F371063

General Info

Members Datasets Scaffolds Average Seq Length
262 214 256 85

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11582928|Ga0105238_115829282
Length 97
Sequence MTDATPAPTLPELPDRLSVDPRSPHHVAAIFEHDVGIRFNGKERFDVEEYCISEGWVRVPVGKTVDRKGRPLTVKIKGTVEAFIKPAPAAAPDAPAA

Samples

Sample ID Description Type Environment
1 2643221570 Acidovorax sp. Root568 Isolate Unclassified
2 2643221596 Acidovorax sp. Root70 Isolate Unclassified
3 2721755523 Delftia sp. HK171 Isolate Unclassified
4 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
5 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
6 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
102 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
121 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
124 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
125 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
126 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
127 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
128 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
129 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
130 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
131 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
134 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
179 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
186 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
187 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
188 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
189 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
192 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
198 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
199 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
200 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0.38
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.07
Nodule 0.76
Rhizoplane 3.82
Rhizosphere 73.66
Stem 0
Stem Tuber 0
Unclassified 10.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1033211 3300002705 Bacteria 756
2 rootH1_10024276 3300003316 Bacteria 5061
3 rootL2_10000805 3300003322 Bacteria 46183
4 rootL2_10095519 3300003322 Bacteria 1509
5 Ga0055539_1039396 3300003752 Bacteria 512
6 Ga0055540_1011028 3300003792 Bacteria 2952
7 Ga0065704_10199779 3300005289 Bacteria 1152
8 Ga0070658_10133414 3300005327 Bacteria 2070
9 Ga0070658_10222843 3300005327 Bacteria 1595
10 Ga0070658_10394344 3300005327 Bacteria 1188
11 Ga0070658_10558693 3300005327 Bacteria 991
12 Ga0070658_11576170 3300005327 Bacteria 569
13 Ga0070670_100390472 3300005331 Bacteria 1227
14 Ga0068868_101120457 3300005338 Bacteria 725
15 Ga0070661_100322390 3300005344 Bacteria 1207
16 Ga0070668_100111187 3300005347 Bacteria 2180
17 Ga0070673_100572130 3300005364 Bacteria 1028
18 Ga0070659_100045751 3300005366 Bacteria 3429
19 Ga0070659_101944825 3300005366 Bacteria 528
20 Ga0070662_100019328 3300005457 Bacteria 4623
21 Ga0070707_100266287 3300005468 Bacteria 1667
22 Ga0070698_100395055 3300005471 Bacteria 1316
23 Ga0068853_100872111 3300005539 Bacteria 864
24 Ga0070672_101363426 3300005543 Bacteria 634
25 Ga0068855_100838893 3300005563 Bacteria 975
26 Ga0068852_100258907 3300005616 Bacteria 1670
27 Ga0068852_100516282 3300005616 Bacteria 1192
28 Ga0068863_102464124 3300005841 Bacteria 530
29 Ga0068862_100029284 3300005844 Bacteria 4639
30 Ga0068862_101184489 3300005844 Bacteria 762
31 Ga0075432_10225188 3300006058 Bacteria 752
32 Ga0075362_10652472 3300006177 Bacteria 547
33 Ga0075367_10202587 3300006178 Bacteria 1240
34 Ga0075369_10363056 3300006186 Bacteria 680
35 Ga0075366_10000823 3300006195 Bacteria 14890
36 Ga0075366_10109224 3300006195 Bacteria 1663
37 Ga0075366_10758992 3300006195 Bacteria 603
38 Ga0075370_10013265 3300006353 Bacteria 4375
39 Ga0079104_1000027 3300006946 Bacteria 212641
40 Ga0105244_10014299 3300009036 Bacteria 4596
41 Ga0105240_10695005 3300009093 Bacteria 1111
