F371068

General Info

Members Datasets Scaffolds Average Seq Length
262 177 524 157

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_11058446|Ga0105249_110584461
Length 192
Sequence MTNDGMTNGSNHIVTTFEFVRFQIRHSIIRHSRIFLMGRITASRKQLKPDPKYGSLLAAKFINTLMHCGKKSVAQNVFYDALDIVKQRVPEKEPIEVFTQAVEHVKPSIEVRSKRVGGAAYQVPMQVNRTRQQSLAIRWILGAIREKKGRPTAQKLADEFVAAFNREGAAVSKRENVHRMADANKAFAHFAW

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
104 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
154 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.35
Metatranscriptomes 15.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0
Rhizoplane 3.82
Rhizosphere 87.4
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_11058446 3300009553 Bacteria 881
2 Ga0058859_11573063 3300004798 Bacteria 689
3 Ga0058863_11958412 3300004799 Bacteria 1103
4 Ga0058861_11916878 3300004800 Bacteria 1208
5 Ga0058862_12864198 3300004803 Bacteria 1019
6 Ga0065704_10074460 3300005289 Bacteria 6259
7 Ga0065712_10069128 3300005290 Bacteria 7959
8 Ga0065707_10083444 3300005295 Bacteria 9157
9 Ga0070689_100064004 3300005340 Bacteria 2862
10 Ga0070689_100707709 3300005340 Bacteria 880
11 Ga0070691_10496047 3300005341 Bacteria 705
12 Ga0070674_100524358 3300005356 Bacteria 990
13 Ga0070667_100322132 3300005367 Bacteria 1395
14 Ga0070714_100593658 3300005435 Bacteria 1063
15 Ga0070714_100725808 3300005435 Bacteria 960
16 Ga0070678_100835851 3300005456 Bacteria 838
17 Ga0070698_100214287 3300005471 Bacteria 1860
18 Ga0070699_100080209 3300005518 Bacteria 2844
19 Ga0070679_100447775 3300005530 Bacteria 1236
20 Ga0070686_100600615 3300005544 Bacteria 867
21 Ga0070665_100000611 3300005548 Bacteria 48974
22 Ga0068855_100100792 3300005563 Bacteria 3325
23 Ga0068854_101192714 3300005578 Bacteria 682
24 Ga0068852_100592686 3300005616 Bacteria 1112
25 Ga0068861_100797796 3300005719 Bacteria 886
26 Ga0068863_100457400 3300005841 Bacteria 1253
27 Ga0068863_101533731 3300005841 Bacteria 675
28 Ga0068858_101008315 3300005842 Bacteria 816
29 Ga0068858_101576916 3300005842 Bacteria 648
30 Ga0081455_10254354 3300005937 Bacteria 1283
31 Ga0075363_100051391 3300006048 Bacteria 2198
32 Ga0075363_100281262 3300006048 Bacteria 963
33 Ga0070716_100425837 3300006173 Bacteria 961
34 Ga0075431_100623093 3300006847 Bacteria 1061
35 Ga0075436_100680844 3300006914 Bacteria 761
36 Ga0105240_10176814 3300009093 Bacteria 2523
37 Ga0111539_11376737 3300009094 Bacteria 818
38 Ga0111539_11485644 3300009094 Bacteria 786
39 Ga0111539_11759116 3300009094 Bacteria 719
40 Ga0111539_12742616 3300009094 Bacteria 571
41 Ga0105245_11208806 3300009098 Bacteria 804
42 Ga0105245_11688873 3300009098 Bacteria 685
43 Ga0105247_10533856 3300009101 Bacteria 860
44 Ga0105243_10520418 3300009148 Bacteria 1131
45 Ga0105243_10667568 3300009148 Bacteria 1009
46 Ga0105248_10754378 3300009177 Bacteria 1098
47 Ga0105249_10051701 3300009553 Bacteria 3749
