F371286

General Info

Members Datasets Scaffolds Average Seq Length
262 175 524 94

Family's Representative Sequence

Representative Sequence 3300044659|Ga0466973_0225331|Ga0466973_0225331_588_911
Length 100
Sequence MFSSASKSFYIGRMSELPTGPVAAEISRRLTAALAPTRLAVIDDSESHRSGESHFTVEIESPAFAGQSRVARQRAVNAALGDLLRDRIHALAIRAKAPGE

Samples

Sample ID Description Type Environment
1 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
147 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
173 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
174 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
175 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 1.91
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 3.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466973_0225331 3300044659 Bacteria 1355
2 JGI24752J21851_1020371 3300001976 Bacteria 866
3 JGI24740J21852_10011855 3300001979 Bacteria 3307
4 JGI24739J22299_10020276 3300001989 Bacteria 2375
5 JGI24739J22299_10182409 3300001989 Bacteria 618
6 JGI24737J22298_10050955 3300001990 Bacteria 1257
7 JGI24735J21928_10009185 3300002067 Bacteria 3179
8 JGI24034J26672_10054459 3300002239 Bacteria 693
9 rootL2_10052019 3300003322 Bacteria 1463
10 Ga0065707_10298575 3300005295 Bacteria 1009
11 Ga0070658_11119327 3300005327 Bacteria 685
12 Ga0070676_10802558 3300005328 Bacteria 695
13 Ga0070676_11070739 3300005328 Bacteria 608
14 Ga0070683_100766177 3300005329 Bacteria 925
15 Ga0070666_10254632 3300005335 Bacteria 1243
16 Ga0070680_100852527 3300005336 Bacteria 785
17 Ga0070682_100239078 3300005337 Bacteria 1303
18 Ga0070660_100152154 3300005339 Bacteria 1861
19 Ga0070660_100434026 3300005339 Archaea 1088
20 Ga0070660_101025405 3300005339 Unclassified 697
21 Ga0070687_100602478 3300005343 Bacteria 755
22 Ga0070661_100119712 3300005344 Bacteria 1971
23 Ga0070668_100022681 3300005347 Bacteria 4746
24 Ga0070668_101699929 3300005347 Bacteria 579
25 Ga0070669_100150844 3300005353 Bacteria 1799
26 Ga0070669_101127779 3300005353 Bacteria 676
27 Ga0070675_100060947 3300005354 Bacteria 3115
28 Ga0070675_102015931 3300005354 Bacteria 532
29 Ga0070671_101129850 3300005355 Bacteria 688
30 Ga0070674_100728408 3300005356 Bacteria 850
31 Ga0070659_100012140 3300005366 Bacteria 6381
32 Ga0070659_100128963 3300005366 Bacteria 2053
33 Ga0070659_101705312 3300005366 Bacteria 563
34 Ga0070667_100343147 3300005367 Bacteria 1351
35 Ga0070705_101794820 3300005440 Unclassified 520
36 Ga0070694_100075440 3300005444 Bacteria 2332
37 Ga0070663_100493491 3300005455 Bacteria 1016
38 Ga0070678_100052435 3300005456 Bacteria 2962
39 Ga0070678_100261210 3300005456 Bacteria 1456
40 Ga0070662_100062310 3300005457 Bacteria 2724
41 Ga0070662_100327945 3300005457 Bacteria 1250
42 Ga0070662_101100365 3300005457 Bacteria 682
43 Ga0068867_100064612 3300005459 Bacteria 2721
44 Ga0070679_100224276 3300005530 Bacteria 1840
45 Ga0068853_100144538 3300005539 Bacteria 2137