42 Ga0105245_10773065 3300009098 Bacteria 997
43 Ga0105245_11016831 3300009098 Bacteria 874
44 Ga0105247_10445494 3300009101 Bacteria 932
45 Ga0114129_10405854 3300009147 Bacteria 1795
46 Ga0114129_12803170 3300009147 Bacteria 579
47 Ga0105243_10005245 3300009148 Bacteria 10141
48 Ga0105243_10405899 3300009148 Bacteria 1267
49 Ga0105242_10649815 3300009176 Bacteria 1025
50 Ga0105248_10005382 3300009177 Bacteria 14071
51 Ga0105238_11582928 3300009551 Bacteria 685
52 Ga0105239_12859902 3300010375 Bacteria 563
53 Ga0157374_10513725 3300013296 Bacteria 1203
54 Ga0182008_10001246 3300014497 Bacteria 17468
55 Ga0182008_10464691 3300014497 Bacteria 690
56 Ga0182007_10148995 3300015262 Bacteria 795
57 Ga0209563_109255 3300025230 Bacteria 1500
58 Ga0207425_1073535 3300025245 Bacteria 581
59 Ga0209026_1018860 3300025250 Bacteria 1087
60 Ga0209677_101083 3300025253 Bacteria 12826
61 Ga0209759_1012099 3300025256 Bacteria 2409
62 Ga0209759_1039458 3300025256 Bacteria 829
63 Ga0209129_1002208 3300025258 Bacteria 9781
64 Ga0209565_1040608 3300025263 Bacteria 868
65 Ga0209455_1000044 3300025272 Bacteria 410787
66 Ga0209673_1049421 3300025273 Bacteria 1125
67 Ga0209025_1000406 3300025294 Bacteria 87410
68 Ga0209564_1000007 3300025295 Bacteria 1028582
69 Ga0209051_1000159 3300025303 Bacteria 126836
70 Ga0207697_10388430 3300025315 Bacteria 620
71 Ga0207696_1014392 3300025711 Bacteria 2716
72 Ga0207655_1016054 3300025728 Bacteria 4121
73 Ga0207642_10957418 3300025899 Bacteria 550
74 Ga0207705_10116595 3300025909 Bacteria 1977
75 Ga0207705_10511105 3300025909 Bacteria 933
76 Ga0207705_11332541 3300025909 Bacteria 547
77 Ga0207695_10654556 3300025913 Bacteria 931
78 Ga0207657_10163321 3300025919 Bacteria 1808
79 Ga0207649_10265107 3300025920 Bacteria 1243
80 Ga0207646_10308172 3300025922 Bacteria 1431
81 Ga0207644_10066172 3300025931 Bacteria 2630
82 Ga0207644_10098305 3300025931 Bacteria 2194
83 Ga0207690_10003472 3300025932 Bacteria 9400
84 Ga0207706_10000266 3300025933 Bacteria 56883
85 Ga0207709_10000055 3300025935 Bacteria 222373
86 Ga0207709_10069681 3300025935 Bacteria 2227
87 Ga0207709_10391950 3300025935 Bacteria 1059
88 Ga0207709_10714229 3300025935 Bacteria 803
89 Ga0207691_11232442 3300025940 Bacteria 619
90 Ga0207711_10126328 3300025941 Bacteria 2288
91 Ga0207667_10930627 3300025949 Bacteria 860
92 Ga0207651_10658888 3300025960 Bacteria 919
93 Ga0207668_10010190 3300025972 Bacteria 5671
94 Ga0207658_10220963 3300025986 Bacteria 1594
95 Ga0207677_11774999 3300026023 Bacteria 572
96 Ga0207702_12322290 3300026078 Bacteria 524
97 Ga0207641_10350831 3300026088 Bacteria 1406
98 Ga0207648_10147318 3300026089 Bacteria 2077
99 Ga0207698_10211126 3300026142 Bacteria 1747
100 Ga0209281_1000002 3300027111 Bacteria 1924012
101 Ga0209973_1010335 3300027252 Bacteria 1102
102 Ga0209998_10041789 3300027717 Bacteria 1042
103 Ga0209974_10004332 3300027876 Bacteria 5047
104 Ga0268266_10008545 3300028379 Bacteria 9100
105 Ga0268266_10091342 3300028379 Bacteria 2670
106 Ga0268265_10089398 3300028380 Bacteria 2456
107 Ga0307515_10004822 3300028794 Bacteria 27609
108 Ga0307515_10042701 3300028794 Bacteria 7082
109 Ga0307511_10069833 3300030521 Bacteria 2578
110 Ga0316182_1410755 3300030745 Bacteria 865
111 Ga0265327_10007407 3300031251 Bacteria 8485
112 Ga0307408_100000012 3300031548 Bacteria 408153
113 Ga0307516_10492097 3300031730 Bacteria 881
114 Ga0307405_11530781 3300031731 Bacteria 587
115 Ga0307406_10255420 3300031901 Bacteria 1323
116 Ga0307406_10331375 3300031901 Bacteria 1182
117 Ga0307414_10186651 3300032004 Bacteria 1673
118 Ga0307411_10000459 3300032005 Bacteria 14063
119 Ga0373948_0006800 3300034817 Bacteria 1904
120 Ga0373958_0142580 3300034819 Bacteria 594
121 Ga0373940_0000397 3300035088 Bacteria 6587
122 Ga0373923_0104894 3300035111 Bacteria 1250
123 Ga0373939_0000015 3300035114 Bacteria 64012
124 Ga0373943_0338729 3300035170 Bacteria 860