48 Ga0105249_12074401 3300009553 Bacteria 641
49 Ga0105239_10430678 3300010375 Bacteria 1495
50 Ga0105239_10888216 3300010375 Bacteria 1023
51 Ga0105239_11099432 3300010375 Bacteria 915
52 Ga0157370_10442017 3300013104 Bacteria 1196
53 Ga0157370_10535255 3300013104 Bacteria 1074
54 Ga0157369_10546853 3300013105 Bacteria 1197
55 Ga0157374_11088289 3300013296 Bacteria 820
56 Ga0163162_10407695 3300013306 Bacteria 1492
57 Ga0163162_11197771 3300013306 Bacteria 862
58 Ga0163162_11404678 3300013306 Bacteria 794
59 Ga0163162_12382942 3300013306 Bacteria 608
60 Ga0157375_11997492 3300013308 Bacteria 689
61 Ga0157379_10378392 3300014968 Bacteria 1299
62 Ga0206349_1389689 3300020075 Bacteria 833
63 Ga0206352_10966787 3300020078 Bacteria 1544
64 Ga0206353_10170493 3300020082 Bacteria 1218
65 Ga0213873_10016225 3300021358 Bacteria 1680
66 Ga0213872_10186063 3300021361 Bacteria 895
67 Ga0213871_10012691 3300021441 Bacteria 1964
68 Ga0224712_10117526 3300022467 Bacteria 1148
69 Ga0207697_10065053 3300025315 Bacteria 1521
70 Ga0207692_10141300 3300025898 Bacteria 1370
71 Ga0207710_10228240 3300025900 Bacteria 926
72 Ga0207695_10346479 3300025913 Bacteria 1373
73 Ga0207662_10338113 3300025918 Bacteria 1008
74 Ga0207652_10459159 3300025921 Bacteria 1148
75 Ga0207652_11150772 3300025921 Bacteria 677
76 Ga0207694_11097668 3300025924 Bacteria 673
77 Ga0207700_10732153 3300025928 Bacteria 883
78 Ga0207709_11392784 3300025935 Bacteria 581
79 Ga0207670_10233883 3300025936 Bacteria 1412
80 Ga0207669_10201279 3300025937 Bacteria 1446
81 Ga0207711_10690126 3300025941 Bacteria 952
82 Ga0207679_10550740 3300025945 Bacteria 1035
83 Ga0207667_10212947 3300025949 Bacteria 1980
84 Ga0207712_10053987 3300025961 Bacteria 2821
85 Ga0207712_11602164 3300025961 Bacteria 583
86 Ga0207640_10991338 3300025981 Bacteria 739
87 Ga0207658_10391821 3300025986 Bacteria 1219
88 Ga0207703_10440883 3300026035 Bacteria 1215
89 Ga0207703_11744876 3300026035 Bacteria 598
90 Ga0207678_11393804 3300026067 Bacteria 620
91 Ga0207648_10307515 3300026089 Bacteria 1422
92 Ga0207648_11530468 3300026089 Bacteria 627
93 Ga0207675_100948727 3300026118 Bacteria 878
94 Ga0207675_100948922 3300026118 Bacteria 877
95 Ga0207698_11206141 3300026142 Bacteria 771
96 Ga0268266_10001092 3300028379 Bacteria 34038
97 Ga0265338_10306872 3300028800 Bacteria 1152
98 Ga0265762_1056101 3300030760 Bacteria 800
99 Ga0265761_110637 3300030889 Bacteria 536
100 Ga0265760_10002697 3300031090 Bacteria 5192
101 Ga0265325_10006220 3300031241 Bacteria 7279
102 Ga0265340_10205182 3300031247 Bacteria 886
103 Ga0265339_10000153 3300031249 Bacteria 56918
104 Ga0265339_10040967 3300031249 Bacteria 2573
105 Ga0265331_10000651 3300031250 Bacteria 30088
106 Ga0265316_10943827 3300031344 Bacteria 602
107 Ga0265313_10000666 3300031595 Bacteria 35375
108 Ga0265313_10051496 3300031595 Bacteria 1970
109 Ga0265314_10000084 3300031711 Bacteria 143039
110 Ga0265314_10001650 3300031711 Bacteria 24431