46 Ga0068853_101038997 3300005539 Bacteria 789
47 Ga0070695_100192169 3300005545 Bacteria 1454
48 Ga0070693_100523236 3300005547 Bacteria 845
49 Ga0068855_100088787 3300005563 Bacteria 3570
50 Ga0068855_100136595 3300005563 Bacteria 2797
51 Ga0070664_100140185 3300005564 Bacteria 2129
52 Ga0068857_100090476 3300005577 Bacteria 2739
53 Ga0068857_100257065 3300005577 Bacteria 1602
54 Ga0068857_100831847 3300005577 Bacteria 883
55 Ga0068854_100018183 3300005578 Bacteria 4715
56 Ga0068854_100350735 3300005578 Bacteria 1208
57 Ga0068854_100521076 3300005578 Bacteria 1004
58 Ga0068854_100737599 3300005578 Bacteria 853
59 Ga0068856_100431934 3300005614 Bacteria 1337
60 Ga0068852_100019017 3300005616 Bacteria 5426
61 Ga0068852_100020627 3300005616 Bacteria 5242
62 Ga0068852_100269502 3300005616 Bacteria 1638
63 Ga0068852_101532541 3300005616 Bacteria 689
64 Ga0068859_100009179 3300005617 Bacteria 9986
65 Ga0068859_100031175 3300005617 Bacteria 5352
66 Ga0068859_100705575 3300005617 Bacteria 1099
67 Ga0068863_100012722 3300005841 Bacteria 8115
68 Ga0068863_100093253 3300005841 Bacteria 2857
69 Ga0068858_101597659 3300005842 Bacteria 643
70 Ga0068860_100184436 3300005843 Bacteria 2017
71 Ga0081539_10026431 3300005985 Bacteria 3704
72 Ga0075366_10141369 3300006195 Bacteria 1455
73 Ga0068871_100077267 3300006358 Bacteria 2751
74 Ga0075428_100044812 3300006844 Bacteria 4861
75 Ga0075429_100178456 3300006880 Bacteria 1861
76 Ga0097620_100009179 3300006931 Bacteria 9986
77 Ga0097620_100031175 3300006931 Bacteria 5352
78 Ga0097620_100705601 3300006931 Bacteria 1099
79 Ga0105251_10430951 3300009011 Bacteria 609
80 Ga0105240_11116832 3300009093 Bacteria 838
81 Ga0111539_10043318 3300009094 Bacteria 5396
82 Ga0111539_10181116 3300009094 Bacteria 2461
83 Ga0105245_10003308 3300009098 Bacteria 14465
84 Ga0105242_12327692 3300009176 Bacteria 582
85 Ga0105242_13010322 3300009176 Bacteria 522
86 Ga0105248_10003010 3300009177 Bacteria 18703
87 Ga0105248_10099206 3300009177 Bacteria 3282
88 Ga0105248_10414879 3300009177 Unclassified 1516
89 Ga0105248_11110919 3300009177 Bacteria 894
90 Ga0105248_13450782 3300009177 Bacteria 502
91 Ga0105238_10607564 3300009551 Bacteria 1102
92 Ga0105249_10888924 3300009553 Bacteria 957
93 Ga0105246_11656562 3300011119 Unclassified 606
94 Ga0157373_10401680 3300013100 Bacteria 982
95 Ga0157373_10541064 3300013100 Bacteria 844
96 Ga0157373_11162986 3300013100 Bacteria 580
97 Ga0157371_10035748 3300013102 Bacteria 3559
98 Ga0157369_10002034 3300013105 Bacteria 24368
99 Ga0157374_10044361 3300013296 Bacteria 4110
100 Ga0163162_10407801 3300013306 Bacteria 1492
101 Ga0157372_11711423 3300013307 Bacteria 723
102 Ga0157375_10007359 3300013308 Bacteria 9639
103 Ga0157375_11873907 3300013308 Bacteria 712
104 Ga0163163_10013110 3300014325 Bacteria 7573
105 Ga0157380_10000102 3300014326 Bacteria 48047
106 Ga0213876_10024855 3300021384 Bacteria 3163
107 Ga0207656_10158659 3300025321 Bacteria 1075
