F370494

General Info

Members Datasets Scaffolds Average Seq Length
261 176 522 259

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1304344|Ga0436365_1304344_1941_2849
Length 302
Sequence VARLAADQDRGGGIISVMVGCSGRFDIARRSGPWLSQLMDTAALFSLAGRTALVTGASRGLGRAIALGLADAGADLILAARDEAKLAAVRDEVAGRGRAARVVAFELGDAEAVQRSCQALLDAGAQVDILVNNGAISDWADLEGTSPEKWRHMFEVNVTSMYLMCRAFAPSMQRRRWGRVVNFGSYVSKTGRPNLSAYVASKHAVLGLTRAVAAELAPYGATCNAVAPGFFDTDMAAPTVGHPQRAKIFRDAIAMGRFGDPAEIVGPVLFLASPAGSYVTGQMLHVDGGVDGVLSLPVVVES

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
159 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
173 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
174 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 17.24
Rhizosphere 74.33
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1304344 3300039437 Bacteria 4086
2 JGI24736J21556_1009215 3300001904 Bacteria 1631
3 JGI24741J21665_1001107 3300001915 Bacteria 8003
4 JGI24741J21665_1010776 3300001915 Bacteria 1621
5 JGI24740J21852_10000869 3300001979 Bacteria 13353
6 JGI24740J21852_10000880 3300001979 Bacteria 13278
7 JGI24740J21852_10025118 3300001979 Bacteria 2012
8 JGI24739J22299_10000072 3300001989 Bacteria 28565
9 JGI24739J22299_10000756 3300001989 Bacteria 11770
10 JGI24739J22299_10001923 3300001989 Bacteria 7941
11 JGI24737J22298_10008077 3300001990 Bacteria 3537
12 JGI24735J21928_10000336 3300002067 Bacteria 16348
13 JGI24735J21928_10005235 3300002067 Bacteria 4308
14 JGI24738J21930_10001691 3300002075 Bacteria 6032
15 JGI24738J21930_10002294 3300002075 Bacteria 5053
16 rootL2_10085574 3300003322 Bacteria 1944
17 Ga0070658_10063991 3300005327 Bacteria 3000
18 Ga0070676_10368073 3300005328 Bacteria 992
19 Ga0070683_100098343 3300005329 Bacteria 2754
20 Ga0070683_100647224 3300005329 Bacteria 1012
21 Ga0070660_100014017 3300005339 Bacteria 5770
22 Ga0070661_100040900 3300005344 Bacteria 3382
23 Ga0070661_100084537 3300005344 Bacteria 2344
24 Ga0070659_100004433 3300005366 Bacteria 10029
25 Ga0070659_100304594 3300005366 Bacteria 1329
26 Ga0070710_10019813 3300005437 Bacteria 3483
27 Ga0070708_100181720 3300005445 Bacteria 1966
28 Ga0070663_100008216 3300005455 Bacteria 6409
29 Ga0070662_100102302 3300005457 Bacteria 2170
30 Ga0070698_100802591 3300005471 Bacteria 885
31 Ga0070684_100100395 3300005535 Bacteria 2584
32 Ga0068853_100313261 3300005539 Bacteria 1453
33 Ga0070695_100092398 3300005545 Bacteria 2023
34 Ga0070665_100271425 3300005548 Bacteria 1698
35 Ga0068855_100200649 3300005563 Bacteria 2245
36 Ga0070664_100467472 3300005564 Bacteria 1159
37 Ga0068857_100050855 3300005577 Bacteria 3675
38 Ga0068857_100410988 3300005577 Bacteria 1260
39 Ga0068854_100184617 3300005578 Bacteria 1631
40 Ga0068854_100380103 3300005578 Bacteria 1163
41 Ga0068856_100309170 3300005614 Bacteria 1598