111 Ga0265342_10008857 3300031712 Bacteria 7171
112 Ga0265342_10400565 3300031712 Bacteria 709
113 Ga0316576_10993901 3300031727 Bacteria 598
114 Ga0316577_10546097 3300031733 Bacteria 659
115 Ga0307406_11251623 3300031901 Bacteria 646
116 Ga0307412_10974792 3300031911 Bacteria 748
117 Ga0307416_101674290 3300032002 Bacteria 741
118 Ga0316592_1126221 3300033524 Bacteria 596
119 Ga0373928_0224714 3300035084 Unclassified 550
120 Ga0373937_0262407 3300036401 Bacteria 1629
121 Ga0373937_1891872 3300036401 Bacteria 543
122 Ga0316584_0350655 3300036712 Bacteria 1060
123 Ga0373925_0141095 3300037068 Bacteria 1886
124 Ga0395905_0361283 3300037471 Bacteria 1345
125 Ga0436364_0625778 3300037853 Bacteria 841
126 Ga0436364_0725442 3300037853 Bacteria 690
127 Ga0436364_0956053 3300037853 Bacteria 741
128 Ga0436365_0016232 3300039437 Bacteria 654
129 Ga0436365_1065536 3300039437 Bacteria 745
130 Ga0436365_1615471 3300039437 Bacteria 590
131 Ga0436365_1685773 3300039437 Bacteria 818
132 Ga0436360_0578417 3300039438 Bacteria 659
133 Ga0436360_0579003 3300039438 Bacteria 2207
134 Ga0436360_1256155 3300039438 Bacteria 1383
135 Ga0436361_0799960 3300039447 Bacteria 1718
136 Ga0436361_0871821 3300039447 Bacteria 2115
137 Ga0436363_0354567 3300039450 Bacteria 892
138 Ga0436363_1031435 3300039450 Bacteria 683
139 Ga0436362_0569561 3300039453 Bacteria 2165
140 Ga0436362_0966182 3300039453 Bacteria 598
141 Ga0451791_0256111 3300041451 Bacteria 621
142 Ga0451797_1374412 3300041453 Bacteria 885
143 Ga0451577_0000003 3300042876 Bacteria 921850
144 Ga0451577_0033938 3300042876 Bacteria 4601
145 Ga0451577_0207057 3300042876 Bacteria 1771
146 Ga0453683_0073900 3300044673 Bacteria 2134
147 Ga0466961_0632543 3300044693 Bacteria 643
148 Ga0453684_0000018 3300044712 Bacteria 921850
149 Ga0453684_0000042 3300044712 Bacteria 682980
150 Ga0453684_0043202 3300044712 Bacteria 6062
151 Ga0451576_0256042 3300045051 Bacteria 1829
152 Ga0466967_1383511 3300045976 Bacteria 701
153 Ga0495630_0339136 3300046517 Bacteria 1150
154 Ga0495632_0256776 3300046519 Bacteria 783
155 Ga0495674_0453163 3300047319 Bacteria 1031
156 Ga0495674_1056852 3300047319 Bacteria 620
157 Ga0495593_0247971 3300047673 Bacteria 892
158 Ga0495602_0171310 3300048088 Bacteria 1685
159 Ga0496103_0424208 3300048906 Bacteria 854
160 Ga0496104_0062659 3300048907 Bacteria 3526
161 Ga0496104_0119280 3300048907 Bacteria 2533
162 Ga0496105_1066447 3300048908 Bacteria 601
163 Ga0496110_1468063 3300048913 Bacteria 592
164 Ga0496113_0961558 3300048916 Bacteria 674
165 Ga0496114_0543796 3300048917 Bacteria 1026
166 Ga0496115_0012294 3300048918 Bacteria 6438
167 Ga0501317_050048 3300049533 Bacteria 661
168 Ga0501032_0223550 3300049569 Bacteria 1225
169 Ga0501032_0503808 3300049569 Bacteria 774
170 Ga0501033_0024510 3300049570 Bacteria 4551
171 Ga0501033_0271313 3300049570 Bacteria 1199
172 Ga0501034_0000289 3300049571 Bacteria 89918