125 Ga0373962_0008387 3300035242 Bacteria 2541
126 Ga0373931_0001009 3300035691 Bacteria 11912
127 Ga0395900_0748027 3300037418 Bacteria 908
128 Ga0395898_0170576 3300037466 Bacteria 2080
129 Ga0395905_0402657 3300037471 Bacteria 1263
130 Ga0395905_0799011 3300037471 Bacteria 846
131 Ga0395901_0829841 3300038443 Bacteria 911
132 Ga0439461_0026044 3300041410 Bacteria 1191
133 Ga0451789_0400955 3300041443 Bacteria 1224
134 Ga0451793_0660416 3300041452 Bacteria 868
135 Ga0451833_0389737 3300041491 Bacteria 735
136 Ga0451841_0264550 3300041498 Bacteria 505
137 Ga0451841_1185214 3300041498 Bacteria 525
138 Ga0451855_1438135 3300041511 Bacteria 523
139 Ga0451853_2282875 3300041512 Bacteria 852
140 Ga0439437_001128 3300042000 Bacteria 2805
141 Ga0439437_028283 3300042000 Bacteria 698
142 Ga0439432_037593 3300042006 Bacteria 1544
143 Ga0439449_0007697 3300042007 Bacteria 4090
144 Ga0450912_000751 3300042116 Bacteria 1751
145 Ga0450914_006457 3300042118 Bacteria 1029
146 Ga0450917_000605 3300042120 Bacteria 2665
147 Ga0450888_000353 3300042126 Bacteria 4334
148 Ga0450890_000198 3300042127 Bacteria 9137
149 Ga0450891_000019 3300042129 Bacteria 11594
150 Ga0450892_000103 3300042130 Bacteria 9443
151 Ga0450902_016298 3300042137 Bacteria 1210
152 Ga0450889_000179 3300042144 Bacteria 6834
153 Ga0439464_0230124 3300042439 Bacteria 596
154 Ga0450916_042669 3300042530 Bacteria 694
155 Ga0450893_0015397 3300042532 Bacteria 1288
156 Ga0451577_0003093 3300042876 Bacteria 18788
157 Ga0451577_1099730 3300042876 Bacteria 711
158 Ga0466972_0006924 3300044658 Bacteria 5685
159 Ga0466966_0475548 3300044684 Bacteria 751
160 Ga0466963_0948758 3300044694 Bacteria 606
161 Ga0466964_0027080 3300044706 Bacteria 2248
162 Ga0453684_0017616 3300044712 Bacteria 11046
163 Ga0453684_0315649 3300044712 Bacteria 1772
164 Ga0466968_0047563 3300044735 Bacteria 1824
165 Ga0451576_0300776 3300045051 Bacteria 1678
166 Ga0451576_1253945 3300045051 Bacteria 773
167 Ga0495638_0127674 3300046460 Bacteria 1497
168 Ga0495650_0000042 3300046471 Bacteria 357244
169 Ga0495650_0000575 3300046471 Bacteria 51319
170 Ga0495605_0000022 3300046474 Bacteria 248321
171 Ga0495585_0636115 3300046492 Bacteria 500
172 Ga0495583_0000164 3300046506 Bacteria 112062
173 Ga0495606_0000014 3300046507 Bacteria 289347
174 Ga0495606_0001489 3300046507 Bacteria 31133
175 Ga0495610_0000753 3300046512 Bacteria 30595
176 Ga0495618_0566616 3300046514 Bacteria 679
177 Ga0495631_0071719 3300046518 Bacteria 1496
178 Ga0495637_0088305 3300046520 Bacteria 1226
179 Ga0495643_0230671 3300046522 Bacteria 873
180 Ga0495642_0210844 3300046528 Bacteria 847
181 Ga0495654_0000826 3300046530 Bacteria 23505
182 Ga0495597_0001265 3300046542 Bacteria 18633
183 Ga0495633_0163197 3300046558 Bacteria 1028
184 Ga0495668_0000088 3300046616 Bacteria 151503
185 Ga0495668_0001807 3300046616 Bacteria 19486
186 Ga0495668_0142562 3300046616 Bacteria 1311
187 Ga0495668_0210118 3300046616 Bacteria 1065
188 Ga0495625_0007611 3300046660 Bacteria 9405
189 Ga0495625_0622812 3300046660 Bacteria 645
190 Ga0495661_0107114 3300046665 Bacteria 1563
191 Ga0495669_0023522 3300046684 Bacteria 2683
192 Ga0495649_0000513 3300046694 Bacteria 33154
193 Ga0495649_0501368 3300046694 Bacteria 604
194 Ga0495676_0241897 3300047321 Bacteria 1235
195 Ga0495683_0038854 3300047323 Bacteria 2408
196 Ga0495683_0048396 3300047323 Bacteria 2132
197 Ga0495686_0027307 3300047472 Bacteria 3728
198 Ga0495686_0050063 3300047472 Bacteria 2626
199 Ga0495602_0781221 3300048088 Bacteria 643
200 Ga0496100_1148992 3300048903 Bacteria 612
201 Ga0496100_1300506 3300048903 Bacteria 574
202 Ga0496105_0129038 3300048908 Bacteria 2085
203 Ga0496108_0076076 3300048911 Bacteria 2837
204 Ga0496109_0397455 3300048912 Bacteria 1302
205 Ga0496113_0085676 3300048916 Bacteria 2420
206 Ga0496114_0373493 3300048917 Bacteria 1262
207 Ga0496115_0112101 3300048918 Bacteria 2241
208 Ga0496121_0003860 3300048924 Bacteria 20840