42 Ga0070702_100289661 3300005615 Bacteria 1128
43 Ga0068852_100166217 3300005616 Bacteria 2064
44 Ga0068852_100198361 3300005616 Bacteria 1898
45 Ga0068859_100000442 3300005617 Bacteria 41408
46 Ga0068861_100000063 3300005719 Bacteria 51048
47 Ga0068851_10004226 3300005834 Bacteria 6463
48 Ga0081539_10010755 3300005985 Bacteria 7370
49 Ga0070717_10092437 3300006028 Bacteria 2556
50 Ga0075364_10054523 3300006051 Bacteria 2615
51 Ga0070716_100031415 3300006173 Bacteria 2888
52 Ga0070712_100096370 3300006175 Bacteria 2178
53 Ga0075434_100152074 3300006871 Bacteria 2335
54 Ga0097620_100000442 3300006931 Bacteria 41408
55 Ga0111539_11089792 3300009094 Bacteria 928
56 Ga0105247_10161834 3300009101 Bacteria 1482
57 Ga0105243_10303110 3300009148 Bacteria 1449
58 Ga0105243_10405334 3300009148 Bacteria 1268
59 Ga0105241_10168230 3300009174 Bacteria 1808
60 Ga0105242_10081546 3300009176 Bacteria 2705
61 Ga0105248_10000785 3300009177 Bacteria 35691
62 Ga0105237_10036153 3300009545 Bacteria 4997
63 Ga0105238_10009012 3300009551 Bacteria 9982
64 Ga0105239_10093686 3300010375 Bacteria 3317
65 Ga0105239_10189387 3300010375 Bacteria 2303
66 Ga0157373_10067678 3300013100 Bacteria 2525
67 Ga0157373_10082871 3300013100 Bacteria 2260
68 Ga0157371_10022884 3300013102 Bacteria 4571
69 Ga0157370_10027149 3300013104 Bacteria 5646
70 Ga0157369_10134972 3300013105 Bacteria 2613
71 Ga0163162_10031723 3300013306 Bacteria 5242
72 Ga0157372_10049497 3300013307 Bacteria 4672
73 Ga0163163_10171772 3300014325 Bacteria 2214
74 Ga0157379_10252698 3300014968 Bacteria 1600
75 Ga0157379_10716627 3300014968 Bacteria 940
76 Ga0213872_10002344 3300021361 Bacteria 11249
77 Ga0213876_10027520 3300021384 Bacteria 2999
78 Ga0213875_10001624 3300021388 Bacteria 14199
79 Ga0207656_10004476 3300025321 Bacteria 4885
80 Ga0207656_10007189 3300025321 Bacteria 4045
81 Ga0207647_10000444 3300025904 Bacteria 33672
82 Ga0207647_10005073 3300025904 Bacteria 9711
83 Ga0207647_10091306 3300025904 Bacteria 1816
84 Ga0207647_10207700 3300025904 Bacteria 1132
85 Ga0207699_10374645 3300025906 Bacteria 1009
86 Ga0207654_10003035 3300025911 Bacteria 8513
87 Ga0207654_10052238 3300025911 Bacteria 2355
88 Ga0207707_10150888 3300025912 Bacteria 2032
89 Ga0207695_10006524 3300025913 Bacteria 15103
90 Ga0207671_10000457 3300025914 Bacteria 56223
91 Ga0207693_10072639 3300025915 Bacteria 2693
92 Ga0207657_10003706 3300025919 Bacteria 16240
93 Ga0207657_10004282 3300025919 Bacteria 15122
94 Ga0207649_10149438 3300025920 Bacteria 1607
95 Ga0207694_10001522 3300025924 Bacteria 19764
96 Ga0207694_10009721 3300025924 Bacteria 7255
97 Ga0207687_10039670 3300025927 Bacteria 3225
98 Ga0207700_10411043 3300025928 Bacteria 1187
99 Ga0207706_10015261 3300025933 Bacteria 6948
100 Ga0207706_10037796 3300025933 Bacteria 4285