173 Ga0501034_0007325 3300049571 Bacteria 11753
174 Ga0501034_0008841 3300049571 Bacteria 10593
175 Ga0501034_0010157 3300049571 Bacteria 9822
176 Ga0501034_0176571 3300049571 Bacteria 2102
177 Ga0501034_0212862 3300049571 Bacteria 1887
178 Ga0501034_0404184 3300049571 Bacteria 1288
179 Ga0501034_0679961 3300049571 Bacteria 929
180 Ga0501034_1453004 3300049571 Bacteria 560
181 Ga0501036_0088880 3300049572 Bacteria 2610
182 Ga0501036_0328553 3300049572 Bacteria 1278
183 Ga0501036_1018843 3300049572 Bacteria 677
184 Ga0501042_0746061 3300049578 Bacteria 712
185 Ga0501043_0071531 3300049579 Bacteria 2724
186 Ga0501043_0205351 3300049579 Bacteria 1528
187 Ga0501043_0832465 3300049579 Unclassified 666
188 Ga0501043_1109236 3300049579 Bacteria 559
189 Ga0501046_0004645 3300049580 Bacteria 12408
190 Ga0501046_0031834 3300049580 Bacteria 4272
191 Ga0501046_1013950 3300049580 Bacteria 576
192 Ga0501047_0007335 3300049581 Bacteria 10370
193 Ga0501047_0027662 3300049581 Bacteria 5463
194 Ga0501047_0243534 3300049581 Bacteria 1648
195 Ga0501047_0320536 3300049581 Bacteria 1390
196 Ga0501048_0204160 3300049582 Bacteria 1401
197 Ga0501070_0006443 3300049586 Bacteria 9994
198 Ga0501070_0195608 3300049586 Bacteria 1661
199 Ga0501070_0404416 3300049586 Bacteria 1104
200 Ga0501072_0806207 3300049588 Bacteria 735
201 Ga0501073_0123352 3300049589 Bacteria 1795
202 Ga0501076_0499299 3300049592 Bacteria 1003
203 Ga0501079_0886386 3300049741 Bacteria 703
204 Ga0501080_1336336 3300049742 Bacteria 613
205 Ga0501083_0055949 3300049744 Bacteria 2644
206 Ga0501083_0445534 3300049744 Bacteria 843
207 Ga0501035_0035605 3300049822 Bacteria 4517
208 Ga0501044_0341776 3300049823 Bacteria 1417
209 Ga0501044_0574598 3300049823 Bacteria 1022
210 Ga0501044_0693215 3300049823 Bacteria 904
211 Ga0501045_0064942 3300049824 Bacteria 2679
212 Ga0501045_1230917 3300049824 Bacteria 546
213 nmdc:mga03n38_31443_c1 3300050490 Bacteria 2240
214 nmdc:mga00v17_104178_c1 3300050491 Bacteria 1793
215 nmdc:mga00v17_466788_c1 3300050491 Bacteria 819
216 nmdc:mga0yw44_265367_c1 3300050492 Bacteria 1145
217 nmdc:mga06z11_149105_c1 3300050494 Bacteria 1328
218 nmdc:mga06z11_665396_c1 3300050494 Bacteria 634
219 nmdc:mga06r32_1537329_c1 3300050510 Bacteria 605
220 nmdc:mga08y16_984049_c1 3300050511 Bacteria 824
221 nmdc:mga08x19_816629_c1 3300050514 Bacteria 662
222 Ga0495601_0133968 3300053077 Bacteria 1615
223 Ga0495601_0494469 3300053077 Bacteria 790
224 Ga0495601_1021486 3300053077 Bacteria 519
225 Ga0495619_0139971 3300053085 Bacteria 1666
226 Ga0495619_0169777 3300053085 Bacteria 1508
227 Ga0500641_0234858 3300053096 Bacteria 773
228 Ga0500562_033897 3300053108 Bacteria 1350
229 Ga0500593_203659 3300053117 Bacteria 711
230 Ga0500658_0047326 3300053134 Bacteria 1745
231 Ga0500579_225406 3300053143 Bacteria 646
232 Ga0501084_1260509 3300054114 Bacteria 620
233 Ga0587084_059124 3300059477 Bacteria 698