108 Ga0207682_10290691 3300025893 Bacteria 765
109 Ga0207705_10197887 3300025909 Bacteria 1522
110 Ga0207684_10357103 3300025910 Bacteria 1258
111 Ga0207654_10135486 3300025911 Bacteria 1564
112 Ga0207707_10003841 3300025912 Bacteria 13310
113 Ga0207707_11048948 3300025912 Bacteria 667
114 Ga0207660_10001245 3300025917 Bacteria 17060
115 Ga0207660_10018450 3300025917 Bacteria 4651
116 Ga0207660_10515388 3300025917 Bacteria 971
117 Ga0207662_10597770 3300025918 Bacteria 767
118 Ga0207657_10204017 3300025919 Bacteria 1589
119 Ga0207657_10948815 3300025919 Unclassified 661
120 Ga0207649_10573972 3300025920 Bacteria 865
121 Ga0207652_10012311 3300025921 Bacteria 6911
122 Ga0207652_10826438 3300025921 Bacteria 821
123 Ga0207681_10969769 3300025923 Bacteria 713
124 Ga0207681_11667787 3300025923 Bacteria 533
125 Ga0207694_10863699 3300025924 Bacteria 765
126 Ga0207650_10066906 3300025925 Bacteria 2695
127 Ga0207650_10125093 3300025925 Bacteria 2006
128 Ga0207659_10044231 3300025926 Bacteria 3132
129 Ga0207644_10682566 3300025931 Bacteria 856
130 Ga0207690_10097947 3300025932 Bacteria 2088
131 Ga0207690_10208297 3300025932 Bacteria 1489
132 Ga0207690_10338834 3300025932 Bacteria 1186
133 Ga0207706_10003286 3300025933 Bacteria 15472
134 Ga0207706_10398940 3300025933 Bacteria 1192
135 Ga0207706_11049133 3300025933 Unclassified 683
136 Ga0207669_10470980 3300025937 Bacteria 999
137 Ga0207669_10586102 3300025937 Bacteria 904
138 Ga0207711_10001621 3300025941 Bacteria 20768
139 Ga0207711_10041006 3300025941 Bacteria 3940
140 Ga0207661_10487334 3300025944 Bacteria 1126
141 Ga0207679_10123416 3300025945 Bacteria 2066
142 Ga0207667_10181285 3300025949 Bacteria 2163
143 Ga0207667_10413062 3300025949 Bacteria 1373
144 Ga0207651_10417595 3300025960 Bacteria 1144
145 Ga0207651_11269980 3300025960 Bacteria 662
146 Ga0207712_10703338 3300025961 Bacteria 882
147 Ga0207668_10670799 3300025972 Bacteria 909
148 Ga0207640_10070301 3300025981 Bacteria 2353
149 Ga0207640_10078315 3300025981 Bacteria 2249
150 Ga0207640_10083006 3300025981 Bacteria 2196
151 Ga0207640_11450718 3300025981 Bacteria 616
152 Ga0207658_10009307 3300025986 Bacteria 6663
153 Ga0207703_10117159 3300026035 Bacteria 2281
154 Ga0207639_10085688 3300026041 Bacteria 2506
155 Ga0207678_10017331 3300026067 Bacteria 6323
156 Ga0207678_12020747 3300026067 Unclassified 501
157 Ga0207708_10088000 3300026075 Bacteria 2392
158 Ga0207641_10012445 3300026088 Bacteria 6975
159 Ga0207641_11405107 3300026088 Bacteria 699
160 Ga0207648_10327770 3300026089 Bacteria 1377
161 Ga0207676_11322497 3300026095 Unclassified 716
162 Ga0207674_10184729 3300026116 Bacteria 2036
163 Ga0207674_10271791 3300026116 Bacteria 1642
164 Ga0207675_100480371 3300026118 Bacteria 1235
165 Ga0207683_10072456 3300026121 Bacteria 3047
166 Ga0207683_10080879 3300026121 Bacteria 2883
167 Ga0207698_10024082 3300026142 Bacteria 4266
168 Ga0207698_10164452 3300026142 Bacteria 1945
