F371035

General Info

Members Datasets Scaffolds Average Seq Length
262 143 524 201

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10540138|Ga0111539_105401382
Length 223
Sequence MKKDNDIQYTVMKITTCIKHVLSAFFLFISVCSSCQRTESNIEADTTVDATKVLIVYLSRTNNTKTIAEIIHRNVGGTLVALELEKPYPENYMATVQQVVRENETGYLPPLKTKIDSIQNYDMVFVGFPTWGMKLPPPMKSFLKQYDLSGKTIVPFNTNDGYGIGSSFETVKELCLNSKIMEGFTTRGGVDKDGKAFLTKDENRKEAEKKVKQWLEKIKLTKE

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
140 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 0
Rhizosphere 97.71
Stem 0
Stem Tuber 0
Unclassified 26.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10540138 3300009094 Unclassified 1358
2 ARcpr5yngRDRAFT_c002505 3300000043 Unclassified 1904
3 Ga0055536_1000012 3300003781 Bacteria 263217
4 Ga0055530_10002752 3300003791 Bacteria 10879
5 Ga0065712_10007304 3300005290 Bacteria 4331
6 Ga0065712_10073039 3300005290 Bacteria 4516
7 Ga0065712_10097184 3300005290 Unclassified 2133
8 Ga0065712_10141896 3300005290 Unclassified 1424
9 Ga0065707_10122890 3300005295 Unclassified 2046
10 Ga0070676_10033642 3300005328 Unclassified 2941
11 Ga0070676_10382259 3300005328 Bacteria 975
12 Ga0070683_100096553 3300005329 Bacteria 2780
13 Ga0070683_100114140 3300005329 Bacteria 2550
14 Ga0070690_100015222 3300005330 Bacteria 4584
15 Ga0068869_100002274 3300005334 Bacteria 11565
16 Ga0068869_100119684 3300005334 Bacteria 2012
17 Ga0068869_100319549 3300005334 Bacteria 1259
18 Ga0068869_101023032 3300005334 Bacteria 720
19 Ga0070666_10027939 3300005335 Bacteria 3699
20 Ga0070666_10087124 3300005335 Unclassified 2140
21 Ga0068868_100515267 3300005338 Bacteria 1049
22 Ga0070689_100002991 3300005340 Bacteria 11115
23 Ga0070689_100087995 3300005340 Bacteria 2444
24 Ga0070689_100178657 3300005340 Bacteria 1723
25 Ga0070661_100111150 3300005344 Unclassified 2046
26 Ga0070661_100298821 3300005344 Unclassified 1253
27 Ga0070669_100004917 3300005353 Bacteria 9652
28 Ga0070669_100047501 3300005353 Bacteria 3131
29 Ga0070669_100249706 3300005353 Bacteria 1412
30 Ga0070675_100002773 3300005354 Bacteria 13182
31 Ga0070675_100457646 3300005354 Bacteria 1145
32 Ga0070671_100144481 3300005355 Unclassified 2008
33 Ga0070674_100066847 3300005356 Bacteria 2527
34 Ga0070673_100049843 3300005364 Bacteria 3271
35 Ga0070673_100093956 3300005364 Bacteria 2457
36 Ga0070673_100262023 3300005364 Unclassified 1510
37 Ga0070688_100002642 3300005365 Bacteria 9093
38 Ga0070688_100017614 3300005365 Bacteria 4103
39 Ga0070688_100157529 3300005365 Bacteria 1558
40 Ga0070659_100283260 3300005366 Bacteria 1379
41 Ga0070667_100291532 3300005367 Bacteria 1467
42 Ga0070700_100195124 3300005441 Unclassified 1418
43 Ga0070700_100620698 3300005441 Bacteria 850
44 Ga0070678_100046760 3300005456 Bacteria 3105
45 Ga0070662_100020521 3300005457 Bacteria 4499
46 Ga0070662_100037763 3300005457 Bacteria 3426
47 Ga0070662_100052822 3300005457 Bacteria 2940
48 Ga0070662_100148556 3300005457 Unclassified 1822
49 Ga0068867_100030739 3300005459 Bacteria 3874
50 Ga0068867_100062230 3300005459 Bacteria 2772