101 Ga0207706_10043719 3300025933 Bacteria 3969
102 Ga0207686_10155727 3300025934 Bacteria 1596
103 Ga0207709_10294602 3300025935 Bacteria 1204
104 Ga0207711_10000571 3300025941 Bacteria 37524
105 Ga0207667_10005837 3300025949 Bacteria 14993
106 Ga0207667_10550155 3300025949 Bacteria 1167
107 Ga0207640_10020454 3300025981 Bacteria 3930
108 Ga0207640_10109826 3300025981 Bacteria 1952
109 Ga0207640_10133340 3300025981 Bacteria 1799
110 Ga0207639_10027031 3300026041 Bacteria 4175
111 Ga0207639_10038127 3300026041 Bacteria 3573
112 Ga0207639_10040726 3300026041 Bacteria 3469
113 Ga0207678_10000182 3300026067 Bacteria 53798
114 Ga0207678_10001373 3300026067 Bacteria 22432
115 Ga0207702_10001947 3300026078 Bacteria 20131
116 Ga0207702_10115762 3300026078 Bacteria 2391
117 Ga0207648_10441070 3300026089 Bacteria 1184
118 Ga0207674_10005499 3300026116 Bacteria 15042
119 Ga0207674_10073043 3300026116 Bacteria 3445
120 Ga0207675_100000380 3300026118 Bacteria 42566
121 Ga0207683_10407462 3300026121 Bacteria 1251
122 Ga0207698_10040297 3300026142 Bacteria 3469
123 Ga0207698_10146024 3300026142 Bacteria 2046
124 Ga0268266_10205769 3300028379 Bacteria 1803
125 Ga0268266_10278018 3300028379 Bacteria 1556
126 Ga0268266_10334025 3300028379 Bacteria 1421
127 Ga0307517_10015827 3300028786 Bacteria 9975
128 Ga0265339_10003396 3300031249 Bacteria 11139
129 Ga0265327_10001540 3300031251 Bacteria 28437
130 Ga0265327_10013739 3300031251 Bacteria 5355
131 Ga0265327_10052305 3300031251 Bacteria 2127
132 Ga0307513_10122896 3300031456 Bacteria 2559
133 Ga0307509_10088155 3300031507 Bacteria 3186
134 Ga0307408_100000421 3300031548 Bacteria 38088
135 Ga0316575_10090553 3300031665 Bacteria 1239
136 Ga0316576_10077803 3300031727 Bacteria 2457
137 Ga0307405_10023199 3300031731 Bacteria 3522
138 Ga0307405_10053855 3300031731 Bacteria 2508
139 Ga0307413_10016652 3300031824 Bacteria 3805
140 Ga0307410_10115312 3300031852 Bacteria 1950
141 Ga0307406_10122676 3300031901 Bacteria 1809
142 Ga0307406_10139943 3300031901 Bacteria 1711
143 Ga0307412_10031220 3300031911 Bacteria 3362
144 Ga0307412_10039016 3300031911 Bacteria 3062
145 Ga0307412_10434182 3300031911 Bacteria 1077
146 Ga0307409_100094017 3300031995 Bacteria 2465
147 Ga0307416_100053496 3300032002 Bacteria 3239
148 Ga0307416_100130229 3300032002 Bacteria 2263
149 Ga0307416_100213374 3300032002 Bacteria 1843
150 Ga0316583_10038963 3300032133 Unclassified 1683
151 Ga0316574_0098385 3300035398 Bacteria 1871
152 Ga0373937_0092557 3300036401 Bacteria 2802
153 Ga0316582_0153726 3300036647 Unclassified 1556
154 Ga0395899_0024111 3300037312 Bacteria 4602
155 Ga0395905_0038265 3300037471 Bacteria 4501
156 Ga0436364_0353909 3300037853 Bacteria 90577
157 Ga0395901_0545967 3300038443 Bacteria 1175
158 Ga0436365_0439026 3300039437 Bacteria 2649