169 Ga0207698_11101285 3300026142 Bacteria 807
170 Ga0207428_10597849 3300027907 Bacteria 795
171 Ga0268265_12483468 3300028380 Bacteria 524
172 Ga0268264_10064284 3300028381 Bacteria 3087
173 Ga0268264_11138232 3300028381 Bacteria 789
174 Ga0307513_10347936 3300031456 Bacteria 1231
175 Ga0307408_101363702 3300031548 Bacteria 666
176 Ga0307405_10050738 3300031731 Bacteria 2571
177 Ga0307405_10054134 3300031731 Bacteria 2503
178 Ga0307405_10147019 3300031731 Bacteria 1652
179 Ga0307413_10326370 3300031824 Bacteria 1174
180 Ga0307413_10606657 3300031824 Bacteria 897
181 Ga0307413_10694464 3300031824 Bacteria 844
182 Ga0307413_10829856 3300031824 Bacteria 779
183 Ga0307410_10112035 3300031852 Bacteria 1975
184 Ga0307410_10116094 3300031852 Bacteria 1944
185 Ga0307410_11038510 3300031852 Bacteria 708
186 Ga0307406_10123511 3300031901 Bacteria 1804
187 Ga0307406_11854495 3300031901 Bacteria 537
188 Ga0307407_10106973 3300031903 Bacteria 1748
189 Ga0307407_10260719 3300031903 Bacteria 1192
190 Ga0307407_10680493 3300031903 Bacteria 773
191 Ga0307407_10920680 3300031903 Bacteria 672
192 Ga0307407_11684508 3300031903 Bacteria 505
193 Ga0307412_10007199 3300031911 Bacteria 6314
194 Ga0307412_10461235 3300031911 Bacteria 1049
195 Ga0307412_10475703 3300031911 Bacteria 1035
196 Ga0307409_100272493 3300031995 Bacteria 1559
197 Ga0307409_100370249 3300031995 Bacteria 1358
198 Ga0307416_100518313 3300032002 Bacteria 1260
199 Ga0307416_102504044 3300032002 Bacteria 615
200 Ga0307416_103785075 3300032002 Bacteria 506
201 Ga0307414_11732830 3300032004 Bacteria 583
202 Ga0307411_10027279 3300032005 Bacteria 3452
203 Ga0307415_100725403 3300032126 Bacteria 900
204 Ga0373923_0254211 3300035111 Bacteria 823
205 Ga0373943_0001269 3300035170 Bacteria 11294
206 Ga0373946_0071436 3300035171 Bacteria 1500
207 Ga0373931_0443660 3300035691 Bacteria 829
208 Ga0373931_0532871 3300035691 Bacteria 761
209 Ga0373935_0112974 3300035692 Bacteria 1805
210 Ga0373927_0779665 3300035695 Bacteria 631
211 Ga0373947_0081560 3300035725 Bacteria 2003
212 Ga0373925_0177901 3300037068 Bacteria 1682
213 Ga0395899_0104134 3300037312 Bacteria 2045
214 Ga0395900_0272862 3300037418 Bacteria 1685
215 Ga0395900_0379295 3300037418 Bacteria 1382
216 Ga0395905_0902481 3300037471 Bacteria 786
217 Ga0395901_0714853 3300038443 Bacteria 998
218 Ga0395901_0932336 3300038443 Bacteria 848
219 Ga0395901_1308489 3300038443 Bacteria 686
220 Ga0451791_1777859 3300041451 Unclassified 520
221 Ga0451843_1773252 3300041509 Bacteria 674
222 Ga0439433_0078493 3300041999 Bacteria 801
223 Ga0439445_0031658 3300042004 Bacteria 1376
224 Ga0439432_050397 3300042006 Bacteria 1299
225 Ga0439449_0002830 3300042007 Bacteria 6747
226 Ga0439452_050984 3300042010 Bacteria 948
227 Ga0439462_0019724 3300042015 Bacteria 1756
228 Ga0450912_002008 3300042116 Bacteria 1322
229 Ga0450889_002186 3300042144 Bacteria 1964
230 Ga0466963_0032539 3300044694 Bacteria 3378