51 Ga0070685_10071894 3300005466 Bacteria 2052
52 Ga0070685_10080859 3300005466 Unclassified 1948
53 Ga0070684_100325530 3300005535 Bacteria 1412
54 Ga0070684_100357006 3300005535 Bacteria 1345
55 Ga0070672_100250456 3300005543 Bacteria 1492
56 Ga0070686_100250254 3300005544 Unclassified 1294
57 Ga0070686_100302672 3300005544 Unclassified 1186
58 Ga0070693_100029513 3300005547 Bacteria 2992
59 Ga0070665_100252631 3300005548 Bacteria 1764
60 Ga0070664_100205252 3300005564 Unclassified 1760
61 Ga0070664_100259107 3300005564 Bacteria 1565
62 Ga0070664_100851538 3300005564 Unclassified 854
63 Ga0068857_100164555 3300005577 Bacteria 2014
64 Ga0068857_100274568 3300005577 Bacteria 1550
65 Ga0068854_100311382 3300005578 Unclassified 1277
66 Ga0068854_100600913 3300005578 Unclassified 939
67 Ga0068852_100225277 3300005616 Bacteria 1785
68 Ga0068852_100264458 3300005616 Unclassified 1653
69 Ga0068859_100009409 3300005617 Bacteria 9870
70 Ga0068859_100014604 3300005617 Bacteria 7888
71 Ga0068859_100329252 3300005617 Bacteria 1622
72 Ga0068864_100004501 3300005618 Bacteria 11462
73 Ga0068864_100401274 3300005618 Bacteria 1303
74 Ga0068861_100052042 3300005719 Bacteria 3111
75 Ga0068870_10130473 3300005840 Bacteria 1459
76 Ga0068858_100103156 3300005842 Unclassified 2660
77 Ga0068858_100490613 3300005842 Bacteria 1186
78 Ga0068860_100188994 3300005843 Unclassified 1993
79 Ga0068860_100412914 3300005843 Unclassified 1337
80 Ga0068860_100928505 3300005843 Bacteria 887
81 Ga0068862_100464537 3300005844 Bacteria 1195
82 Ga0070715_10159487 3300006163 Unclassified 1113
83 Ga0097621_100040438 3300006237 Bacteria 3749
84 Ga0068871_100049744 3300006358 Bacteria 3389
85 Ga0068871_100870965 3300006358 Unclassified 833
86 Ga0075428_100054272 3300006844 Bacteria 4392
87 Ga0075428_100062436 3300006844 Bacteria 4079
88 Ga0075428_100324219 3300006844 Unclassified 1655
89 Ga0075434_100396622 3300006871 Bacteria 1401
90 Ga0075429_100043405 3300006880 Bacteria 3913
91 Ga0075429_100480755 3300006880 Bacteria 1088
92 Ga0097620_100009409 3300006931 Bacteria 9870
93 Ga0097620_100014602 3300006931 Bacteria 7888
94 Ga0097620_100329225 3300006931 Bacteria 1622
95 Ga0105244_10000004 3300009036 Bacteria 492478
96 Ga0111539_10039605 3300009094 Bacteria 5678
97 Ga0111539_10060617 3300009094 Unclassified 4484
98 Ga0105241_10142814 3300009174 Bacteria 1951
99 Ga0105242_10004134 3300009176 Bacteria 11294
100 Ga0105242_10063643 3300009176 Bacteria 3038
101 Ga0105242_10495560 3300009176 Unclassified 1161
102 Ga0105242_10986871 3300009176 Unclassified 849
103 Ga0105242_11839776 3300009176 Unclassified 645
104 Ga0105248_10228604 3300009177 Unclassified 2094
105 Ga0105237_10000113 3300009545 Bacteria 114034
106 Ga0105237_10086918 3300009545 Bacteria 3117
107 Ga0105249_10456929 3300009553 Bacteria 1317
108 Ga0105239_10277120 3300010375 Unclassified 1887
109 Ga0105239_10487317 3300010375 Bacteria 1401
110 Ga0105246_10062087 3300011119 Bacteria 2602
111 Ga0157370_10217850 3300013104 Bacteria 1768
112 Ga0157374_10000955 3300013296 Bacteria 25080