234 Ga0587084_063437 3300059477 Bacteria 682
235 Ga0587077_019703 3300059493 Bacteria 1178
236 Ga0587077_109627 3300059493 Bacteria 674
237 Ga0587080_071438 3300059503 Bacteria 695
238 Ga0587082_097327 3300059504 Bacteria 636
239 Ga0587083_0133858 3300059505 Bacteria 653
240 Ga0587083_0191321 3300059505 Bacteria 579
241 Ga0587083_0249887 3300059505 Bacteria 528
242 Ga0587085_001634 3300059506 Bacteria 2125
243 Ga0587085_092290 3300059506 Bacteria 627
244 Ga0587090_013021 3300059510 Bacteria 1196
245 Ga0587091_092467 3300059511 Bacteria 697
246 Ga0587091_110311 3300059511 Bacteria 656
247 Ga0587106_053868 3300059605 Bacteria 721
248 Ga0587125_032227 3300059607 Bacteria 674
249 Ga0587099_033912 3300059622 Bacteria 631
250 Ga0587101_073681 3300059623 Bacteria 634
251 Ga0587109_074530 3300059624 Bacteria 740
252 Ga0587109_126507 3300059624 Bacteria 612
253 Ga0587115_071101 3300059626 Bacteria 601
254 Ga0587128_049645 3300059630 Bacteria 762
255 Ga0587062_015416 3300059639 Bacteria 1021
256 Ga0587067_019143 3300059640 Bacteria 1157
257 Ga0587067_158033 3300059640 Bacteria 574
258 Ga0587079_025902 3300059647 Bacteria 1092
259 Ga0587079_103241 3300059647 Bacteria 683
260 Ga0587071_065364 3300060344 Bacteria 781
261 Ga0530510_0430317 3300061734 Unclassified 997
262 Ga0530510_0827072 3300061734 Bacteria 707
263 Ga0105249_11058446
264 Ga0058859_11573063
265 Ga0058863_11958412
266 Ga0058861_11916878
267 Ga0058862_12864198
268 Ga0065704_10074460
269 Ga0065712_10069128
270 Ga0065707_10083444
271 Ga0070689_100064004
272 Ga0070689_100707709
273 Ga0070691_10496047
274 Ga0070674_100524358
275 Ga0070667_100322132
276 Ga0070714_100593658
277 Ga0070714_100725808
278 Ga0070678_100835851
279 Ga0070698_100214287
280 Ga0070699_100080209
281 Ga0070679_100447775
282 Ga0070686_100600615
283 Ga0070665_100000611
284 Ga0068855_100100792
285 Ga0068854_101192714
286 Ga0068852_100592686
287 Ga0068861_100797796
288 Ga0068863_100457400
289 Ga0068863_101533731
290 Ga0068858_101008315
291 Ga0068858_101576916
292 Ga0081455_10254354
293 Ga0075363_100051391
294 Ga0075363_100281262
295 Ga0070716_100425837
296 Ga0075431_100623093
297 Ga0075436_100680844
298 Ga0105240_10176814
299 Ga0111539_11376737
300 Ga0111539_11485644
301 Ga0111539_11759116
302 Ga0111539_12742616
303 Ga0105245_11208806
304 Ga0105245_11688873
305 Ga0105247_10533856
306 Ga0105243_10520418
307 Ga0105243_10667568
308 Ga0105248_10754378
309 Ga0105249_10051701
310 Ga0105249_12074401
311 Ga0105239_10430678
312 Ga0105239_10888216
313 Ga0105239_11099432
314 Ga0157370_10442017
315 Ga0157370_10535255
316 Ga0157369_10546853
317 Ga0157374_11088289
318 Ga0163162_10407695
319 Ga0163162_11197771
320 Ga0163162_11404678
321 Ga0163162_12382942
322 Ga0157375_11997492
323 Ga0157379_10378392
324 Ga0206349_1389689
325 Ga0206352_10966787
326 Ga0206353_10170493
327 Ga0213873_10016225
328 Ga0213872_10186063
329 Ga0213871_10012691
330 Ga0224712_10117526
331 Ga0207697_10065053
