F370850

General Info

Members Datasets Scaffolds Average Seq Length
262 169 524 428

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100003539|Ga0070668_1000035398
Length 458
Sequence VPPWGETREARFGGDPILTGIGVGFVIFGVMLALMVVRVPIGIAMFVVGGAGYVYLTGNPTALLNSLKNLAYARLSNYDLVVIPLFLLMGQFATHGGLSRALFRFVSAFMGHRKGGVAMAAIGACAGFGAICGSSLATAATMGQVALPELRRYGYSGSLATGALAAGGTLGIMIPPSVPLVIYAILTQESIGKLFMAAVLPGIIAMLGYMLVVRIVVAINPKAGPAGPAVAWDEKLKSFFAVLPVMLVFXXXXVGIYGGWANPTEAAAIGAAACGILAVTSGGMGTKGLIDSALGTAQATAMIFLILLGADMLNTTLALSQMPAELAGWVKASGLSPLLVMFMILLIYIFLGCVMDSLAMILLTIPIFYPMVMGLDFWGMSQDDKSIWFGILALMVVEVGLVHPPVGMNVYIINRLAKDVPLTETFKGVIPFLISDGFRIVLLVYFPIISLYLVHTFK

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
120 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
158 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
159 2643221558 Rhizobium sp. Root149 Isolate Unclassified
160 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
161 2643221719 Rhizobium sp. Root274 Isolate Unclassified
162 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
163 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
164 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
165 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
166 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
167 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
168 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
169 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.04
Metatranscriptomes 0
Isolates 4.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.87
Nodule 0.38
Rhizoplane 2.67
Rhizosphere 79.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100003539 3300005347 Bacteria 11519
2 Ga0065165_1000209 3300005262 Bacteria 101834
3 Ga0070676_10000957 3300005328 Bacteria 14350
4 Ga0070670_100002352 3300005331 Bacteria 15580
5 Ga0068869_100000275 3300005334 Bacteria 27128
6 Ga0068869_100008929 3300005334 Bacteria 6487
7 Ga0070666_10006082 3300005335 Bacteria 7417
8 Ga0070680_100230897 3300005336 Bacteria 1563
9 Ga0068868_100010948 3300005338 Bacteria 6586
10 Ga0070660_100037011 3300005339 Bacteria 3698
11 Ga0070689_100041220 3300005340 Bacteria 3544
12 Ga0070689_100045167 3300005340 Bacteria 3391
13 Ga0070668_100001319 3300005347 Bacteria 17775
14 Ga0070669_100071090 3300005353 Bacteria 2573
15 Ga0070669_100145948 3300005353 Bacteria 1828
16 Ga0070675_100020066 3300005354 Bacteria 5332
17 Ga0070675_100135761 3300005354 Bacteria 2099
18 Ga0070671_100069687 3300005355 Bacteria 2933
19 Ga0070674_100058314 3300005356 Bacteria 2683
20 Ga0070674_100084371 3300005356 Bacteria 2278
21 Ga0070674_100135903 3300005356 Bacteria 1839
22 Ga0070673_100020806 3300005364 Bacteria 4739
23 Ga0070673_100040183 3300005364 Bacteria 3586
24 Ga0070673_100087691 3300005364 Bacteria 2537
25 Ga0070667_100008685 3300005367 Bacteria 8420
26 Ga0070708_100000163 3300005445 Bacteria 47318
27 Ga0070678_100021926 3300005456 Bacteria 4222
28 Ga0068867_100005069 3300005459 Bacteria 9302
29 Ga0068867_100009131 3300005459 Bacteria 6995
30 Ga0068867_100027274 3300005459 Bacteria 4103