113 Ga0157374_10034553 3300013296 Bacteria 4619
114 Ga0157374_10072746 3300013296 Bacteria 3244
115 Ga0157378_10015370 3300013297 Bacteria 6702
116 Ga0157378_10075376 3300013297 Bacteria 3037
117 Ga0157378_11226040 3300013297 Unclassified 790
118 Ga0163162_10090745 3300013306 Bacteria 3137
119 Ga0163162_10162439 3300013306 Bacteria 2356
120 Ga0163162_10287125 3300013306 Bacteria 1777
121 Ga0163162_10303015 3300013306 Bacteria 1730
122 Ga0163162_10471422 3300013306 Bacteria 1387
123 Ga0157372_10241969 3300013307 Bacteria 2094
124 Ga0157372_10243075 3300013307 Bacteria 2089
125 Ga0157375_10003853 3300013308 Bacteria 13019
126 Ga0157375_10010304 3300013308 Bacteria 8227
127 Ga0157375_10077909 3300013308 Bacteria 3346
128 Ga0157375_10175632 3300013308 Bacteria 2291
129 Ga0157375_10290249 3300013308 Bacteria 1799
130 Ga0157375_10387378 3300013308 Bacteria 1564
131 Ga0163163_10000075 3300014325 Bacteria 109545
132 Ga0163163_10145136 3300014325 Unclassified 2417
133 Ga0163163_10718365 3300014325 Bacteria 1063
134 Ga0157380_10014300 3300014326 Bacteria 5805
135 Ga0157380_10044739 3300014326 Bacteria 3470
136 Ga0157380_10186590 3300014326 Bacteria 1827
137 Ga0157380_10355676 3300014326 Bacteria 1372
138 Ga0157380_10370262 3300014326 Bacteria 1348
139 Ga0157380_10656513 3300014326 Unclassified 1047
140 Ga0157377_10002046 3300014745 Bacteria 8847
141 Ga0157377_10009980 3300014745 Bacteria 4684
142 Ga0157377_10018730 3300014745 Bacteria 3604
143 Ga0157377_10062067 3300014745 Unclassified 2137
144 Ga0157379_10126454 3300014968 Unclassified 2300
145 Ga0157379_11509110 3300014968 Bacteria 654
146 Ga0157376_10003083 3300014969 Bacteria 11443
147 Ga0157376_10906222 3300014969 Bacteria 900
148 Ga0163161_10005489 3300017792 Bacteria 8793
149 Ga0163161_10110317 3300017792 Unclassified 2056
150 Ga0163161_10132310 3300017792 Bacteria 1883
151 Ga0163161_10196173 3300017792 Unclassified 1554
152 Ga0209676_1000001 3300025292 Bacteria 1852142
153 Ga0209050_1000018 3300025298 Bacteria 723263
154 Ga0207697_10054014 3300025315 Bacteria 1664
155 Ga0207655_1000008 3300025728 Bacteria 734289
156 Ga0207680_10082944 3300025903 Unclassified 2019
157 Ga0207647_10193187 3300025904 Bacteria 1179
158 Ga0207645_10010286 3300025907 Bacteria 6426
159 Ga0207645_10042973 3300025907 Unclassified 2892
160 Ga0207643_10100454 3300025908 Unclassified 1696
161 Ga0207654_10727679 3300025911 Bacteria 714
162 Ga0207695_10720127 3300025913 Bacteria 878
163 Ga0207671_10002020 3300025914 Bacteria 22320
164 Ga0207662_10232713 3300025918 Unclassified 1204
165 Ga0207649_10077583 3300025920 Bacteria 2141
166 Ga0207649_10554681 3300025920 Unclassified 879
167 Ga0207646_10213058 3300025922 Unclassified 1745
168 Ga0207681_10005212 3300025923 Bacteria 7981
169 Ga0207650_10413883 3300025925 Bacteria 1117
170 Ga0207659_10011304 3300025926 Bacteria 5638
171 Ga0207659_10164219 3300025926 Bacteria 1746
172 Ga0207659_10405727 3300025926 Bacteria 1141
173 Ga0207690_10308191 3300025932 Bacteria 1241
174 Ga0207706_10008620 3300025933 Bacteria 9397