209 Ga0496124_0150657 3300048927 Bacteria 1825
210 Ga0496124_0358275 3300048927 Bacteria 1029
211 Ga0496125_0003484 3300048928 Bacteria 19026
212 Ga0496125_0003539 3300048928 Bacteria 18831
213 Ga0496125_0060354 3300048928 Bacteria 3049
214 Ga0496125_0337275 3300048928 Bacteria 906
215 Ga0496126_0120248 3300048929 Bacteria 2279
216 Ga0496126_0296358 3300048929 Bacteria 1336
217 Ga0501300_006336 3300049523 Bacteria 1742
218 Ga0501314_048498 3300049530 Bacteria 509
219 Ga0501046_0088450 3300049580 Bacteria 2385
220 Ga0501047_0010106 3300049581 Bacteria 8920
221 Ga0501073_0017431 3300049589 Bacteria 5203
222 Ga0501074_0298731 3300049590 Bacteria 1144
223 Ga0501202_055687 3300049652 Bacteria 884
224 Ga0501211_002699 3300049658 Bacteria 1864
225 Ga0501222_000852 3300049662 Bacteria 4405
226 Ga0501227_061105 3300049665 Bacteria 966
227 Ga0501235_189734 3300049669 Bacteria 552
228 Ga0501236_014664 3300049670 Bacteria 1089
229 Ga0501249_060492 3300049679 Bacteria 877
230 Ga0501253_024348 3300049683 Bacteria 1097
231 Ga0501258_009667 3300049687 Bacteria 1011
232 Ga0501258_025608 3300049687 Bacteria 718
233 Ga0501225_0064738 3300049705 Bacteria 1032
234 Ga0501229_001356 3300049706 Bacteria 2857
235 Ga0501080_0034227 3300049742 Bacteria 4741
236 Ga0501083_0402389 3300049744 Bacteria 891
237 Ga0501262_060688 3300049759 Bacteria 602
238 Ga0501263_050149 3300049760 Bacteria 633
239 Ga0501267_000582 3300049764 Bacteria 2891
240 Ga0501272_010217 3300049769 Bacteria 1046
241 Ga0501035_0081444 3300049822 Bacteria 2857
242 Ga0501035_0270816 3300049822 Bacteria 1437
243 Ga0501044_0081085 3300049823 Bacteria 3285
244 Ga0501226_025823 3300049853 Bacteria 659
245 nmdc:mga03n38_178838_c1 3300050490 Bacteria 1085
246 nmdc:mga0k408_14990_c1 3300050493 Bacteria 4282
247 nmdc:mga0k408_515752_c1 3300050493 Bacteria 708
248 nmdc:mga07m45_10141_c1 3300050496 Bacteria 4912
249 nmdc:mga05p37_453766_c1 3300050507 Bacteria 1483
250 nmdc:mga0a205_506190_c1 3300050515 Bacteria 1064
251 nmdc:mga0sz30_469297_c1 3300050516 Bacteria 565
252 Ga0500610_0028911 3300053079 Bacteria 2796
253 Ga0500643_125827 3300053087 Bacteria 690
254 Ga0500646_0327598 3300053090 Bacteria 554
255 Ga0500651_0235160 3300053093 Bacteria 1070
256 Ga0500636_0009146 3300053177 Bacteria 5757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0327598 Ga0500646_0327598_159_434 77
2 iso_pu_bacteria 2721755523 2722886054 78
3 iso_pu_bacteria 2839138175 2839144726 78
4 3300005366 Ga0070659_101944825 Ga0070659_1019448251 79
5 iso_pu_bacteria 2881101125 2881104538 79
6 3300006195 Ga0075366_10758992 Ga0075366_107589922 80
7 3300045051 Ga0451576_1253945 Ga0451576_1253945_332_574 80
8 3300025245 Ga0207425_1073535 Ga0207425_10735352 81
9 3300025273 Ga0209673_1049421 Ga0209673_10494212 81
10 3300037471 Ga0395905_0402657 Ga0395905_0402657_133_381 81
11 3300041512 Ga0451853_2282875 Ga0451853_2282875_385_630 81
12 3300044694 Ga0466963_0948758 Ga0466963_0948758_335_583 81
13 3300044712 Ga0453684_0017616 Ga0453684_0017616_7835_8110 81
14 3300045051 Ga0451576_0300776 Ga0451576_0300776_341_616 81
15 3300046514 Ga0495618_0566616 Ga0495618_0566616_266_559 81
16 3300046518 Ga0495631_0071719 Ga0495631_0071719_239_484 81
17 3300046616 Ga0495668_0210118 Ga0495668_0210118_577_822 81
18 3300046665 Ga0495661_0107114 Ga0495661_0107114_1253_1498 81
19 3300047321 Ga0495676_0241897 Ga0495676_0241897_634_879 81
20 3300003316 rootH1_10024276 rootH1_100242765 82
21 3300003322 rootL2_10000805 rootL2_1000080510 82
22 3300003322 rootL2_10095519 rootL2_100955192 82
23 3300003792 Ga0055540_1011028 Ga0055540_10110282 82
24 3300005289 Ga0065704_10199779 Ga0065704_101997792 82
25 3300005327 Ga0070658_11576170 Ga0070658_115761702 82
26 3300005331 Ga0070670_100390472 Ga0070670_1003904723 82
27 3300005338 Ga0068868_101120457 Ga0068868_1011204571 82
28 3300005344 Ga0070661_100322390 Ga0070661_1003223903 82
29 3300005347 Ga0070668_100111187 Ga0070668_1001111873 82