31 Ga0068867_100057923 3300005459 Bacteria 2870
32 Ga0068867_100071885 3300005459 Bacteria 2589
33 Ga0070679_100004252 3300005530 Bacteria 13212
34 Ga0070696_100027590 3300005546 Bacteria 3871
35 Ga0070665_100004494 3300005548 Bacteria 14637
36 Ga0070665_100021324 3300005548 Bacteria 6516
37 Ga0068855_100022967 3300005563 Bacteria 7474
38 Ga0068856_100301139 3300005614 Bacteria 1621
39 Ga0068859_100010984 3300005617 Bacteria 9112
40 Ga0068859_100040764 3300005617 Bacteria 4663
41 Ga0068864_100010705 3300005618 Bacteria 7581
42 Ga0068861_100002523 3300005719 Bacteria 11961
43 Ga0068861_100107431 3300005719 Bacteria 2231
44 Ga0068863_100007355 3300005841 Bacteria 10778
45 Ga0068863_100020210 3300005841 Bacteria 6370
46 Ga0068863_100026618 3300005841 Bacteria 5515
47 Ga0068863_100135066 3300005841 Bacteria 2357
48 Ga0068858_100002684 3300005842 Bacteria 17910
49 Ga0068858_100031190 3300005842 Bacteria 4950
50 Ga0068860_100014690 3300005843 Bacteria 7659
51 Ga0068860_100021649 3300005843 Bacteria 6224
52 Ga0075365_10042308 3300006038 Bacteria 2978
53 Ga0075368_10003128 3300006042 Bacteria 5491
54 Ga0075369_10002379 3300006186 Bacteria 6710
55 Ga0075366_10005737 3300006195 Bacteria 6739
56 Ga0075366_10010316 3300006195 Bacteria 5243
57 Ga0097621_100003113 3300006237 Bacteria 11380
58 Ga0097621_100182014 3300006237 Bacteria 1816
59 Ga0097621_100310499 3300006237 Bacteria 1395
60 Ga0075370_10056429 3300006353 Bacteria 2232
61 Ga0068871_100005984 3300006358 Bacteria 8560
62 Ga0068871_100018259 3300006358 Bacteria 5327
63 Ga0068871_100182674 3300006358 Bacteria 1803
64 Ga0068871_100244682 3300006358 Bacteria 1561
65 Ga0075430_100170166 3300006846 Bacteria 1812
66 Ga0075431_100108197 3300006847 Bacteria 2869
67 Ga0075429_100002615 3300006880 Bacteria 15180
68 Ga0068865_100028896 3300006881 Bacteria 3674
69 Ga0068865_100067289 3300006881 Bacteria 2530
70 Ga0097620_100010983 3300006931 Bacteria 9112
71 Ga0097620_100040764 3300006931 Bacteria 4663
72 Ga0105251_10041844 3300009011 Bacteria 2227
73 Ga0105240_10010584 3300009093 Bacteria 12958
74 Ga0105247_10085071 3300009101 Bacteria 1999
75 Ga0105243_10011574 3300009148 Bacteria 6675
76 Ga0105243_10091602 3300009148 Bacteria 2504
77 Ga0105243_10206939 3300009148 Bacteria 1725
78 Ga0105241_10015890 3300009174 Bacteria 5514
79 Ga0105242_10001133 3300009176 Bacteria 20985
80 Ga0105248_10008483 3300009177 Bacteria 11279
81 Ga0105248_10017075 3300009177 Bacteria 7993
82 Ga0105248_10176269 3300009177 Bacteria 2409
83 Ga0105238_10296677 3300009551 Bacteria 1599
84 Ga0105249_10078702 3300009553 Bacteria 3059
85 Ga0157374_10009791 3300013296 Bacteria 8231
86 Ga0157378_10014895 3300013297 Bacteria 6804
87 Ga0157378_10018060 3300013297 Bacteria 6194
88 Ga0157378_10094810 3300013297 Bacteria 2717
89 Ga0163162_10011958 3300013306 Bacteria 8465
90 Ga0163162_10015879 3300013306 Bacteria 7359
91 Ga0163162_10030341 3300013306 Bacteria 5357
92 Ga0163162_10156092 3300013306 Bacteria 2402
93 Ga0157375_10011070 3300013308 Bacteria 7955
94 Ga0163163_10181587 3300014325 Bacteria 2151