175 Ga0207706_10016444 3300025933 Bacteria 6679
176 Ga0207686_10286595 3300025934 Bacteria 1218
177 Ga0207686_10689029 3300025934 Unclassified 811
178 Ga0207670_10005318 3300025936 Bacteria 7053
179 Ga0207670_10038597 3300025936 Bacteria 3121
180 Ga0207670_10112283 3300025936 Bacteria 1966
181 Ga0207670_10430373 3300025936 Unclassified 1060
182 Ga0207669_10080349 3300025937 Unclassified 2085
183 Ga0207669_10465852 3300025937 Unclassified 1004
184 Ga0207704_10278683 3300025938 Unclassified 1270
185 Ga0207704_10699882 3300025938 Bacteria 839
186 Ga0207691_10017098 3300025940 Bacteria 6881
187 Ga0207691_10148906 3300025940 Unclassified 2059
188 Ga0207691_10248752 3300025940 Bacteria 1535
189 Ga0207689_10040266 3300025942 Bacteria 3868
190 Ga0207689_10045663 3300025942 Bacteria 3621
191 Ga0207689_10092589 3300025942 Unclassified 2483
192 Ga0207689_10199558 3300025942 Bacteria 1651
193 Ga0207689_10898279 3300025942 Bacteria 747
194 Ga0207679_10154902 3300025945 Bacteria 1870
195 Ga0207679_10232110 3300025945 Unclassified 1558
196 Ga0207667_10895545 3300025949 Bacteria 879
197 Ga0207651_10011171 3300025960 Bacteria 5013
198 Ga0207651_10055626 3300025960 Bacteria 2719
199 Ga0207651_10097049 3300025960 Bacteria 2175
200 Ga0207712_10239622 3300025961 Bacteria 1460
201 Ga0207712_10495870 3300025961 Unclassified 1043
202 Ga0207668_11079060 3300025972 Bacteria 719
203 Ga0207640_10062104 3300025981 Bacteria 2477
204 Ga0207677_10093677 3300026023 Bacteria 2191
205 Ga0207639_10103291 3300026041 Unclassified 2309
206 Ga0207678_10371727 3300026067 Bacteria 1235
207 Ga0207708_10223162 3300026075 Unclassified 1510
208 Ga0207708_10272857 3300026075 Unclassified 1368
209 Ga0207702_10462889 3300026078 Bacteria 1232
210 Ga0207641_10557738 3300026088 Bacteria 1118
211 Ga0207648_10031067 3300026089 Bacteria 4724
212 Ga0207648_10272395 3300026089 Bacteria 1512
213 Ga0207648_10711372 3300026089 Bacteria 931
214 Ga0207676_10001466 3300026095 Bacteria 17524
215 Ga0207676_10286393 3300026095 Bacteria 1498
216 Ga0207674_10275478 3300026116 Bacteria 1630
217 Ga0207674_10402778 3300026116 Bacteria 1322
218 Ga0207675_100017188 3300026118 Bacteria 6756
219 Ga0207675_100499146 3300026118 Bacteria 1211
220 Ga0207683_10249750 3300026121 Bacteria 1619
221 Ga0207683_10682337 3300026121 Bacteria 952
222 Ga0207698_10133521 3300026142 Bacteria 2125
223 Ga0207428_10050505 3300027907 Bacteria 3327
224 Ga0268266_10116866 3300028379 Bacteria 2370
225 Ga0268266_10231482 3300028379 Bacteria 1702
226 Ga0268265_10004707 3300028380 Bacteria 9419
227 Ga0268265_10174994 3300028380 Unclassified 1838
228 Ga0268265_10509682 3300028380 Bacteria 1135
229 Ga0268265_10520103 3300028380 Unclassified 1125
230 Ga0268264_10146374 3300028381 Unclassified 2113
231 Ga0307515_10000479 3300028794 Bacteria 95197
232 Ga0307413_10427741 3300031824 Bacteria 1045
233 Ga0307414_10042047 3300032004 Unclassified 3102
234 Ga0307414_10280770 3300032004 Bacteria 1399
235 Ga0307414_10471950 3300032004 Bacteria 1105
236 Ga0373933_0239517 3300035724 Bacteria 1167