231 Ga0466963_0380768 3300044694 Bacteria 994
232 Ga0466967_0127788 3300045976 Bacteria 2356
233 Ga0466967_0266563 3300045976 Bacteria 1640
234 Ga0466967_0988995 3300045976 Bacteria 837
235 Ga0495621_0199638 3300046539 Bacteria 804
236 Ga0495669_0077908 3300046684 Bacteria 1518
237 Ga0496103_0352910 3300048906 Bacteria 946
238 Ga0496107_0085895 3300048910 Bacteria 2296
239 Ga0496111_0140567 3300048914 Bacteria 1789
240 Ga0496112_1043236 3300048915 Unclassified 737
241 Ga0496121_0000861 3300048924 Bacteria 54871
242 Ga0496126_0978776 3300048929 Bacteria 636
243 Ga0501032_0209677 3300049569 Bacteria 1270
244 Ga0501034_1479377 3300049571 Bacteria 553
245 Ga0501036_0783991 3300049572 Bacteria 785
246 Ga0501043_0031415 3300049579 Bacteria 4174
247 Ga0501046_0455830 3300049580 Bacteria 919
248 Ga0501047_0010264 3300049581 Bacteria 8859
249 Ga0501048_0858569 3300049582 Bacteria 652
250 Ga0501074_0676642 3300049590 Bacteria 729
251 Ga0501259_086713 3300049688 Bacteria 697
252 Ga0501035_0214108 3300049822 Bacteria 1648
253 Ga0501044_0002114 3300049823 Bacteria 22843
254 Ga0501044_0385916 3300049823 Bacteria 1315
255 nmdc:mga09592_786258_c1 3300050508 Bacteria 806
256 nmdc:mga0qj67_1023495_c1 3300050509 Bacteria 647
257 nmdc:mga08y16_586480_c1 3300050511 Bacteria 1125
258 nmdc:mga08y16_910739_c1 3300050511 Bacteria 865
259 2643729302 2643221541 Bacteria 5498788
260 2644045778 2643221606 Bacteria 5588032
261 2644393355 2643221671 Bacteria 5496681
262 2819553097 2818991438 Bacteria 5793701
263 Ga0466973_0225331
264 JGI24752J21851_1020371
265 JGI24740J21852_10011855
266 JGI24739J22299_10020276
267 JGI24739J22299_10182409
268 JGI24737J22298_10050955
269 JGI24735J21928_10009185
270 JGI24034J26672_10054459
271 rootL2_10052019
272 Ga0065707_10298575
273 Ga0070658_11119327
274 Ga0070676_10802558
275 Ga0070676_11070739
276 Ga0070683_100766177
277 Ga0070666_10254632
278 Ga0070680_100852527
279 Ga0070682_100239078
280 Ga0070660_100152154
281 Ga0070660_100434026
282 Ga0070660_101025405
283 Ga0070687_100602478
284 Ga0070661_100119712
285 Ga0070668_100022681
286 Ga0070668_101699929
287 Ga0070669_100150844
288 Ga0070669_101127779
289 Ga0070675_100060947
290 Ga0070675_102015931
291 Ga0070671_101129850
292 Ga0070674_100728408
293 Ga0070659_100012140
294 Ga0070659_100128963
295 Ga0070659_101705312
296 Ga0070667_100343147
297 Ga0070705_101794820
298 Ga0070694_100075440
299 Ga0070663_100493491
300 Ga0070678_100052435
301 Ga0070678_100261210
302 Ga0070662_100062310
303 Ga0070662_100327945
304 Ga0070662_101100365
305 Ga0068867_100064612
306 Ga0070679_100224276
307 Ga0068853_100144538
308 Ga0068853_101038997
309 Ga0070695_100192169
310 Ga0070693_100523236
311 Ga0068855_100088787
312 Ga0068855_100136595
313 Ga0070664_100140185
314 Ga0068857_100090476
315 Ga0068857_100257065
316 Ga0068857_100831847
317 Ga0068854_100018183
318 Ga0068854_100350735
319 Ga0068854_100521076
320 Ga0068854_100737599
321 Ga0068856_100431934