30 3300005457 Ga0070662_100019328 Ga0070662_1000193282 82
31 3300005468 Ga0070707_100266287 Ga0070707_1002662871 82
32 3300005471 Ga0070698_100395055 Ga0070698_1003950552 82
33 3300005539 Ga0068853_100872111 Ga0068853_1008721112 82
34 3300005616 Ga0068852_100258907 Ga0068852_1002589072 82
35 3300005844 Ga0068862_100029284 Ga0068862_1000292847 82
36 3300006058 Ga0075432_10225188 Ga0075432_102251882 82
37 3300006177 Ga0075362_10652472 Ga0075362_106524722 82
38 3300006178 Ga0075367_10202587 Ga0075367_102025873 82
39 3300006186 Ga0075369_10363056 Ga0075369_103630561 82
40 3300006195 Ga0075366_10000823 Ga0075366_100008236 82
41 3300006195 Ga0075366_10109224 Ga0075366_101092242 82
42 3300006353 Ga0075370_10013265 Ga0075370_100132654 82
43 3300006946 Ga0079104_1000027 Ga0079104_100002736 82
44 3300009036 Ga0105244_10014299 Ga0105244_100142995 82
45 3300009098 Ga0105245_10773065 Ga0105245_107730651 82
46 3300009147 Ga0114129_10405854 Ga0114129_104058543 82
47 3300009147 Ga0114129_12803170 Ga0114129_128031701 82
48 3300009148 Ga0105243_10005245 Ga0105243_100052459 82
49 3300014497 Ga0182008_10001246 Ga0182008_1000124617 82
50 3300014497 Ga0182008_10464691 Ga0182008_104646912 82
51 3300015262 Ga0182007_10148995 Ga0182007_101489952 82
52 3300025258 Ga0209129_1002208 Ga0209129_10022088 82
53 3300025263 Ga0209565_1040608 Ga0209565_10406082 82
54 3300025272 Ga0209455_1000044 Ga0209455_1000044214 82
55 3300025294 Ga0209025_1000406 Ga0209025_100040667 82
56 3300025295 Ga0209564_1000007 Ga0209564_1000007711 82
57 3300025303 Ga0209051_1000159 Ga0209051_100015985 82
58 3300025315 Ga0207697_10388430 Ga0207697_103884303 82
59 3300025711 Ga0207696_1014392 Ga0207696_10143922 82
60 3300025728 Ga0207655_1016054 Ga0207655_10160542 82
61 3300025899 Ga0207642_10957418 Ga0207642_109574182 82
62 3300025909 Ga0207705_11332541 Ga0207705_113325412 82
63 3300025920 Ga0207649_10265107 Ga0207649_102651072 82
64 3300025922 Ga0207646_10308172 Ga0207646_103081721 82
65 3300025931 Ga0207644_10098305 Ga0207644_100983051 82
66 3300025933 Ga0207706_10000266 Ga0207706_1000026633 82
67 3300025935 Ga0207709_10000055 Ga0207709_1000005536 82
68 3300025935 Ga0207709_10069681 Ga0207709_100696813 82
69 3300025935 Ga0207709_10714229 Ga0207709_107142292 82
70 3300025940 Ga0207691_11232442 Ga0207691_112324421 82
71 3300025972 Ga0207668_10010190 Ga0207668_100101908 82
72 3300025986 Ga0207658_10220963 Ga0207658_102209633 82
73 3300026023 Ga0207677_11774999 Ga0207677_117749991 82
74 3300026089 Ga0207648_10147318 Ga0207648_101473182 82
75 3300026142 Ga0207698_10211126 Ga0207698_102111262 82
76 3300027111 Ga0209281_1000002 Ga0209281_1000002472 82
77 3300027252 Ga0209973_1010335 Ga0209973_10103352 82
78 3300027717 Ga0209998_10041789 Ga0209998_100417892 82
79 3300027876 Ga0209974_10004332 Ga0209974_100043323 82
80 3300028379 Ga0268266_10008545 Ga0268266_100085456 82
81 3300028379 Ga0268266_10091342 Ga0268266_100913423 82
82 3300028380 Ga0268265_10089398 Ga0268265_100893983 82
83 3300028794 Ga0307515_10042701 Ga0307515_100427012 82
84 3300030745 Ga0316182_1410755 Ga0316182_14107552 82
85 3300031548 Ga0307408_100000012 Ga0307408_100000012315 82
86 3300032004 Ga0307414_10186651 Ga0307414_101866511 82
87 3300032005 Ga0307411_10000459 Ga0307411_100004591 82
88 3300034817 Ga0373948_0006800 Ga0373948_0006800_344_625 82
89 3300034819 Ga0373958_0142580 Ga0373958_0142580_156_437 82
90 3300035088 Ga0373940_0000397 Ga0373940_0000397_3404_3685 82
91 3300035114 Ga0373939_0000015 Ga0373939_0000015_7461_7742 82
92 3300035242 Ga0373962_0008387 Ga0373962_0008387_1888_2169 82
93 3300035691 Ga0373931_0001009 Ga0373931_0001009_7004_7285 82
94 3300037418 Ga0395900_0748027 Ga0395900_0748027_432_680 82
95 3300037466 Ga0395898_0170576 Ga0395898_0170576_674_922 82
96 3300037471 Ga0395905_0799011 Ga0395905_0799011_221_469 82
97 3300038443 Ga0395901_0829841 Ga0395901_0829841_546_794 82
98 3300041410 Ga0439461_0026044 Ga0439461_0026044_894_1145 82