237 Ga0373947_0521861 3300035725 Unclassified 808
238 Ga0373937_0123782 3300036401 Bacteria 2411
239 Ga0395905_0530292 3300037471 Bacteria 1078
240 Ga0439435_0157751 3300042436 Bacteria 731
241 Ga0451577_0019948 3300042876 Bacteria 6158
242 Ga0453684_0013408 3300044712 Bacteria 13313
243 Ga0451576_0481151 3300045051 Unclassified 1304
244 Ga0495627_022531 3300046453 Bacteria 2072
245 Ga0495650_0168013 3300046471 Bacteria 778
246 Ga0495606_0000919 3300046507 Bacteria 43453
247 Ga0495630_0566426 3300046517 Bacteria 871
248 Ga0495598_0219412 3300046537 Unclassified 694
249 Ga0495621_0269848 3300046539 Bacteria 699
250 Ga0495633_0000199 3300046558 Bacteria 76789
251 Ga0495669_0210331 3300046684 Bacteria 931
252 Ga0495670_0156548 3300046691 Unclassified 1196
253 Ga0495660_0005922 3300046810 Bacteria 7284
254 Ga0501250_020207 3300049680 Bacteria 857
255 Ga0501271_038233 3300049768 Bacteria 617
256 nmdc:mga09592_115407_c1 3300050508 Unclassified 2305
257 nmdc:mga09592_383035_c1 3300050508 Unclassified 1216
258 nmdc:mga09592_3957_c1 3300050508 Bacteria 11937
259 nmdc:mga08y16_109275_c1 3300050511 Unclassified 2879
260 nmdc:mga08y16_228928_c1 3300050511 Unclassified 1923
261 nmdc:mga08y16_815266_c1 3300050511 Bacteria 925
262 Ga0500642_0123839 3300053130 Bacteria 1210
263 Ga0111539_10540138
264 ARcpr5yngRDRAFT_c002505
265 Ga0055536_1000012
266 Ga0055530_10002752
267 Ga0065712_10007304
268 Ga0065712_10073039
269 Ga0065712_10097184
270 Ga0065712_10141896
271 Ga0065707_10122890
272 Ga0070676_10033642
273 Ga0070676_10382259
274 Ga0070683_100096553
275 Ga0070683_100114140
276 Ga0070690_100015222
277 Ga0068869_100002274
278 Ga0068869_100119684
279 Ga0068869_100319549
280 Ga0068869_101023032
281 Ga0070666_10027939
282 Ga0070666_10087124
283 Ga0068868_100515267
284 Ga0070689_100002991
285 Ga0070689_100087995
286 Ga0070689_100178657
287 Ga0070661_100111150
288 Ga0070661_100298821
289 Ga0070669_100004917
290 Ga0070669_100047501
291 Ga0070669_100249706
292 Ga0070675_100002773
293 Ga0070675_100457646
294 Ga0070671_100144481
295 Ga0070674_100066847
296 Ga0070673_100049843
297 Ga0070673_100093956
298 Ga0070673_100262023
299 Ga0070688_100002642
300 Ga0070688_100017614
301 Ga0070688_100157529
302 Ga0070659_100283260
303 Ga0070667_100291532
304 Ga0070700_100195124
305 Ga0070700_100620698
306 Ga0070678_100046760
307 Ga0070662_100020521
308 Ga0070662_100037763
309 Ga0070662_100052822
310 Ga0070662_100148556
311 Ga0068867_100030739
312 Ga0068867_100062230
313 Ga0070685_10071894
314 Ga0070685_10080859
315 Ga0070684_100325530
316 Ga0070684_100357006
317 Ga0070672_100250456
318 Ga0070686_100250254
319 Ga0070686_100302672
320 Ga0070693_100029513
321 Ga0070665_100252631
322 Ga0070664_100205252
323 Ga0070664_100259107
324 Ga0070664_100851538
325 Ga0068857_100164555
326 Ga0068857_100274568
327 Ga0068854_100311382
328 Ga0068854_100600913
329 Ga0068852_100225277
330 Ga0068852_100264458
331 Ga0068859_100009409
332 Ga0068859_100014604
333 Ga0068859_100329252
334 Ga0068864_100004501
335 Ga0068864_100401274
336 Ga0068861_100052042