322 Ga0068852_100019017
323 Ga0068852_100020627
324 Ga0068852_100269502
325 Ga0068852_101532541
326 Ga0068859_100009179
327 Ga0068859_100031175
328 Ga0068859_100705575
329 Ga0068863_100012722
330 Ga0068863_100093253
331 Ga0068858_101597659
332 Ga0068860_100184436
333 Ga0081539_10026431
334 Ga0075366_10141369
335 Ga0068871_100077267
336 Ga0075428_100044812
337 Ga0075429_100178456
338 Ga0097620_100009179
339 Ga0097620_100031175
340 Ga0097620_100705601
341 Ga0105251_10430951
342 Ga0105240_11116832
343 Ga0111539_10043318
344 Ga0111539_10181116
345 Ga0105245_10003308
346 Ga0105242_12327692
347 Ga0105242_13010322
348 Ga0105248_10003010
349 Ga0105248_10099206
350 Ga0105248_10414879
351 Ga0105248_11110919
352 Ga0105248_13450782
353 Ga0105238_10607564
354 Ga0105249_10888924
355 Ga0105246_11656562
356 Ga0157373_10401680
357 Ga0157373_10541064
358 Ga0157373_11162986
359 Ga0157371_10035748
360 Ga0157369_10002034
361 Ga0157374_10044361
362 Ga0163162_10407801
363 Ga0157372_11711423
364 Ga0157375_10007359
365 Ga0157375_11873907
366 Ga0163163_10013110
367 Ga0157380_10000102
368 Ga0213876_10024855
369 Ga0207656_10158659
370 Ga0207682_10290691
371 Ga0207705_10197887
372 Ga0207684_10357103
373 Ga0207654_10135486
374 Ga0207707_10003841
375 Ga0207707_11048948
376 Ga0207660_10001245
377 Ga0207660_10018450
378 Ga0207660_10515388
379 Ga0207662_10597770
380 Ga0207657_10204017
381 Ga0207657_10948815
382 Ga0207649_10573972
383 Ga0207652_10012311
384 Ga0207652_10826438
385 Ga0207681_10969769
386 Ga0207681_11667787
387 Ga0207694_10863699
388 Ga0207650_10066906
389 Ga0207650_10125093
390 Ga0207659_10044231
391 Ga0207644_10682566
392 Ga0207690_10097947
393 Ga0207690_10208297
394 Ga0207690_10338834
395 Ga0207706_10003286
396 Ga0207706_10398940
397 Ga0207706_11049133
398 Ga0207669_10470980
399 Ga0207669_10586102
400 Ga0207711_10001621
401 Ga0207711_10041006
402 Ga0207661_10487334
403 Ga0207679_10123416
404 Ga0207667_10181285
405 Ga0207667_10413062
406 Ga0207651_10417595
407 Ga0207651_11269980
408 Ga0207712_10703338
409 Ga0207668_10670799
410 Ga0207640_10070301
411 Ga0207640_10078315
412 Ga0207640_10083006
413 Ga0207640_11450718
414 Ga0207658_10009307
415 Ga0207703_10117159
416 Ga0207639_10085688
417 Ga0207678_10017331
418 Ga0207678_12020747
419 Ga0207708_10088000
420 Ga0207641_10012445
421 Ga0207641_11405107
422 Ga0207648_10327770
423 Ga0207676_11322497
424 Ga0207674_10184729
425 Ga0207674_10271791
426 Ga0207675_100480371
427 Ga0207683_10072456
428 Ga0207683_10080879
429 Ga0207698_10024082
430 Ga0207698_10164452
431 Ga0207698_11101285
432 Ga0207428_10597849
433 Ga0268265_12483468
434 Ga0268264_10064284
435 Ga0268264_11138232
436 Ga0307513_10347936
437 Ga0307408_101363702
438 Ga0307405_10050738
439 Ga0307405_10054134
440 Ga0307405_10147019
441 Ga0307413_10326370
442 Ga0307413_10606657
443 Ga0307413_10694464
444 Ga0307413_10829856
445 Ga0307410_10112035
446 Ga0307410_10116094
447 Ga0307410_11038510