332 Ga0207692_10141300
333 Ga0207710_10228240
334 Ga0207695_10346479
335 Ga0207662_10338113
336 Ga0207652_10459159
337 Ga0207652_11150772
338 Ga0207694_11097668
339 Ga0207700_10732153
340 Ga0207709_11392784
341 Ga0207670_10233883
342 Ga0207669_10201279
343 Ga0207711_10690126
344 Ga0207679_10550740
345 Ga0207667_10212947
346 Ga0207712_10053987
347 Ga0207712_11602164
348 Ga0207640_10991338
349 Ga0207658_10391821
350 Ga0207703_10440883
351 Ga0207703_11744876
352 Ga0207678_11393804
353 Ga0207648_10307515
354 Ga0207648_11530468
355 Ga0207675_100948727
356 Ga0207675_100948922
357 Ga0207698_11206141
358 Ga0268266_10001092
359 Ga0265338_10306872
360 Ga0265762_1056101
361 Ga0265761_110637
362 Ga0265760_10002697
363 Ga0265325_10006220
364 Ga0265340_10205182
365 Ga0265339_10000153
366 Ga0265339_10040967
367 Ga0265331_10000651
368 Ga0265316_10943827
369 Ga0265313_10000666
370 Ga0265313_10051496
371 Ga0265314_10000084
372 Ga0265314_10001650
373 Ga0265342_10008857
374 Ga0265342_10400565
375 Ga0316576_10993901
376 Ga0316577_10546097
377 Ga0307406_11251623
378 Ga0307412_10974792
379 Ga0307416_101674290
380 Ga0316592_1126221
381 Ga0373928_0224714
382 Ga0373937_0262407
383 Ga0373937_1891872
384 Ga0316584_0350655
385 Ga0373925_0141095
386 Ga0395905_0361283
387 Ga0436364_0625778
388 Ga0436364_0725442
389 Ga0436364_0956053
390 Ga0436365_0016232
391 Ga0436365_1065536
392 Ga0436365_1615471
393 Ga0436365_1685773
394 Ga0436360_0578417
395 Ga0436360_0579003
396 Ga0436360_1256155
397 Ga0436361_0799960
398 Ga0436361_0871821
399 Ga0436363_0354567
400 Ga0436363_1031435
401 Ga0436362_0569561
402 Ga0436362_0966182
403 Ga0451791_0256111
404 Ga0451797_1374412
405 Ga0451577_0000003
406 Ga0451577_0033938
407 Ga0451577_0207057
408 Ga0453683_0073900
409 Ga0466961_0632543
410 Ga0453684_0000018
411 Ga0453684_0000042
412 Ga0453684_0043202
413 Ga0451576_0256042
414 Ga0466967_1383511
415 Ga0495630_0339136
416 Ga0495632_0256776
417 Ga0495674_0453163
418 Ga0495674_1056852
419 Ga0495593_0247971
420 Ga0495602_0171310
421 Ga0496103_0424208
422 Ga0496104_0062659
423 Ga0496104_0119280
424 Ga0496105_1066447
425 Ga0496110_1468063
426 Ga0496113_0961558
427 Ga0496114_0543796
428 Ga0496115_0012294
429 Ga0501317_050048
430 Ga0501032_0223550
431 Ga0501032_0503808
432 Ga0501033_0024510
433 Ga0501033_0271313
434 Ga0501034_0000289
435 Ga0501034_0007325
436 Ga0501034_0008841
437 Ga0501034_0010157
438 Ga0501034_0176571
439 Ga0501034_0212862
440 Ga0501034_0404184
441 Ga0501034_0679961
442 Ga0501034_1453004
443 Ga0501036_0088880
444 Ga0501036_0328553
445 Ga0501036_1018843
446 Ga0501042_0746061
447 Ga0501043_0071531
448 Ga0501043_0205351
449 Ga0501043_0832465
450 Ga0501043_1109236
451 Ga0501046_0004645
452 Ga0501046_0031834
453 Ga0501046_1013950
454 Ga0501047_0007335
455 Ga0501047_0027662
456 Ga0501047_0243534
457 Ga0501047_0320536
458 Ga0501048_0204160
459 Ga0501070_0006443
460 Ga0501070_0195608
461 Ga0501070_0404416
462 Ga0501072_0806207