159 Ga0436361_0231868 3300039447 Bacteria 59358
160 Ga0466967_0109201 3300045976 Bacteria 2540
161 Ga0495641_0288143 3300046461 Unclassified 740
162 Ga0495651_0056816 3300046462 Bacteria 3005
163 Ga0495653_0026468 3300046463 Bacteria 4651
164 Ga0495608_0020933 3300046511 Bacteria 4493
165 Ga0495608_0344579 3300046511 Bacteria 918
166 Ga0495631_0167456 3300046518 Bacteria 943
167 Ga0495648_0027677 3300046524 Bacteria 3791
168 Ga0495587_0008662 3300046536 Bacteria 6536
169 Ga0495667_0001401 3300046559 Bacteria 15883
170 Ga0495635_0116830 3300046663 Bacteria 1821
171 Ga0495657_0002333 3300046675 Bacteria 15985
172 Ga0495623_0084379 3300046679 Bacteria 1960
173 Ga0495671_0073930 3300046692 Bacteria 1673
174 Ga0495600_0131876 3300046809 Bacteria 1624
175 Ga0495676_0298441 3300047321 Bacteria 1087
176 Ga0495680_0001093 3300047322 Bacteria 30065
177 Ga0495602_0466639 3300048088 Bacteria 888
178 Ga0496100_0037839 3300048903 Bacteria 3053
179 Ga0496101_0002955 3300048904 Bacteria 10459
180 Ga0496101_0035572 3300048904 Bacteria 3523
181 Ga0496102_0003499 3300048905 Bacteria 13317
182 Ga0496102_0011120 3300048905 Bacteria 7752
183 Ga0496102_0022021 3300048905 Bacteria 5645
184 Ga0496103_0009068 3300048906 Bacteria 5891
185 Ga0496103_0084452 3300048906 Bacteria 2000
186 Ga0496104_0002264 3300048907 Bacteria 16590
187 Ga0496104_0014595 3300048907 Bacteria 7096
188 Ga0496105_0004099 3300048908 Bacteria 10921
189 Ga0496105_0057761 3300048908 Unclassified 3203
190 Ga0496105_0204871 3300048908 Bacteria 1609
191 Ga0496105_0214258 3300048908 Bacteria 1569
192 Ga0496106_0060593 3300048909 Bacteria 2869
193 Ga0496106_0081554 3300048909 Bacteria 2485
194 Ga0496107_0006826 3300048910 Bacteria 7863
195 Ga0496107_0023757 3300048910 Bacteria 4333
196 Ga0496107_0187769 3300048910 Bacteria 1535
197 Ga0496108_0181097 3300048911 Bacteria 1825
198 Ga0496109_0014003 3300048912 Bacteria 6972
199 Ga0496109_0023247 3300048912 Bacteria 5499
200 Ga0496109_0049245 3300048912 Bacteria 3835
201 Ga0496109_0159727 3300048912 Bacteria 2112
202 Ga0496110_0001115 3300048913 Bacteria 18942
203 Ga0496110_0005465 3300048913 Bacteria 9968
204 Ga0496110_0135424 3300048913 Bacteria 2226
205 Ga0496110_0168056 3300048913 Bacteria 1989
206 Ga0496110_0978367 3300048913 Bacteria 753
207 Ga0496111_0003391 3300048914 Bacteria 9852
208 Ga0496111_0041885 3300048914 Bacteria 3287
209 Ga0496111_0191475 3300048914 Bacteria 1520
210 Ga0496111_0220528 3300048914 Bacteria 1409
211 Ga0496111_0430982 3300048914 Bacteria 974
212 Ga0496112_0009724 3300048915 Bacteria 8681
213 Ga0496112_0058606 3300048915 Unclassified 3792
214 Ga0496112_0138892 3300048915 Bacteria 2399
215 Ga0496113_0038117 3300048916 Bacteria 3532
216 Ga0496113_0148299 3300048916 Bacteria 1849
217 Ga0496113_0564998 3300048916 Bacteria 912