95 Ga0163163_10385493 3300014325 Bacteria 1459
96 Ga0157380_10009947 3300014326 Bacteria 6825
97 Ga0157380_10138110 3300014326 Bacteria 2090
98 Ga0157379_10014223 3300014968 Bacteria 6980
99 Ga0157379_10147715 3300014968 Bacteria 2120
100 Ga0157376_10004168 3300014969 Bacteria 10023
101 Ga0157376_10018307 3300014969 Bacteria 5367
102 Ga0163161_10018277 3300017792 Bacteria 4914
103 Ga0209130_1000902 3300025284 Bacteria 23951
104 Ga0209025_1005483 3300025294 Bacteria 10325
105 Ga0207697_10005366 3300025315 Bacteria 5962
106 Ga0207688_10019830 3300025901 Bacteria 3666
107 Ga0207645_10000829 3300025907 Bacteria 25892
108 Ga0207645_10016433 3300025907 Bacteria 4899
109 Ga0207645_10036312 3300025907 Bacteria 3164
110 Ga0207643_10013756 3300025908 Bacteria 4389
111 Ga0207705_10022525 3300025909 Bacteria 4492
112 Ga0207684_10054903 3300025910 Bacteria 3380
113 Ga0207654_10020600 3300025911 Bacteria 3498
114 Ga0207657_10007668 3300025919 Bacteria 11041
115 Ga0207694_10082854 3300025924 Bacteria 2521
116 Ga0207650_10050366 3300025925 Bacteria 3079
117 Ga0207650_10070245 3300025925 Bacteria 2632
118 Ga0207650_10077522 3300025925 Bacteria 2513
119 Ga0207650_10105824 3300025925 Bacteria 2172
120 Ga0207659_10008474 3300025926 Bacteria 6384
121 Ga0207644_10054434 3300025931 Bacteria 2882
122 Ga0207706_10027520 3300025933 Bacteria 5083
123 Ga0207706_10195710 3300025933 Bacteria 1773
124 Ga0207686_10001396 3300025934 Bacteria 13734
125 Ga0207669_10031030 3300025937 Bacteria 2980
126 Ga0207704_10008382 3300025938 Bacteria 4939
127 Ga0207704_10017473 3300025938 Bacteria 3720
128 Ga0207704_10069450 3300025938 Bacteria 2226
129 Ga0207691_10000244 3300025940 Bacteria 53634
130 Ga0207691_10017796 3300025940 Bacteria 6737
131 Ga0207691_10029491 3300025940 Bacteria 5132
132 Ga0207691_10279658 3300025940 Bacteria 1436
133 Ga0207711_10048164 3300025941 Bacteria 3646
134 Ga0207689_10010329 3300025942 Bacteria 8041
135 Ga0207679_10010672 3300025945 Bacteria 5922
136 Ga0207651_10003457 3300025960 Bacteria 7762
137 Ga0207668_10125259 3300025972 Bacteria 1952
138 Ga0207658_10007548 3300025986 Bacteria 7407
139 Ga0207677_10006657 3300026023 Bacteria 6343
140 Ga0207703_10001282 3300026035 Bacteria 23304
141 Ga0207703_10046325 3300026035 Bacteria 3501
142 Ga0207678_10060785 3300026067 Bacteria 3249
143 Ga0207678_10073584 3300026067 Bacteria 2928
144 Ga0207708_10060606 3300026075 Bacteria 2888
145 Ga0207641_10013823 3300026088 Bacteria 6620
146 Ga0207641_10027959 3300026088 Bacteria 4658
147 Ga0207641_10088506 3300026088 Bacteria 2704
148 Ga0207648_10000357 3300026089 Bacteria 50390
149 Ga0207648_10000892 3300026089 Bacteria 33688
150 Ga0207648_10010344 3300026089 Bacteria 8848
151 Ga0207648_10010758 3300026089 Bacteria 8645
152 Ga0207648_10010901 3300026089 Bacteria 8590
153 Ga0207675_100099526 3300026118 Bacteria 2738
154 Ga0207675_100197212 3300026118 Bacteria 1933
155 Ga0207683_10000230 3300026121 Bacteria 49516
156 Ga0207683_10004846 3300026121 Bacteria 11587
157 Ga0207683_10016130 3300026121 Bacteria 6358
158 Ga0207683_10186156 3300026121 Bacteria 1884