463 Ga0501073_0123352
464 Ga0501076_0499299
465 Ga0501079_0886386
466 Ga0501080_1336336
467 Ga0501083_0055949
468 Ga0501083_0445534
469 Ga0501035_0035605
470 Ga0501044_0341776
471 Ga0501044_0574598
472 Ga0501044_0693215
473 Ga0501045_0064942
474 Ga0501045_1230917
475 nmdc:mga03n38_31443_c1
476 nmdc:mga00v17_104178_c1
477 nmdc:mga00v17_466788_c1
478 nmdc:mga0yw44_265367_c1
479 nmdc:mga06z11_149105_c1
480 nmdc:mga06z11_665396_c1
481 nmdc:mga06r32_1537329_c1
482 nmdc:mga08y16_984049_c1
483 nmdc:mga08x19_816629_c1
484 Ga0495601_0133968
485 Ga0495601_0494469
486 Ga0495601_1021486
487 Ga0495619_0139971
488 Ga0495619_0169777
489 Ga0500641_0234858
490 Ga0500562_033897
491 Ga0500593_203659
492 Ga0500658_0047326
493 Ga0500579_225406
494 Ga0501084_1260509
495 Ga0587084_059124
496 Ga0587084_063437
497 Ga0587077_019703
498 Ga0587077_109627
499 Ga0587080_071438
500 Ga0587082_097327
501 Ga0587083_0133858
502 Ga0587083_0191321
503 Ga0587083_0249887
504 Ga0587085_001634
505 Ga0587085_092290
506 Ga0587090_013021
507 Ga0587091_092467
508 Ga0587091_110311
509 Ga0587106_053868
510 Ga0587125_032227
511 Ga0587099_033912
512 Ga0587101_073681
513 Ga0587109_074530
514 Ga0587109_126507
515 Ga0587115_071101
516 Ga0587128_049645
517 Ga0587062_015416
518 Ga0587067_019143
519 Ga0587067_158033
520 Ga0587079_025902
521 Ga0587079_103241
522 Ga0587071_065364
523 Ga0530510_0430317
524 Ga0530510_0827072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

37

185

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.971 12 152
7p7u-assembly1.cif.gz_h e. faecalis 70s ribosome with p-trna, state iv 0.969 12 153
7nhm-assembly1.cif.gz_h 70s ribosome from staphylococcus aureus 0.9663 12 152
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9625 12 152
8cdu-assembly1.cif.gz_H rnase r bound to a 30s degradation intermediate (main state) 0.959 10 152
ID Description Score Start End Superfamily
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9608 10 156 1.10.455.10
4qcoG00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9496 11 156 1.10.455.10
5mmjg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9408 5 154 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9276 12 148 1.10.455.10
5x8rg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9266 5 152 1.10.455.10
ID Description Score Start End GO Terms
AF-A0A6N6S4C9-F1-model_v4 Ribosomal protein S7 0.9863 11 135 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A4P5Y9S3-F1-model_v4 Small ribosomal subunit protein uS7 0.9828 7 154 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A3M1MHX5-F1-model_v4 30S ribosomal protein S7 0.98 42 156 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-M5RNF6-F1-model_v4 Small ribosomal subunit protein uS7 0.9788 21 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A356KX02-F1-model_v4 Small ribosomal subunit protein uS7 0.9783 11 156 GO:0000049
GO:0003735
GO:0006412
GO:0015935
GO:0019843

Map