218 Ga0496114_0008344 3300048917 Bacteria 8208
219 Ga0496114_0012651 3300048917 Bacteria 6760
220 Ga0496114_0149079 3300048917 Bacteria 2029
221 Ga0496115_0052470 3300048918 Bacteria 3271
222 Ga0496115_0106357 3300048918 Bacteria 2303
223 Ga0496121_0002801 3300048924 Bacteria 25834
224 Ga0496125_0002671 3300048928 Bacteria 22776
225 Ga0501032_0159405 3300049569 Bacteria 1482
226 Ga0501033_0000576 3300049570 Bacteria 34166
227 Ga0501034_0006294 3300049571 Bacteria 12774
228 Ga0501034_0010341 3300049571 Bacteria 9725
229 Ga0501034_0451626 3300049571 Bacteria 1203
230 Ga0501037_0030360 3300049573 Bacteria 3995
231 Ga0501046_0013092 3300049580 Bacteria 7042
232 Ga0501047_0206638 3300049581 Bacteria 1823
233 Ga0501069_0034379 3300049585 Bacteria 2792
234 Ga0501070_0009804 3300049586 Bacteria 8102
235 Ga0501070_0105328 3300049586 Bacteria 2332
236 Ga0501071_0331812 3300049587 Bacteria 1156
237 Ga0501223_000095 3300049663 Bacteria 25891
238 Ga0501224_000014 3300049664 Bacteria 91830
239 Ga0501233_000102 3300049668 Bacteria 11473
240 Ga0501235_000356 3300049669 Bacteria 8745
241 Ga0501225_0000027 3300049705 Bacteria 48411
242 Ga0501234_014772 3300049707 Bacteria 1227
243 Ga0501080_0070838 3300049742 Bacteria 3243
244 Ga0501080_0157752 3300049742 Bacteria 2096
245 Ga0501044_0015874 3300049823 Bacteria 8105
246 Ga0501044_0076248 3300049823 Bacteria 3403
247 Ga0501044_0249805 3300049823 Bacteria 1715
248 Ga0501044_0518952 3300049823 Bacteria 1091
249 Ga0501226_000037 3300049853 Bacteria 64584
250 nmdc:mga00v17_45135_c1 3300050491 Bacteria 2661
251 nmdc:mga0yw44_328349_c1 3300050492 Bacteria 1028
252 nmdc:mga0yw44_42783_c1 3300050492 Bacteria 2702
253 nmdc:mga0yw44_463307_c1 3300050492 Bacteria 859
254 nmdc:mga0rr50_253548_c1 3300050513 Bacteria 1462
255 Ga0495619_0010306 3300053085 Bacteria 5882
256 Ga0500566_0000386 3300053094 Bacteria 24416
257 Ga0500562_032358 3300053108 Bacteria 1380
258 Ga0500594_0020818 3300053118 Bacteria 1640
259 Ga0500652_000117 3300053131 Bacteria 30916
260 Ga0500616_0000289 3300053153 Bacteria 73129
261 2644029669 2643221603 Bacteria 6147767
262 Ga0436365_1304344
263 JGI24736J21556_1009215
264 JGI24741J21665_1001107
265 JGI24741J21665_1010776
266 JGI24740J21852_10000869
267 JGI24740J21852_10000880
268 JGI24740J21852_10025118
269 JGI24739J22299_10000072
270 JGI24739J22299_10000756
271 JGI24739J22299_10001923
272 JGI24737J22298_10008077
273 JGI24735J21928_10000336
274 JGI24735J21928_10005235
275 JGI24738J21930_10001691
276 JGI24738J21930_10002294
277 rootL2_10085574
278 Ga0070658_10063991
279 Ga0070676_10368073
280 Ga0070683_100098343
281 Ga0070683_100647224
282 Ga0070660_100014017
283 Ga0070661_100040900
284 Ga0070661_100084537
285 Ga0070659_100004433
286 Ga0070659_100304594
287 Ga0070710_10019813
288 Ga0070708_100181720