337 Ga0068870_10130473
338 Ga0068858_100103156
339 Ga0068858_100490613
340 Ga0068860_100188994
341 Ga0068860_100412914
342 Ga0068860_100928505
343 Ga0068862_100464537
344 Ga0070715_10159487
345 Ga0097621_100040438
346 Ga0068871_100049744
347 Ga0068871_100870965
348 Ga0075428_100054272
349 Ga0075428_100062436
350 Ga0075428_100324219
351 Ga0075434_100396622
352 Ga0075429_100043405
353 Ga0075429_100480755
354 Ga0097620_100009409
355 Ga0097620_100014602
356 Ga0097620_100329225
357 Ga0105244_10000004
358 Ga0111539_10039605
359 Ga0111539_10060617
360 Ga0105241_10142814
361 Ga0105242_10004134
362 Ga0105242_10063643
363 Ga0105242_10495560
364 Ga0105242_10986871
365 Ga0105242_11839776
366 Ga0105248_10228604
367 Ga0105237_10000113
368 Ga0105237_10086918
369 Ga0105249_10456929
370 Ga0105239_10277120
371 Ga0105239_10487317
372 Ga0105246_10062087
373 Ga0157370_10217850
374 Ga0157374_10000955
375 Ga0157374_10034553
376 Ga0157374_10072746
377 Ga0157378_10015370
378 Ga0157378_10075376
379 Ga0157378_11226040
380 Ga0163162_10090745
381 Ga0163162_10162439
382 Ga0163162_10287125
383 Ga0163162_10303015
384 Ga0163162_10471422
385 Ga0157372_10241969
386 Ga0157372_10243075
387 Ga0157375_10003853
388 Ga0157375_10010304
389 Ga0157375_10077909
390 Ga0157375_10175632
391 Ga0157375_10290249
392 Ga0157375_10387378
393 Ga0163163_10000075
394 Ga0163163_10145136
395 Ga0163163_10718365
396 Ga0157380_10014300
397 Ga0157380_10044739
398 Ga0157380_10186590
399 Ga0157380_10355676
400 Ga0157380_10370262
401 Ga0157380_10656513
402 Ga0157377_10002046
403 Ga0157377_10009980
404 Ga0157377_10018730
405 Ga0157377_10062067
406 Ga0157379_10126454
407 Ga0157379_11509110
408 Ga0157376_10003083
409 Ga0157376_10906222
410 Ga0163161_10005489
411 Ga0163161_10110317
412 Ga0163161_10132310
413 Ga0163161_10196173
414 Ga0209676_1000001
415 Ga0209050_1000018
416 Ga0207697_10054014
417 Ga0207655_1000008
418 Ga0207680_10082944
419 Ga0207647_10193187
420 Ga0207645_10010286
421 Ga0207645_10042973
422 Ga0207643_10100454
423 Ga0207654_10727679
424 Ga0207695_10720127
425 Ga0207671_10002020
426 Ga0207662_10232713
427 Ga0207649_10077583
428 Ga0207649_10554681
429 Ga0207646_10213058
430 Ga0207681_10005212
431 Ga0207650_10413883
432 Ga0207659_10011304
433 Ga0207659_10164219
434 Ga0207659_10405727
435 Ga0207690_10308191
436 Ga0207706_10008620
437 Ga0207706_10016444
438 Ga0207686_10286595
439 Ga0207686_10689029
440 Ga0207670_10005318
441 Ga0207670_10038597
442 Ga0207670_10112283
443 Ga0207670_10430373
444 Ga0207669_10080349
445 Ga0207669_10465852
446 Ga0207704_10278683
447 Ga0207704_10699882
448 Ga0207691_10017098
449 Ga0207691_10148906
450 Ga0207691_10248752
451 Ga0207689_10040266
452 Ga0207689_10045663
453 Ga0207689_10092589
454 Ga0207689_10199558
455 Ga0207689_10898279
456 Ga0207679_10154902
457 Ga0207679_10232110
458 Ga0207667_10895545
459 Ga0207651_10011171
460 Ga0207651_10055626
461 Ga0207651_10097049
462 Ga0207712_10239622
463 Ga0207712_10495870
464 Ga0207668_11079060
465 Ga0207640_10062104
466 Ga0207677_10093677
467 Ga0207639_10103291
468 Ga0207678_10371727
469 Ga0207708_10223162
470 Ga0207708_10272857
471 Ga0207702_10462889
472 Ga0207641_10557738
473 Ga0207648_10031067
474 Ga0207648_10272395
475 Ga0207648_10711372
476 Ga0207676_10001466
477 Ga0207676_10286393
478 Ga0207674_10275478
479 Ga0207674_10402778
480 Ga0207675_100017188
481 Ga0207675_100499146
482 Ga0207683_10249750
483 Ga0207683_10682337
484 Ga0207698_10133521
485 Ga0207428_10050505
486 Ga0268266_10116866
487 Ga0268266_10231482
488 Ga0268265_10004707
489 Ga0268265_10174994
490 Ga0268265_10509682
491 Ga0268265_10520103
492 Ga0268264_10146374
493 Ga0307515_10000479
494 Ga0307413_10427741
495 Ga0307414_10042047
496 Ga0307414_10280770
497 Ga0307414_10471950
498 Ga0373933_0239517
499 Ga0373947_0521861
500 Ga0373937_0123782
501 Ga0395905_0530292
502 Ga0439435_0157751
503 Ga0451577_0019948
504 Ga0453684_0013408
505 Ga0451576_0481151
506 Ga0495627_022531
507 Ga0495650_0168013
508 Ga0495606_0000919
509 Ga0495630_0566426
510 Ga0495598_0219412
511 Ga0495621_0269848
512 Ga0495633_0000199
513 Ga0495669_0210331
514 Ga0495670_0156548
515 Ga0495660_0005922
516 Ga0501250_020207
517 Ga0501271_038233
518 nmdc:mga09592_115407_c1
519 nmdc:mga09592_383035_c1
520 nmdc:mga09592_3957_c1
521 nmdc:mga08y16_109275_c1
522 nmdc:mga08y16_228928_c1
523 nmdc:mga08y16_815266_c1
524 Ga0500642_0123839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12682

Flavodoxin_4

Flavodoxin

52

218

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3edo-assembly2.cif.gz_B crystal structure of flavoprotein in complex with fmn (yp_193882.1) from lactobacillus acidophilus ncfm at 1.20 a resolution 0.8722 40 174
4ici-assembly1.cif.gz_A crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution 0.8541 41 207
4j8p-assembly1.cif.gz_A crystal structure of a putative flavoprotein (bacuni_04544) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.8488 40 201
3klb-assembly1.cif.gz_A crystal structure of putative flavoprotein in complex with fmn (yp_213683.1) from bacteroides fragilis nctc 9343 at 1.75 a resolution 0.8473 41 207
4j8p-assembly1.cif.gz_A crystal structure of a putative flavoprotein (bacuni_04544) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.8287 40 201
ID Description Score Start End Superfamily
4j8pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8538 40 201 3.40.50.360
4j8pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8335 40 201 3.40.50.360
2n1mA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7738 40 174 3.40.50.360
af_Q57746_4_148_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7156 43 201 3.40.50.360
af_Q57746_4_148_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.6981 43 201 3.40.50.360
ID Description Score Start End GO Terms
AF-C6IJR3-F1-model_v4 deleted 0.9705 43 176
AF-A0A316N5F5-F1-model_v4 Flavodoxin 0.9689 43 150 GO:0009055
GO:0010181
AF-S3ZCU8-F1-model_v4 Flavodoxin-like domain-containing protein 0.967 69 176 GO:0010181
AF-G5IEN0-F1-model_v4 Flavodoxin-like domain-containing protein 0.9638 40 206 GO:0009055
GO:0010181
GO:0016651
AF-D1Y6R0-F1-model_v4 deleted 0.9632 41 173

Map