99 3300041443 Ga0451789_0400955 Ga0451789_0400955_755_1003 82
100 3300041452 Ga0451793_0660416 Ga0451793_0660416_326_574 82
101 3300041491 Ga0451833_0389737 Ga0451833_0389737_70_318 82
102 3300041498 Ga0451841_0264550 Ga0451841_0264550_244_492 82
103 3300041511 Ga0451855_1438135 Ga0451855_1438135_100_366 82
104 3300042000 Ga0439437_001128 Ga0439437_001128_1289_1540 82
105 3300042000 Ga0439437_028283 Ga0439437_028283_350_610 82
106 3300042006 Ga0439432_037593 Ga0439432_037593_761_1009 82
107 3300042007 Ga0439449_0007697 Ga0439449_0007697_1063_1311 82
108 3300042116 Ga0450912_000751 Ga0450912_000751_139_387 82
109 3300042118 Ga0450914_006457 Ga0450914_006457_700_960 82
110 3300042120 Ga0450917_000605 Ga0450917_000605_1026_1277 82
111 3300042126 Ga0450888_000353 Ga0450888_000353_3082_3333 82
112 3300042127 Ga0450890_000198 Ga0450890_000198_3187_3438 82
113 3300042129 Ga0450891_000019 Ga0450891_000019_5634_5885 82
114 3300042130 Ga0450892_000103 Ga0450892_000103_8072_8323 82
115 3300042137 Ga0450902_016298 Ga0450902_016298_11_262 82
116 3300042144 Ga0450889_000179 Ga0450889_000179_2527_2778 82
117 3300042439 Ga0439464_0230124 Ga0439464_0230124_284_535 82
118 3300042532 Ga0450893_0015397 Ga0450893_0015397_17_268 82
119 3300042876 Ga0451577_0003093 Ga0451577_0003093_14217_14504 82
120 3300042876 Ga0451577_1099730 Ga0451577_1099730_10_258 82
121 3300044684 Ga0466966_0475548 Ga0466966_0475548_174_422 82
122 3300044712 Ga0453684_0315649 Ga0453684_0315649_845_1132 82
123 3300044735 Ga0466968_0047563 Ga0466968_0047563_359_619 82
124 3300046460 Ga0495638_0127674 Ga0495638_0127674_876_1124 82
125 3300046471 Ga0495650_0000042 Ga0495650_0000042_331987_332235 82
126 3300046471 Ga0495650_0000575 Ga0495650_0000575_19455_19703 82
127 3300046474 Ga0495605_0000022 Ga0495605_0000022_98043_98291 82
128 3300046507 Ga0495606_0000014 Ga0495606_0000014_80963_81211 82
129 3300046512 Ga0495610_0000753 Ga0495610_0000753_15305_15553 82
130 3300046520 Ga0495637_0088305 Ga0495637_0088305_184_432 82
131 3300046522 Ga0495643_0230671 Ga0495643_0230671_439_687 82
132 3300046528 Ga0495642_0210844 Ga0495642_0210844_498_755 82
133 3300046530 Ga0495654_0000826 Ga0495654_0000826_4020_4286 82
134 3300046542 Ga0495597_0001265 Ga0495597_0001265_2265_2513 82
135 3300046558 Ga0495633_0163197 Ga0495633_0163197_625_873 82
136 3300046616 Ga0495668_0000088 Ga0495668_0000088_116583_116831 82
137 3300046616 Ga0495668_0001807 Ga0495668_0001807_662_910 82
138 3300046660 Ga0495625_0007611 Ga0495625_0007611_2769_3017 82
139 3300046660 Ga0495625_0622812 Ga0495625_0622812_208_462 82
140 3300046694 Ga0495649_0501368 Ga0495649_0501368_224_472 82
141 3300047323 Ga0495683_0038854 Ga0495683_0038854_796_1044 82
142 3300047472 Ga0495686_0050063 Ga0495686_0050063_614_862 82
143 3300048088 Ga0495602_0781221 Ga0495602_0781221_359_607 82
144 3300048903 Ga0496100_1300506 Ga0496100_1300506_197_457 82
145 3300048917 Ga0496114_0373493 Ga0496114_0373493_199_459 82
146 3300048918 Ga0496115_0112101 Ga0496115_0112101_1564_1812 82
147 3300048927 Ga0496124_0150657 Ga0496124_0150657_144_392 82
148 3300048927 Ga0496124_0358275 Ga0496124_0358275_46_294 82
149 3300048928 Ga0496125_0060354 Ga0496125_0060354_299_547 82
150 3300048928 Ga0496125_0337275 Ga0496125_0337275_425_673 82
151 3300049523 Ga0501300_006336 Ga0501300_006336_619_885 82
152 3300049530 Ga0501314_048498 Ga0501314_048498_71_322 82
153 3300049580 Ga0501046_0088450 Ga0501046_0088450_58_306 82
154 3300049581 Ga0501047_0010106 Ga0501047_0010106_6491_6739 82
155 3300049589 Ga0501073_0017431 Ga0501073_0017431_4528_4776 82
156 3300049590 Ga0501074_0298731 Ga0501074_0298731_18_266 82
157 3300049652 Ga0501202_055687 Ga0501202_055687_526_777 82
158 3300049658 Ga0501211_002699 Ga0501211_002699_829_1095 82
159 3300049662 Ga0501222_000852 Ga0501222_000852_109_375 82
160 3300049665 Ga0501227_061105 Ga0501227_061105_54_305 82
161 3300049670 Ga0501236_014664 Ga0501236_014664_127_378 82