159 Ga0209995_1005762 3300027471 Bacteria 1991
160 Ga0209983_1006212 3300027665 Bacteria 2460
161 Ga0209974_10001110 3300027876 Bacteria 9529
162 Ga0268266_10039723 3300028379 Bacteria 4008
163 Ga0268266_10114783 3300028379 Bacteria 2390
164 Ga0268264_10105357 3300028381 Bacteria 2459
165 Ga0307515_10000252 3300028794 Bacteria 132500
166 Ga0307515_10003461 3300028794 Bacteria 33183
167 Ga0307515_10048172 3300028794 Bacteria 6451
168 Ga0265330_10001040 3300031235 Bacteria 16791
169 Ga0265332_10000546 3300031238 Bacteria 25445
170 Ga0265331_10001112 3300031250 Bacteria 20696
171 Ga0265327_10006635 3300031251 Bacteria 9195
172 Ga0307509_10001929 3300031507 Bacteria 34257
173 Ga0307509_10008423 3300031507 Bacteria 13161
174 Ga0307509_10135378 3300031507 Bacteria 2410
175 Ga0307408_100012537 3300031548 Bacteria 5619
176 Ga0307508_10000430 3300031616 Bacteria 49980
177 Ga0307508_10002660 3300031616 Bacteria 18747
178 Ga0307413_10011036 3300031824 Bacteria 4418
179 Ga0307410_10005327 3300031852 Bacteria 6793
180 Ga0307406_10002188 3300031901 Bacteria 10639
181 Ga0307407_10000829 3300031903 Bacteria 10271
182 Ga0307412_10015079 3300031911 Bacteria 4572
183 Ga0307412_10127674 3300031911 Bacteria 1842
184 Ga0307409_100008985 3300031995 Bacteria 6108
185 Ga0307416_100015890 3300032002 Bacteria 5214
186 Ga0307414_10008726 3300032004 Bacteria 5776
187 Ga0307411_10004167 3300032005 Bacteria 6872
188 Ga0307507_10104789 3300033179 Bacteria 2345
189 Ga0373931_0033186 3300035691 Bacteria 2674
190 Ga0395905_0042900 3300037471 Bacteria 4244
191 Ga0400490_20818 3300038726 Bacteria 28661
192 Ga0242420_005208 3300038996 Bacteria 2004
193 Ga0400483_007105 3300039062 Bacteria 4299
194 Ga0400483_020454 3300039062 Bacteria 2520
195 Ga0400483_076233 3300039062 Bacteria 12369
196 Ga0400483_125573 3300039062 Bacteria 2529
197 Ga0400483_151320 3300039062 Bacteria 1760
198 Ga0400483_226550 3300039062 Bacteria 20366
199 Ga0400487_03636 3300039110 Bacteria 4637
200 Ga0400487_13295 3300039110 Bacteria 22511
201 Ga0400487_41525 3300039110 Bacteria 1465
202 Ga0451577_0000191 3300042876 Bacteria 128991
203 Ga0451577_0002423 3300042876 Bacteria 22248
204 Ga0466972_0031634 3300044658 Bacteria 2601
205 Ga0453683_0000268 3300044673 Bacteria 68303
206 Ga0453683_0000431 3300044673 Bacteria 47971
207 Ga0453683_0005365 3300044673 Bacteria 8957
208 Ga0453684_0000590 3300044712 Bacteria 134718
209 Ga0453684_0022464 3300044712 Bacteria 9353
210 Ga0453684_0104731 3300044712 Bacteria 3453
211 Ga0453684_0297121 3300044712 Bacteria 1837
212 Ga0495580_0009635 3300046472 Bacteria 7585
213 Ga0496106_0047927 3300048909 Bacteria 3217
214 Ga0496106_0072235 3300048909 Bacteria 2639
215 Ga0496109_0124948 3300048912 Bacteria 2398
216 Ga0496110_0272399 3300048913 Bacteria 1541
217 Ga0496113_0078618 3300048916 Bacteria 2524
218 Ga0496114_0045217 3300048917 Bacteria 3657
219 Ga0496118_0009599 3300048921 Bacteria 9741
220 Ga0496120_0088320 3300048923 Bacteria 1662
221 Ga0501037_0013461 3300049573 Bacteria 6024
222 Ga0501039_0142185 3300049575 Bacteria 1885
223 Ga0501041_0056787 3300049577 Bacteria 2393
224 Ga0501075_0112798 3300049591 Bacteria 2067
225 Ga0501076_0067271 3300049592 Bacteria 2861
226 Ga0501076_0119661 3300049592 Bacteria 2132
227 Ga0501077_0049682 3300049593 Bacteria 2665
228 Ga0501079_0002435 3300049741 Bacteria 13518
229 Ga0501079_0032048 3300049741 Bacteria 4040
230 Ga0501080_0286884 3300049742 Bacteria 1495
231 Ga0501081_0038449 3300049743 Bacteria 3269
232 Ga0501081_0040488 3300049743 Bacteria 3190
233 Ga0501045_0093791 3300049824 Bacteria 2220
234 nmdc:mga00v17_156697_c1 3300050491 Bacteria 1465
235 nmdc:mga0k408_221_c1 3300050493 Bacteria 30239
236 nmdc:mga0k408_29663_c1 3300050493 Bacteria 2119
237 nmdc:mga06z11_19146_c1 3300050494 Bacteria 3142
238 nmdc:mga04h51_16286_c1 3300050495 Bacteria 2156
239 nmdc:mga09592_788_c1 3300050508 Bacteria 24540
240 nmdc:mga06r32_250260_c1 3300050510 Bacteria 1759
241 Ga0500644_0001088 3300053088 Bacteria 8020
242 Ga0500594_0000753 3300053118 Bacteria 6893
243 Ga0500594_0009995 3300053118 Bacteria 2194
244 Ga0500622_0001145 3300053156 Bacteria 22070
245 Ga0501084_0001539 3300054114 Bacteria 18342
246 Ga0501082_0071239 3300060353 Bacteria 2993
247 Ga0501082_0081980 3300060353 Bacteria 2783
248 Ga0530510_0000095 3300061734 Bacteria 48147
249 Ga0530510_0062109 3300061734 Bacteria 2705
250 2510840193 2510461069 Bacteria 5505000
251 2602012375 2600255389 Bacteria 5275336
252 2643810286 2643221558 Bacteria 5460675
253 2644297193 2643221653 Bacteria 4569637
254 2644655446 2643221719 Bacteria 4568197
255 2819242886 2818991272 Bacteria 4622173
256 2840881981 2840878972 Bacteria 5483153
257 2937844268 2937843397 Bacteria 5256375
258 2989777835 2989776772 Bacteria 4843317
259 8005246939 8005246636 Bacteria 4933972
260 8005662240 8005658619 Bacteria 4500593
261 8018151916 8018150411 Bacteria 5549903
262 8057531897 8057529695 Bacteria 6306553
263 Ga0070668_100003539
264 Ga0065165_1000209
265 Ga0070676_10000957
266 Ga0070670_100002352
267 Ga0068869_100000275
268 Ga0068869_100008929
269 Ga0070666_10006082
270 Ga0070680_100230897
271 Ga0068868_100010948
272 Ga0070660_100037011
273 Ga0070689_100041220
274 Ga0070689_100045167
275 Ga0070668_100001319
276 Ga0070669_100071090
277 Ga0070669_100145948
278 Ga0070675_100020066
279 Ga0070675_100135761
280 Ga0070671_100069687
281 Ga0070674_100058314
282 Ga0070674_100084371
283 Ga0070674_100135903
284 Ga0070673_100020806
285 Ga0070673_100040183
286 Ga0070673_100087691
287 Ga0070667_100008685
288 Ga0070708_100000163
289 Ga0070678_100021926
290 Ga0068867_100005069
291 Ga0068867_100009131
292 Ga0068867_100027274
293 Ga0068867_100057923
294 Ga0068867_100071885
295 Ga0070679_100004252
296 Ga0070696_100027590
297 Ga0070665_100004494
298 Ga0070665_100021324
299 Ga0068855_100022967
300 Ga0068856_100301139
301 Ga0068859_100010984
302 Ga0068859_100040764
303 Ga0068864_100010705
304 Ga0068861_100002523
305 Ga0068861_100107431
306 Ga0068863_100007355
307 Ga0068863_100020210
308 Ga0068863_100026618
309 Ga0068863_100135066
310 Ga0068858_100002684
311 Ga0068858_100031190
312 Ga0068860_100014690
313 Ga0068860_100021649
314 Ga0075365_10042308
315 Ga0075368_10003128
316 Ga0075369_10002379
317 Ga0075366_10005737
318 Ga0075366_10010316
319 Ga0097621_100003113
320 Ga0097621_100182014
321 Ga0097621_100310499
322 Ga0075370_10056429
323 Ga0068871_100005984
324 Ga0068871_100018259
325 Ga0068871_100182674
326 Ga0068871_100244682
327 Ga0075430_100170166
328 Ga0075431_100108197
329 Ga0075429_100002615
330 Ga0068865_100028896
331 Ga0068865_100067289
332 Ga0097620_100010983
333 Ga0097620_100040764
334 Ga0105251_10041844
335 Ga0105240_10010584
336 Ga0105247_10085071
337 Ga0105243_10011574
338 Ga0105243_10091602
339 Ga0105243_10206939
340 Ga0105241_10015890
341 Ga0105242_10001133
342 Ga0105248_10008483
343 Ga0105248_10017075
344 Ga0105248_10176269
345 Ga0105238_10296677
346 Ga0105249_10078702
347 Ga0157374_10009791
348 Ga0157378_10014895
349 Ga0157378_10018060
350 Ga0157378_10094810
351 Ga0163162_10011958
352 Ga0163162_10015879
353 Ga0163162_10030341
354 Ga0163162_10156092
355 Ga0157375_10011070
356 Ga0163163_10181587
357 Ga0163163_10385493
358 Ga0157380_10009947
359 Ga0157380_10138110
360 Ga0157379_10014223
361 Ga0157379_10147715
362 Ga0157376_10004168
363 Ga0157376_10018307
364 Ga0163161_10018277
365 Ga0209130_1000902
366 Ga0209025_1005483
367 Ga0207697_10005366
368 Ga0207688_10019830
369 Ga0207645_10000829
370 Ga0207645_10016433
371 Ga0207645_10036312
372 Ga0207643_10013756
373 Ga0207705_10022525
374 Ga0207684_10054903
375 Ga0207654_10020600
376 Ga0207657_10007668
377 Ga0207694_10082854
378 Ga0207650_10050366
379 Ga0207650_10070245
380 Ga0207650_10077522
381 Ga0207650_10105824
382 Ga0207659_10008474
383 Ga0207644_10054434
384 Ga0207706_10027520
385 Ga0207706_10195710
386 Ga0207686_10001396
387 Ga0207669_10031030
388 Ga0207704_10008382
389 Ga0207704_10017473
390 Ga0207704_10069450
391 Ga0207691_10000244
392 Ga0207691_10017796
393 Ga0207691_10029491
394 Ga0207691_10279658
395 Ga0207711_10048164
396 Ga0207689_10010329
397 Ga0207679_10010672
398 Ga0207651_10003457
399 Ga0207668_10125259
400 Ga0207658_10007548
401 Ga0207677_10006657
402 Ga0207703_10001282
403 Ga0207703_10046325
404 Ga0207678_10060785
405 Ga0207678_10073584
406 Ga0207708_10060606
407 Ga0207641_10013823
408 Ga0207641_10027959
409 Ga0207641_10088506
410 Ga0207648_10000357
411 Ga0207648_10000892
412 Ga0207648_10010344
413 Ga0207648_10010758
414 Ga0207648_10010901
415 Ga0207675_100099526
416 Ga0207675_100197212
417 Ga0207683_10000230
418 Ga0207683_10004846
419 Ga0207683_10016130
420 Ga0207683_10186156
421 Ga0209995_1005762
422 Ga0209983_1006212
423 Ga0209974_10001110
424 Ga0268266_10039723
425 Ga0268266_10114783
426 Ga0268264_10105357
427 Ga0307515_10000252
428 Ga0307515_10003461
429 Ga0307515_10048172
430 Ga0265330_10001040
431 Ga0265332_10000546
432 Ga0265331_10001112
433 Ga0265327_10006635
434 Ga0307509_10001929
435 Ga0307509_10008423
436 Ga0307509_10135378
437 Ga0307408_100012537
438 Ga0307508_10000430
439 Ga0307508_10002660
440 Ga0307413_10011036
441 Ga0307410_10005327
442 Ga0307406_10002188
443 Ga0307407_10000829
444 Ga0307412_10015079
445 Ga0307412_10127674
446 Ga0307409_100008985
447 Ga0307416_100015890
448 Ga0307414_10008726
449 Ga0307411_10004167
450 Ga0307507_10104789
451 Ga0373931_0033186
452 Ga0395905_0042900
453 Ga0400490_20818
454 Ga0242420_005208
455 Ga0400483_007105
456 Ga0400483_020454
457 Ga0400483_076233
458 Ga0400483_125573
459 Ga0400483_151320
460 Ga0400483_226550
461 Ga0400487_03636
462 Ga0400487_13295
463 Ga0400487_41525
464 Ga0451577_0000191
465 Ga0451577_0002423
466 Ga0466972_0031634
467 Ga0453683_0000268
468 Ga0453683_0000431
469 Ga0453683_0005365
470 Ga0453684_0000590
471 Ga0453684_0022464
472 Ga0453684_0104731
473 Ga0453684_0297121
474 Ga0495580_0009635
475 Ga0496106_0047927
476 Ga0496106_0072235
477 Ga0496109_0124948
478 Ga0496110_0272399
479 Ga0496113_0078618
480 Ga0496114_0045217
481 Ga0496118_0009599
482 Ga0496120_0088320
483 Ga0501037_0013461
484 Ga0501039_0142185
485 Ga0501041_0056787
486 Ga0501075_0112798
487 Ga0501076_0067271
488 Ga0501076_0119661
489 Ga0501077_0049682
490 Ga0501079_0002435
491 Ga0501079_0032048
492 Ga0501080_0286884
493 Ga0501081_0038449
494 Ga0501081_0040488
495 Ga0501045_0093791
496 nmdc:mga00v17_156697_c1
497 nmdc:mga0k408_221_c1
498 nmdc:mga0k408_29663_c1
499 nmdc:mga06z11_19146_c1
500 nmdc:mga04h51_16286_c1
501 nmdc:mga09592_788_c1
502 nmdc:mga06r32_250260_c1
503 Ga0500644_0001088
504 Ga0500594_0000753
505 Ga0500594_0009995
506 Ga0500622_0001145
507 Ga0501084_0001539
508 Ga0501082_0071239
509 Ga0501082_0081980
510 Ga0530510_0000095
511 Ga0530510_0062109
512 2510840193
513 2602012375
514 2643810286
515 2644297193
516 2644655446
517 2819242886
518 2840881981
519 2937844268
520 2989777835
521 8005246939
522 8005662240
523 8018151916
524 8057531897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06808

DctM

Tripartite ATP-independent periplasmic transporter, DctM component

28

449

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.9207 8 437
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.901 5 441
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8981 8 437
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.8607 5 441
4r0c-assembly1.cif.gz_D crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.6943 51 428
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.732 5 428 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7258 5 428 1.20.1530.20
af_Q57875_1_175_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3214 67 263 1.20.1250.20
af_K7TLJ8_13_211_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3183 66 265 1.20.1080.10
af_Q2FVZ5_891_1052_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.2962 119 305 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A1H6NP75-F1-model_v4 TRAP transporter large permease protein 0.988 1 440 GO:0005886
GO:0022857
AF-A0A4S4IQK3-F1-model_v4 deleted 0.9867 109 439
AF-A0A0P7XU31-F1-model_v4 TRAP transporter large permease protein 0.9856 2 441 GO:0005886
GO:0022857
AF-A0A536ZTQ4-F1-model_v4 TRAP transporter large permease subunit 0.9854 2 437 GO:0005886
GO:0022857
AF-A0A7R7H3T4-F1-model_v4 deleted 0.9847 1 440

Map