448 Ga0307406_10123511
449 Ga0307406_11854495
450 Ga0307407_10106973
451 Ga0307407_10260719
452 Ga0307407_10680493
453 Ga0307407_10920680
454 Ga0307407_11684508
455 Ga0307412_10007199
456 Ga0307412_10461235
457 Ga0307412_10475703
458 Ga0307409_100272493
459 Ga0307409_100370249
460 Ga0307416_100518313
461 Ga0307416_102504044
462 Ga0307416_103785075
463 Ga0307414_11732830
464 Ga0307411_10027279
465 Ga0307415_100725403
466 Ga0373923_0254211
467 Ga0373943_0001269
468 Ga0373946_0071436
469 Ga0373931_0443660
470 Ga0373931_0532871
471 Ga0373935_0112974
472 Ga0373927_0779665
473 Ga0373947_0081560
474 Ga0373925_0177901
475 Ga0395899_0104134
476 Ga0395900_0272862
477 Ga0395900_0379295
478 Ga0395905_0902481
479 Ga0395901_0714853
480 Ga0395901_0932336
481 Ga0395901_1308489
482 Ga0451791_1777859
483 Ga0451843_1773252
484 Ga0439433_0078493
485 Ga0439445_0031658
486 Ga0439432_050397
487 Ga0439449_0002830
488 Ga0439452_050984
489 Ga0439462_0019724
490 Ga0450912_002008
491 Ga0450889_002186
492 Ga0466963_0032539
493 Ga0466963_0380768
494 Ga0466967_0127788
495 Ga0466967_0266563
496 Ga0466967_0988995
497 Ga0495621_0199638
498 Ga0495669_0077908
499 Ga0496103_0352910
500 Ga0496107_0085895
501 Ga0496111_0140567
502 Ga0496112_1043236
503 Ga0496121_0000861
504 Ga0496126_0978776
505 Ga0501032_0209677
506 Ga0501034_1479377
507 Ga0501036_0783991
508 Ga0501043_0031415
509 Ga0501046_0455830
510 Ga0501047_0010264
511 Ga0501048_0858569
512 Ga0501074_0676642
513 Ga0501259_086713
514 Ga0501035_0214108
515 Ga0501044_0002114
516 Ga0501044_0385916
517 nmdc:mga09592_786258_c1
518 nmdc:mga0qj67_1023495_c1
519 nmdc:mga08y16_586480_c1
520 nmdc:mga08y16_910739_c1
521 2643729302
522 2644045778
523 2644393355
524 2819553097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

30

100

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8846 11 90
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.8753 7 89
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8741 7 89
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.8728 9 92
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8292 11 89
ID Description Score Start End Superfamily
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9216 7 89 3.30.300.90
af_Q3E793_13_109_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9185 10 91 3.30.300.90
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.905 9 91 3.10.20.90
3o2eA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8846 11 90 3.30.300.90
af_Q54G84_40_127_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8781 8 92 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A219B325-F1-model_v4 BolA family transcriptional regulator 0.9793 7 89 GO:0016226
AF-A0A7W6BEF5-F1-model_v4 BolA protein 0.9717 10 91 GO:0016226
AF-A0A495RVY8-F1-model_v4 deleted 0.97 9 92
AF-A0A397NKG3-F1-model_v4 BolA protein 0.9698 6 92 GO:0016226
AF-A0A848SD58-F1-model_v4 BolA family transcriptional regulator 0.9695 7 89 GO:0016226

Map