162 3300049679 Ga0501249_060492 Ga0501249_060492_159_410 82
163 3300049683 Ga0501253_024348 Ga0501253_024348_437_688 82
164 3300049687 Ga0501258_009667 Ga0501258_009667_518_769 82
165 3300049687 Ga0501258_025608 Ga0501258_025608_167_418 82
166 3300049705 Ga0501225_0064738 Ga0501225_0064738_519_770 82
167 3300049706 Ga0501229_001356 Ga0501229_001356_2498_2749 82
168 3300049742 Ga0501080_0034227 Ga0501080_0034227_3449_3697 82
169 3300049744 Ga0501083_0402389 Ga0501083_0402389_355_603 82
170 3300049759 Ga0501262_060688 Ga0501262_060688_108_359 82
171 3300049760 Ga0501263_050149 Ga0501263_050149_154_402 82
172 3300049764 Ga0501267_000582 Ga0501267_000582_290_541 82
173 3300049769 Ga0501272_010217 Ga0501272_010217_30_281 82
174 3300049822 Ga0501035_0081444 Ga0501035_0081444_2454_2702 82
175 3300049822 Ga0501035_0270816 Ga0501035_0270816_152_400 82
176 3300049823 Ga0501044_0081085 Ga0501044_0081085_1319_1567 82
177 3300049853 Ga0501226_025823 Ga0501226_025823_136_402 82
178 3300050490 nmdc:mga03n38_178838_c1 nmdc:mga03n38_178838_c1_807_1055 82
179 3300050493 nmdc:mga0k408_14990_c1 nmdc:mga0k408_14990_c1_2408_2659 82
180 3300050493 nmdc:mga0k408_515752_c1 nmdc:mga0k408_515752_c1_137_385 82
181 3300050496 nmdc:mga07m45_10141_c1 nmdc:mga07m45_10141_c1_3251_3499 82
182 3300050507 nmdc:mga05p37_453766_c1 nmdc:mga05p37_453766_c1_641_889 82
183 3300050515 nmdc:mga0a205_506190_c1 nmdc:mga0a205_506190_c1_436_684 82
184 3300050516 nmdc:mga0sz30_469297_c1 nmdc:mga0sz30_469297_c1_165_413 82
185 3300053079 Ga0500610_0028911 Ga0500610_0028911_219_467 82
186 3300053093 Ga0500651_0235160 Ga0500651_0235160_769_1017 82
187 iso_pu_bacteria 2643221570 2643864340 82
188 iso_pu_bacteria 2643221596 2643992634 82
189 iso_pu_bacteria 2990710928 2990714934 82
190 3300031251 Ga0265327_10007407 Ga0265327_100074077 83
191 3300031731 Ga0307405_11530781 Ga0307405_115307811 83
192 3300031901 Ga0307406_10331375 Ga0307406_103313752 83
193 3300042530 Ga0450916_042669 Ga0450916_042669_102_356 83
194 3300044658 Ga0466972_0006924 Ga0466972_0006924_2563_2814 83
195 3300044706 Ga0466964_0027080 Ga0466964_0027080_1610_1861 83
196 3300049669 Ga0501235_189734 Ga0501235_189734_163_414 83
197 3300005841 Ga0068863_102464124 Ga0068863_1024641242 84
198 3300009101 Ga0105247_10445494 Ga0105247_104454942 84
199 3300009177 Ga0105248_10005382 Ga0105248_1000538213 84
200 3300025931 Ga0207644_10066172 Ga0207644_100661722 84
201 3300025941 Ga0207711_10126328 Ga0207711_101263281 84
202 3300026088 Ga0207641_10350831 Ga0207641_103508312 84
203 3300031901 Ga0307406_10255420 Ga0307406_102554203 84
204 3300048903 Ga0496100_1148992 Ga0496100_1148992_295_549 84
205 3300048908 Ga0496105_0129038 Ga0496105_0129038_493_747 84
206 3300048911 Ga0496108_0076076 Ga0496108_0076076_2235_2489 84
207 3300048912 Ga0496109_0397455 Ga0496109_0397455_877_1131 84
208 3300048916 Ga0496113_0085676 Ga0496113_0085676_811_1065 84
209 3300048924 Ga0496121_0003860 Ga0496121_0003860_12555_12812 84
210 3300048928 Ga0496125_0003484 Ga0496125_0003484_5347_5604 84
211 3300048928 Ga0496125_0003539 Ga0496125_0003539_11712_11969 84
212 3300048929 Ga0496126_0120248 Ga0496126_0120248_961_1218 84
213 3300053087 Ga0500643_125827 Ga0500643_125827_10_264 84
214 3300028794 Ga0307515_10004822 Ga0307515_1000482212 85
215 3300041498 Ga0451841_1185214 Ga0451841_1185214_237_506 85
216 3300005844 Ga0068862_101184489 Ga0068862_1011844892 88
217 3300025256 Ga0209759_1039458 Ga0209759_10394582 88
218 3300003752 Ga0055539_1039396 Ga0055539_10393962 89
219 3300005327 Ga0070658_10222843 Ga0070658_102228432 89
220 3300005543 Ga0070672_101363426 Ga0070672_1013634262 89
221 3300009098 Ga0105245_11016831 Ga0105245_110168311 89
222 3300009148 Ga0105243_10405899 Ga0105243_104058992 89
223 3300009176 Ga0105242_10649815 Ga0105242_106498153 89
224 3300025250 Ga0209026_1018860 Ga0209026_10188602 89
225 3300025253 Ga0209677_101083 Ga0209677_1010836 89
