHA3-F1-model_v4 | Luciferase | 0.9656 | 1 | 328 |
GO:0005829
GO:0016705 |
| AF-A0A1F3ZHA3-F1-model_v4 | Luciferase | 0.9458 | 1 | 328 |
GO:0005829
GO:0016705 |
| AF-G5LU41-F1-model_v4 | Luciferase-like monooxygenase | 0.9423 | 1 | 108 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A3D2XZF9-F1-model_v4 | Alkane 1-monooxygenase | 0.9394 | 1 | 108 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A3R9TDX2-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9369 | 1 | 107 |
GO:0005829
GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar