F370869

General Info

Members Datasets Scaffolds Average Seq Length
262 183 524 198

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100509998|Ga0070674_1005099982
Length 231
Sequence VVWWDSTSRKAVNAPLTSASRWELGVVLHLLIATSNPNKIREIRQLLSGVPVTLHSLAELPPVIEPDETGSTFLENARLKARYYSEHLAAARVPWGASAITVAEDSGLVIDALDGEPGVRSARFLGDETTYPERFAEIYRRLAQRPDAGRDARFICALAAMRDGNPAFETTGIVEGVIAPEPAGTNGFGYDPIFLFPAYQRTLADVSDEEKLRVAHRGHAFRGLAEWLRRI

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 0.76
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100509998 3300005356 Bacteria 1003
2 rootH2_10047242 3300003320 Bacteria 23681
3 rootH2_10318476 3300003320 Bacteria 1551
4 rootH1_10285262 3300003323 Bacteria 4453
5 Ga0065715_10009735 3300005293 Bacteria 3109
6 Ga0065707_10120444 3300005295 Bacteria 2134
7 Ga0070676_10019316 3300005328 Bacteria 3790
8 Ga0070677_10359343 3300005333 Bacteria 757
9 Ga0068869_100501111 3300005334 Bacteria 1014
10 Ga0070680_100181839 3300005336 Bacteria 1771
11 Ga0070682_100220356 3300005337 Bacteria 1350
12 Ga0068868_100014146 3300005338 Bacteria 5876
13 Ga0070675_100270995 3300005354 Unclassified 1490
14 Ga0070659_100032301 3300005366 Bacteria 4059
15 Ga0070714_100016857 3300005435 Bacteria 5909
16 Ga0070713_100022179 3300005436 Bacteria 4903
17 Ga0070711_100001627 3300005439 Bacteria 12404
18 Ga0070705_100000382 3300005440 Bacteria 25885
19 Ga0070705_100006081 3300005440 Bacteria 5906
20 Ga0070705_100357187 3300005440 Bacteria 1067
21 Ga0070694_100001318 3300005444 Bacteria 14439
22 Ga0070694_100003061 3300005444 Bacteria 9955
23 Ga0070708_100101103 3300005445 Bacteria 2640
24 Ga0070678_100002854 3300005456 Bacteria 9561
25 Ga0070678_100456577 3300005456 Bacteria 1120
26 Ga0070662_100000003 3300005457 Bacteria 239813
27 Ga0068867_100076171 3300005459 Bacteria 2518
28 Ga0070707_100416455 3300005468 Bacteria 1304
29 Ga0070698_100004552 3300005471 Bacteria 15229
30 Ga0070698_100017026 3300005471 Bacteria 7663
31 Ga0070698_100380130 3300005471 Unclassified 1345
32 Ga0070699_100001230 3300005518 Bacteria 23625
33 Ga0070699_100037457 3300005518 Bacteria 4197
34 Ga0068853_100026788 3300005539 Bacteria 4842
35 Ga0068853_100327205 3300005539 Bacteria 1422
36 Ga0070672_100021000 3300005543 Bacteria 4773
37 Ga0070672_100038944 3300005543 Bacteria 3637
38 Ga0070695_100000008 3300005545 Bacteria 88588
39 Ga0070696_100000399 3300005546 Bacteria 26916
40 Ga0070696_100011186 3300005546 Bacteria 6006
41 Ga0070665_100000212 3300005548 Bacteria 100019
42 Ga0070704_100078769 3300005549 Bacteria 2419
43 Ga0070704_100197336 3300005549 Unclassified 1622
44 Ga0070704_100351434 3300005549 Bacteria 1245
45 Ga0068855_100018464 3300005563 Bacteria 8381
46 Ga0070664_100608135 3300005564 Bacteria 1014
47 Ga0068856_100162219 3300005614 Bacteria 2246
48 Ga0070702_100093449 3300005615 Bacteria 1829
49 Ga0068852_100005587 3300005616 Bacteria 9012
50 Ga0068859_100199164 3300005617 Bacteria 2087
51 Ga0068866_10365262 3300005718 Bacteria 921
52 Ga0068861_100218938 3300005719 Unclassified 1608
53 Ga0068861_100565491 3300005719 Bacteria 1038
54 Ga0068870_10059238 3300005840 Bacteria 2052
55 Ga0068858_100113311 3300005842 Bacteria 2533
56 Ga0068862_100164552 3300005844 Bacteria 1982
57 Ga0081455_10004758 3300005937 Bacteria 15084
58 Ga0081539_10002829 3300005985 Bacteria 23195
59 Ga0070717_10200863 3300006028 Bacteria 1746
60 Ga0075432_10025838 3300006058 Bacteria 2015
61 Ga0070712_100001808 3300006175 Bacteria 13045
62 Ga0097621_100000205 3300006237 Bacteria 38617
63 Ga0097621_100695255 3300006237 Bacteria 936
64 Ga0068871_100002674 3300006358 Bacteria 12163
65 Ga0068871_100184387 3300006358 Bacteria 1795
66 Ga0075428_100001574 3300006844 Bacteria 24457
67 Ga0075428_100005755 3300006844 Bacteria 13770
68 Ga0075428_100018531 3300006844 Bacteria 7696
69 Ga0075428_100100279 3300006844 Bacteria 3157
70 Ga0075428_100407540 3300006844 Bacteria 1457
71 Ga0075428_100445788 3300006844 Bacteria 1386
72 Ga0075428_101030037 3300006844 Bacteria 871
73 Ga0075430_100002500 3300006846 Bacteria 15328
74 Ga0075431_100002000 3300006847 Bacteria 19446
75 Ga0075433_10001555 3300006852 Bacteria 16975
76 Ga0075433_10001782 3300006852 Bacteria 16126
77 Ga0075433_10018277 3300006852 Bacteria 5823
78 Ga0075434_100004464 3300006871 Bacteria 12619
79 Ga0075434_100008974 3300006871 Bacteria 9312
80 Ga0075434_100090878 3300006871 Bacteria 3054
81 Ga0075434_100107489 3300006871 Bacteria 2800
82 Ga0075429_100004558 3300006880 Bacteria 11911
83 Ga0068865_100000780 3300006881 Bacteria 17900
84 Ga0097620_100199172 3300006931 Bacteria 2087
85 Ga0075435_100004677 3300007076 Bacteria 9439
86 Ga0075435_100116645 3300007076 Bacteria 2224
87 Ga0075435_100203216 3300007076 Unclassified 1679
88 Ga0075435_100310297 3300007076 Bacteria 1350
89 Ga0105240_10018983 3300009093 Bacteria 9206
90 Ga0105240_10062153 3300009093 Bacteria 4650
91 Ga0105240_11577738 3300009093 Bacteria 687
92 Ga0111539_10000789 3300009094 Bacteria 41240
93 Ga0111539_10033730 3300009094 Bacteria 6213
94 Ga0111539_10186926 3300009094 Bacteria 2419
95 Ga0111539_10378195 3300009094 Bacteria 1649
96 Ga0111539_10612466 3300009094 Bacteria 1268
97 Ga0114129_10000759 3300009147 Bacteria 41109
98 Ga0114129_10012544 3300009147 Bacteria 12068
99 Ga0114129_10083815 3300009147 Bacteria 4426
100 Ga0114129_10245709 3300009147 Bacteria 2404
101 Ga0105243_10026823 3300009148 Bacteria 4412
102 Ga0105241_10000926 3300009174 Bacteria 22230
103 Ga0105241_10012615 3300009174 Bacteria 6200
104 Ga0105242_10251506 3300009176 Bacteria 1593
105 Ga0105237_10006439 3300009545 Bacteria 13015
106 Ga0105238_10000836 3300009551 Bacteria 31890
107 Ga0105249_10368942 3300009553 Bacteria 1458
108 Ga0105239_10067453 3300010375 Bacteria 3930
109 Ga0105239_10098961 3300010375 Bacteria 3224
110 Ga0105239_10257274 3300010375 Bacteria 1962
111 Ga0105239_11214884 3300010375 Bacteria 869
112 Ga0157373_10047763 3300013100 Bacteria 3053
113 Ga0157369_10210624 3300013105 Bacteria 2037
114 Ga0157374_10000897 3300013296 Bacteria 25951
115 Ga0157374_10003812 3300013296 Bacteria 12663
116 Ga0157374_10111594 3300013296 Bacteria 2630
117 Ga0163162_10000008 3300013306 Bacteria 316194
118 Ga0157372_10052534 3300013307 Bacteria 4539
119 Ga0157375_10002636 3300013308 Bacteria 15528
120 Ga0157380_10071670 3300014326 Bacteria 2803
121 Ga0157380_11553392 3300014326 Bacteria 716
122 Ga0157377_10046654 3300014745 Bacteria 2425
123 Ga0157377_10078668 3300014745 Bacteria 1922
124 Ga0157376_10099966 3300014969 Bacteria 2532
125 Ga0213872_10004767 3300021361 Bacteria 7098
126 Ga0207697_10022138 3300025315 Bacteria 2605
127 Ga0207647_10000244 3300025904 Bacteria 44547
128 Ga0207645_10000014 3300025907 Bacteria 117512
129 Ga0207705_10246500 3300025909 Unclassified 1362
130 Ga0207654_10002186 3300025911 Bacteria 10002
131 Ga0207654_10095406 3300025911 Bacteria 1822
132 Ga0207695_10044472 3300025913 Bacteria 4723
133 Ga0207695_11085570 3300025913 Bacteria 680
134 Ga0207671_10009490 3300025914 Bacteria 8128
135 Ga0207693_10000709 3300025915 Bacteria 29986
136 Ga0207693_10051320 3300025915 Bacteria 3237
137 Ga0207663_10011022 3300025916 Bacteria 4835
138 Ga0207646_10271234 3300025922 Bacteria 1534
139 Ga0207659_10176332 3300025926 Bacteria 1690
140 Ga0207700_10016922 3300025928 Bacteria 4856
141 Ga0207664_10002575 3300025929 Bacteria 11990
142 Ga0207664_10471058 3300025929 Bacteria 1123
143 Ga0207690_10029049 3300025932 Bacteria 3512
144 Ga0207706_10000009 3300025933 Bacteria 200607
145 Ga0207706_10077229 3300025933 Bacteria 2929
146 Ga0207686_10120712 3300025934 Bacteria 1784
147 Ga0207704_10000601 3300025938 Bacteria 15875
148 Ga0207691_10313547 3300025940 Bacteria 1346
149 Ga0207689_10265476 3300025942 Bacteria 1421
150 Ga0207667_10015047 3300025949 Bacteria 8801
151 Ga0207651_10307532 3300025960 Unclassified 1321
152 Ga0207677_10335840 3300026023 Bacteria 1261
153 Ga0207703_10597205 3300026035 Bacteria 1044
154 Ga0207639_10004084 3300026041 Bacteria 9847
155 Ga0207639_10024012 3300026041 Bacteria 4406
156 Ga0207639_11460371 3300026041 Bacteria 642
157 Ga0207648_10000963 3300026089 Bacteria 32564
158 Ga0207683_10003023 3300026121 Bacteria 14688
159 Ga0207683_10182418 3300026121 Bacteria 1903
160 Ga0207683_10339183 3300026121 Bacteria 1378
161 Ga0207428_10000374 3300027907 Bacteria 56990
162 Ga0207428_10402938 3300027907 Bacteria 1001
163 Ga0268266_10000177 3300028379 Bacteria 114318
164 Ga0268265_10018946 3300028380 Bacteria 4779
165 Ga0265340_10040331 3300031247 Bacteria 2300
166 Ga0307408_100043825 3300031548 Bacteria 3185
167 Ga0307408_100104284 3300031548 Bacteria 2166
168 Ga0316579_10063860 3300031691 Bacteria 1736
169 Ga0307413_10041383 3300031824 Bacteria 2697
170 Ga0307410_10023481 3300031852 Bacteria 3834
171 Ga0307410_10060318 3300031852 Bacteria 2592
172 Ga0307406_10015725 3300031901 Bacteria 4385
173 Ga0307407_10003147 3300031903 Bacteria 6681
174 Ga0307407_10312640 3300031903 Bacteria 1099
175 Ga0307412_10106044 3300031911 Bacteria 1997
176 Ga0307409_100024499 3300031995 Bacteria 4210
177 Ga0307416_100210402 3300032002 Bacteria 1854
178 Ga0307414_10049673 3300032004 Bacteria 2902
179 Ga0307411_10020585 3300032005 Bacteria 3841
180 Ga0307411_10020847 3300032005 Bacteria 3822
181 Ga0307415_100351867 3300032126 Bacteria 1240
182 Ga0307510_10000172 3300033180 Bacteria 54812
183 Ga0373934_0011214 3300035086 Bacteria 3373
184 Ga0373934_0023164 3300035086 Bacteria 2399
185 Ga0373953_0003044 3300035117 Bacteria 5145
186 Ga0373954_0278582 3300035118 Bacteria 824
187 Ga0373956_0021530 3300035119 Bacteria 2751
188 Ga0373924_0021831 3300035410 Bacteria 2498
189 Ga0373924_0069223 3300035410 Bacteria 1487
190 Ga0373933_0019600 3300035724 Bacteria 3823
191 Ga0373933_0060953 3300035724 Bacteria 2275
192 Ga0373937_0001822 3300036401 Bacteria 17888
193 Ga0373937_0112015 3300036401 Bacteria 2538
194 Ga0316582_0007220 3300036647 Bacteria 5907
195 Ga0316584_0007623 3300036712 Bacteria 7423
196 Ga0373925_0794434 3300037068 Unclassified 780
197 Ga0395899_0000681 3300037312 Bacteria 34363
198 Ga0395900_0000658 3300037418 Bacteria 46240
199 Ga0395898_0004739 3300037466 Bacteria 14802
200 Ga0395905_0001785 3300037471 Bacteria 24962
201 Ga0395901_0001153 3300038443 Bacteria 28037
202 Ga0436365_0455240 3300039437 Bacteria 690
203 Ga0436361_0866169 3300039447 Bacteria 9590
204 Ga0439433_0046714 3300041999 Unclassified 1015
205 Ga0439448_0009647 3300042005 Bacteria 2849
206 Ga0453684_0129552 3300044712 Bacteria 3029
207 Ga0466959_0067220 3300045049 Bacteria 2599
208 Ga0451576_0307890 3300045051 Bacteria 1657
209 Ga0495592_0082395 3300046454 Bacteria 2325
210 Ga0495629_0100251 3300046459 Bacteria 2021
211 Ga0495651_0325525 3300046462 Bacteria 1023
212 Ga0495653_0073839 3300046463 Bacteria 2544
213 Ga0495596_0014773 3300046500 Bacteria 3285
214 Ga0495583_0097644 3300046506 Bacteria 1257
215 Ga0495631_0043598 3300046518 Unclassified 1979
216 Ga0495631_0296388 3300046518 Bacteria 688
217 Ga0495642_0003240 3300046528 Bacteria 6449
218 Ga0495621_0276875 3300046539 Bacteria 691
219 Ga0495667_0014800 3300046559 Bacteria 5272
220 Ga0495668_0232198 3300046616 Unclassified 1010
221 Ga0495659_0009208 3300046664 Bacteria 3148
222 Ga0495623_0054149 3300046679 Bacteria 2532
223 Ga0495581_0293869 3300047315 Bacteria 950
224 Ga0495604_0012644 3300047317 Bacteria 6714
225 Ga0495680_0024416 3300047322 Bacteria 5015
226 Ga0495683_0088193 3300047323 Bacteria 1506
227 Ga0495687_000409 3300047443 Bacteria 53157
228 Ga0495684_0524839 3300047471 Bacteria 810
229 Ga0496102_0688284 3300048905 Bacteria 945
230 Ga0496115_0003506 3300048918 Bacteria 11276
231 Ga0501034_0543435 3300049571 Bacteria 1072
232 Ga0501036_1021153 3300049572 Bacteria 677
233 Ga0501039_0052427 3300049575 Bacteria 3157
234 Ga0501039_0608089 3300049575 Bacteria 857
235 Ga0501042_0128141 3300049578 Bacteria 1828
236 Ga0501047_0315866 3300049581 Bacteria 1403
237 Ga0501048_0718458 3300049582 Bacteria 717
238 nmdc:mga05p37_101689_c1 3300050507 Bacteria 3539
239 nmdc:mga05p37_204220_c1 3300050507 Bacteria 2391
240 nmdc:mga05p37_297_c2 3300050507 Bacteria 49814
241 nmdc:mga05p37_909851_c1 3300050507 Bacteria 947
242 nmdc:mga0qj67_253_c1 3300050509 Bacteria 36631
243 nmdc:mga06r32_291_c1 3300050510 Bacteria 41746
244 nmdc:mga08y16_134525_c1 3300050511 Bacteria 2569
245 nmdc:mga08y16_217347_c2 3300050511 Bacteria 1648
246 nmdc:mga0n895_24902_c1 3300050512 Bacteria 5647
247 nmdc:mga0n895_414_c1 3300050512 Bacteria 28665
248 nmdc:mga0n895_6736_c1 3300050512 Bacteria 9799
249 nmdc:mga0rr50_337595_c1 3300050513 Bacteria 1266
250 nmdc:mga0rr50_370974_c1 3300050513 Bacteria 1206
251 nmdc:mga0rr50_960_c1 3300050513 Bacteria 15634
252 nmdc:mga0a205_11196_c1 3300050515 Bacteria 8257
253 nmdc:mga0a205_268953_c1 3300050515 Bacteria 1582
254 nmdc:mga0a205_730098_c1 3300050515 Bacteria 840
255 nmdc:mga0a205_751_c1 3300050515 Bacteria 26130
256 Ga0495601_0014149 3300053077 Bacteria 4806
257 Ga0495601_0015704 3300053077 Bacteria 4579
258 Ga0500635_0278610 3300053080 Bacteria 658
259 Ga0495595_0025741 3300053084 Bacteria 2609
260 Ga0495619_0003528 3300053085 Bacteria 10091
261 Ga0501084_0196055 3300054114 Bacteria 1704
262 2977234482 2977232053 Bacteria 5485925
263 Ga0070674_100509998
264 rootH2_10047242
265 rootH2_10318476
266 rootH1_10285262
267 Ga0065715_10009735
268 Ga0065707_10120444
269 Ga0070676_10019316
270 Ga0070677_10359343
271 Ga0068869_100501111
272 Ga0070680_100181839
273 Ga0070682_100220356
274 Ga0068868_100014146
275 Ga0070675_100270995
276 Ga0070659_100032301
277 Ga0070714_100016857
278 Ga0070713_100022179
279 Ga0070711_100001627
280 Ga0070705_100000382
281 Ga0070705_100006081
282 Ga0070705_100357187
283 Ga0070694_100001318
284 Ga0070694_100003061
285 Ga0070708_100101103
286 Ga0070678_100002854
287 Ga0070678_100456577
288 Ga0070662_100000003
289 Ga0068867_100076171
290 Ga0070707_100416455
291 Ga0070698_100004552
292 Ga0070698_100017026
293 Ga0070698_100380130
294 Ga0070699_100001230
295 Ga0070699_100037457
296 Ga0068853_100026788
297 Ga0068853_100327205
298 Ga0070672_100021000
299 Ga0070672_100038944
300 Ga0070695_100000008
301 Ga0070696_100000399
302 Ga0070696_100011186
303 Ga0070665_100000212
304 Ga0070704_100078769
305 Ga0070704_100197336
306 Ga0070704_100351434
307 Ga0068855_100018464
308 Ga0070664_100608135
309 Ga0068856_100162219
310 Ga0070702_100093449
311 Ga0068852_100005587
312 Ga0068859_100199164
313 Ga0068866_10365262
314 Ga0068861_100218938
315 Ga0068861_100565491
316 Ga0068870_10059238
317 Ga0068858_100113311
318 Ga0068862_100164552
319 Ga0081455_10004758
320 Ga0081539_10002829
321 Ga0070717_10200863
322 Ga0075432_10025838
323 Ga0070712_100001808
324 Ga0097621_100000205
325 Ga0097621_100695255
326 Ga0068871_100002674
327 Ga0068871_100184387
328 Ga0075428_100001574
329 Ga0075428_100005755
330 Ga0075428_100018531
331 Ga0075428_100100279
332 Ga0075428_100407540
333 Ga0075428_100445788
334 Ga0075428_101030037
335 Ga0075430_100002500
336 Ga0075431_100002000
337 Ga0075433_10001555
338 Ga0075433_10001782
339 Ga0075433_10018277
340 Ga0075434_100004464
341 Ga0075434_100008974
342 Ga0075434_100090878
343 Ga0075434_100107489
344 Ga0075429_100004558
345 Ga0068865_100000780
346 Ga0097620_100199172
347 Ga0075435_100004677
348 Ga0075435_100116645
349 Ga0075435_100203216
350 Ga0075435_100310297
351 Ga0105240_10018983
352 Ga0105240_10062153
353 Ga0105240_11577738
354 Ga0111539_10000789
355 Ga0111539_10033730
356 Ga0111539_10186926
357 Ga0111539_10378195
358 Ga0111539_10612466
359 Ga0114129_10000759
360 Ga0114129_10012544
361 Ga0114129_10083815
362 Ga0114129_10245709
363 Ga0105243_10026823
364 Ga0105241_10000926
365 Ga0105241_10012615
366 Ga0105242_10251506
367 Ga0105237_10006439
368 Ga0105238_10000836
369 Ga0105249_10368942
370 Ga0105239_10067453
371 Ga0105239_10098961
372 Ga0105239_10257274
373 Ga0105239_11214884
374 Ga0157373_10047763
375 Ga0157369_10210624
376 Ga0157374_10000897
377 Ga0157374_10003812
378 Ga0157374_10111594
379 Ga0163162_10000008
380 Ga0157372_10052534
381 Ga0157375_10002636
382 Ga0157380_10071670
383 Ga0157380_11553392
384 Ga0157377_10046654
385 Ga0157377_10078668
386 Ga0157376_10099966
387 Ga0213872_10004767
388 Ga0207697_10022138
389 Ga0207647_10000244
390 Ga0207645_10000014
391 Ga0207705_10246500
392 Ga0207654_10002186
393 Ga0207654_10095406
394 Ga0207695_10044472
395 Ga0207695_11085570
396 Ga0207671_10009490
397 Ga0207693_10000709
398 Ga0207693_10051320
399 Ga0207663_10011022
400 Ga0207646_10271234
401 Ga0207659_10176332
402 Ga0207700_10016922
403 Ga0207664_10002575
404 Ga0207664_10471058
405 Ga0207690_10029049
406 Ga0207706_10000009
407 Ga0207706_10077229
408 Ga0207686_10120712
409 Ga0207704_10000601
410 Ga0207691_10313547
411 Ga0207689_10265476
412 Ga0207667_10015047
413 Ga0207651_10307532
414 Ga0207677_10335840
415 Ga0207703_10597205
416 Ga0207639_10004084
417 Ga0207639_10024012
418 Ga0207639_11460371
419 Ga0207648_10000963
420 Ga0207683_10003023
421 Ga0207683_10182418
422 Ga0207683_10339183
423 Ga0207428_10000374
424 Ga0207428_10402938
425 Ga0268266_10000177
426 Ga0268265_10018946
427 Ga0265340_10040331
428 Ga0307408_100043825
429 Ga0307408_100104284
430 Ga0316579_10063860
431 Ga0307413_10041383
432 Ga0307410_10023481
433 Ga0307410_10060318
434 Ga0307406_10015725
435 Ga0307407_10003147
436 Ga0307407_10312640
437 Ga0307412_10106044
438 Ga0307409_100024499
439 Ga0307416_100210402
440 Ga0307414_10049673
441 Ga0307411_10020585
442 Ga0307411_10020847
443 Ga0307415_100351867
444 Ga0307510_10000172
445 Ga0373934_0011214
446 Ga0373934_0023164
447 Ga0373953_0003044
448 Ga0373954_0278582
449 Ga0373956_0021530
450 Ga0373924_0021831
451 Ga0373924_0069223
452 Ga0373933_0019600
453 Ga0373933_0060953
454 Ga0373937_0001822
455 Ga0373937_0112015
456 Ga0316582_0007220
457 Ga0316584_0007623
458 Ga0373925_0794434
459 Ga0395899_0000681
460 Ga0395900_0000658
461 Ga0395898_0004739
462 Ga0395905_0001785
463 Ga0395901_0001153
464 Ga0436365_0455240
465 Ga0436361_0866169
466 Ga0439433_0046714
467 Ga0439448_0009647
468 Ga0453684_0129552
469 Ga0466959_0067220
470 Ga0451576_0307890
471 Ga0495592_0082395
472 Ga0495629_0100251
473 Ga0495651_0325525
474 Ga0495653_0073839
475 Ga0495596_0014773
476 Ga0495583_0097644
477 Ga0495631_0043598
478 Ga0495631_0296388
479 Ga0495642_0003240
480 Ga0495621_0276875
481 Ga0495667_0014800
482 Ga0495668_0232198
483 Ga0495659_0009208
484 Ga0495623_0054149
485 Ga0495581_0293869
486 Ga0495604_0012644
487 Ga0495680_0024416
488 Ga0495683_0088193
489 Ga0495687_000409
490 Ga0495684_0524839
491 Ga0496102_0688284
492 Ga0496115_0003506
493 Ga0501034_0543435
494 Ga0501036_1021153
495 Ga0501039_0052427
496 Ga0501039_0608089
497 Ga0501042_0128141
498 Ga0501047_0315866
499 Ga0501048_0718458
500 nmdc:mga05p37_101689_c1
501 nmdc:mga05p37_204220_c1
502 nmdc:mga05p37_297_c2
503 nmdc:mga05p37_909851_c1
504 nmdc:mga0qj67_253_c1
505 nmdc:mga06r32_291_c1
506 nmdc:mga08y16_134525_c1
507 nmdc:mga08y16_217347_c2
508 nmdc:mga0n895_24902_c1
509 nmdc:mga0n895_414_c1
510 nmdc:mga0n895_6736_c1
511 nmdc:mga0rr50_337595_c1
512 nmdc:mga0rr50_370974_c1
513 nmdc:mga0rr50_960_c1
514 nmdc:mga0a205_11196_c1
515 nmdc:mga0a205_268953_c1
516 nmdc:mga0a205_730098_c1
517 nmdc:mga0a205_751_c1
518 Ga0495601_0014149
519 Ga0495601_0015704
520 Ga0500635_0278610
521 Ga0495595_0025741
522 Ga0495619_0003528
523 Ga0501084_0196055
524 2977234482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

30

227

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9316 3 192
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.9311 4 194
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9311 3 194
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.93 5 190
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.9218 4 194
ID Description Score Start End Superfamily
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9507 3 191 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9453 3 192 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9311 3 194 3.90.950.10
af_P9WMR7_2_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9289 2 192 3.90.950.10
af_Q9UU89_2_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9265 3 192 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A2N2ZCR9-F1-model_v4 Non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family 0.9957 58 194 GO:0005829
GO:0009143
GO:0047429
AF-A0A076P2I4-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9899 3 191 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A4R2NXH9-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9884 2 192 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A354GGW6-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9883 70 194 GO:0005829
GO:0009143
GO:0047429
AF-A0A7Y2VF55-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9876 116 193 GO:0005829
GO:0009143
GO:0047429

Map