226 3300025909 Ga0207705_10511105 Ga0207705_105111051 89
227 3300025935 Ga0207709_10391950 Ga0207709_103919502 89
228 3300030521 Ga0307511_10069833 Ga0307511_100698335 89
229 3300031730 Ga0307516_10492097 Ga0307516_104920971 89
230 3300035111 Ga0373923_0104894 Ga0373923_0104894_511_792 89
231 3300035170 Ga0373943_0338729 Ga0373943_0338729_537_818 89
232 3300046492 Ga0495585_0636115 Ga0495585_0636115_124_405 89
233 3300046506 Ga0495583_0000164 Ga0495583_0000164_68630_68911 89
234 3300046507 Ga0495606_0001489 Ga0495606_0001489_3930_4211 89
235 3300046616 Ga0495668_0142562 Ga0495668_0142562_256_537 89
236 3300046684 Ga0495669_0023522 Ga0495669_0023522_1804_2085 89
237 3300046694 Ga0495649_0000513 Ga0495649_0000513_12149_12430 89
238 3300047323 Ga0495683_0048396 Ga0495683_0048396_187_468 89
239 3300047472 Ga0495686_0027307 Ga0495686_0027307_2410_2682 89
240 3300048929 Ga0496126_0296358 Ga0496126_0296358_655_927 89
241 3300053177 Ga0500636_0009146 Ga0500636_0009146_1825_2106 89
242 3300002705 JGI25156J39149_1033211 JGI25156J39149_10332112 92
243 3300005327 Ga0070658_10133414 Ga0070658_101334143 92
244 3300005327 Ga0070658_10394344 Ga0070658_103943442 92
245 3300005327 Ga0070658_10558693 Ga0070658_105586932 92
246 3300005364 Ga0070673_100572130 Ga0070673_1005721302 92
247 3300005366 Ga0070659_100045751 Ga0070659_1000457513 92
248 3300005563 Ga0068855_100838893 Ga0068855_1008388932 92
249 3300005616 Ga0068852_100516282 Ga0068852_1005162822 92
250 3300009093 Ga0105240_10695005 Ga0105240_106950052 92
251 3300009551 Ga0105238_11582928 Ga0105238_115829282 92
252 3300010375 Ga0105239_12859902 Ga0105239_128599021 92
253 3300013296 Ga0157374_10513725 Ga0157374_105137252 92
254 3300025230 Ga0209563_109255 Ga0209563_1092552 92
255 3300025256 Ga0209759_1012099 Ga0209759_10120992 92
256 3300025909 Ga0207705_10116595 Ga0207705_101165955 92
257 3300025913 Ga0207695_10654556 Ga0207695_106545562 92
258 3300025919 Ga0207657_10163321 Ga0207657_101633212 92
259 3300025932 Ga0207690_10003472 Ga0207690_100034728 92
260 3300025949 Ga0207667_10930627 Ga0207667_109306272 92
261 3300025960 Ga0207651_10658888 Ga0207651_106588882 92
262 3300026078 Ga0207702_12322290 Ga0207702_123222901 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11730

DUF3297

Protein of unknown function (DUF3297)

14

84

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pdp-assembly1.cif.gz_A 10-mer ring of hmpv n-rna bound to the c-terminal region of p 0.7831 55 76
8pdr-assembly1.cif.gz_A rigid body fit of assembled hmpv n-rna spiral bound to the c-terminal region of p 0.6904 55 81
2icg-assembly1.cif.gz_A crystal structure of a protein of unknown function (np_472245.1) from listeria innocua at 1.65 a resolution 0.5763 43 76
7dve-assembly2.cif.gz_B crystal structure of fad-dependent c-glycoside oxidase 0.5666 42 78
4oby-assembly1.cif.gz_A crystal structure of e.coli arginyl-trna synthetase and ligand binding studies revealed key residues in arginine recognition 0.5379 56 77
ID Description Score Start End Superfamily
af_P11875_109_453_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6301 53 75 3.40.50.620
2icgA00 Alpha Beta;3-Layer(aba) Sandwich;SMI1/KNR4-like;SMI1/KNR4-like 0.6202 54 76 3.40.1580.10
af_A0A1D6LPC7_51_198_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6126 52 77 3.50.50.60
af_Q9BL48_11_358_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.5995 51 83 3.90.1410.10
af_Q4DCU2_5_434_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.589 51 77 3.50.50.100
ID Description Score Start End GO Terms
AF-A0A847J894-F1-model_v4 DUF3297 family protein 0.9748 38 85
AF-A0A847J894-F1-model_v4 DUF3297 family protein 0.9556 38 85
AF-A0A359KHD8-F1-model_v4 DUF3297 domain-containing protein 0.9484 34 84
AF-A0A533J6W8-F1-model_v4 deleted 0.9446 12 82
AF-A0A1Z1FEJ3-F1-model_v4 DUF3297 family protein 0.9435 13 83

Feature Viewer

pLDDT pTM Quality
79.28 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map