289 Ga0070663_100008216
290 Ga0070662_100102302
291 Ga0070698_100802591
292 Ga0070684_100100395
293 Ga0068853_100313261
294 Ga0070695_100092398
295 Ga0070665_100271425
296 Ga0068855_100200649
297 Ga0070664_100467472
298 Ga0068857_100050855
299 Ga0068857_100410988
300 Ga0068854_100184617
301 Ga0068854_100380103
302 Ga0068856_100309170
303 Ga0070702_100289661
304 Ga0068852_100166217
305 Ga0068852_100198361
306 Ga0068859_100000442
307 Ga0068861_100000063
308 Ga0068851_10004226
309 Ga0081539_10010755
310 Ga0070717_10092437
311 Ga0075364_10054523
312 Ga0070716_100031415
313 Ga0070712_100096370
314 Ga0075434_100152074
315 Ga0097620_100000442
316 Ga0111539_11089792
317 Ga0105247_10161834
318 Ga0105243_10303110
319 Ga0105243_10405334
320 Ga0105241_10168230
321 Ga0105242_10081546
322 Ga0105248_10000785
323 Ga0105237_10036153
324 Ga0105238_10009012
325 Ga0105239_10093686
326 Ga0105239_10189387
327 Ga0157373_10067678
328 Ga0157373_10082871
329 Ga0157371_10022884
330 Ga0157370_10027149
331 Ga0157369_10134972
332 Ga0163162_10031723
333 Ga0157372_10049497
334 Ga0163163_10171772
335 Ga0157379_10252698
336 Ga0157379_10716627
337 Ga0213872_10002344
338 Ga0213876_10027520
339 Ga0213875_10001624
340 Ga0207656_10004476
341 Ga0207656_10007189
342 Ga0207647_10000444
343 Ga0207647_10005073
344 Ga0207647_10091306
345 Ga0207647_10207700
346 Ga0207699_10374645
347 Ga0207654_10003035
348 Ga0207654_10052238
349 Ga0207707_10150888
350 Ga0207695_10006524
351 Ga0207671_10000457
352 Ga0207693_10072639
353 Ga0207657_10003706
354 Ga0207657_10004282
355 Ga0207649_10149438
356 Ga0207694_10001522
357 Ga0207694_10009721
358 Ga0207687_10039670
359 Ga0207700_10411043
360 Ga0207706_10015261
361 Ga0207706_10037796
362 Ga0207706_10043719
363 Ga0207686_10155727
364 Ga0207709_10294602
365 Ga0207711_10000571
366 Ga0207667_10005837
367 Ga0207667_10550155
368 Ga0207640_10020454
369 Ga0207640_10109826
370 Ga0207640_10133340
371 Ga0207639_10027031
372 Ga0207639_10038127
373 Ga0207639_10040726
374 Ga0207678_10000182
375 Ga0207678_10001373
376 Ga0207702_10001947
377 Ga0207702_10115762
378 Ga0207648_10441070
379 Ga0207674_10005499
380 Ga0207674_10073043
381 Ga0207675_100000380
382 Ga0207683_10407462
383 Ga0207698_10040297
384 Ga0207698_10146024
385 Ga0268266_10205769
386 Ga0268266_10278018
387 Ga0268266_10334025
388 Ga0307517_10015827
389 Ga0265339_10003396
390 Ga0265327_10001540
391 Ga0265327_10013739
392 Ga0265327_10052305
393 Ga0307513_10122896
394 Ga0307509_10088155
395 Ga0307408_100000421
396 Ga0316575_10090553
397 Ga0316576_10077803
398 Ga0307405_10023199
399 Ga0307405_10053855
400 Ga0307413_10016652
401 Ga0307410_10115312
402 Ga0307406_10122676
403 Ga0307406_10139943
404 Ga0307412_10031220
405 Ga0307412_10039016
406 Ga0307412_10434182
407 Ga0307409_100094017
408 Ga0307416_100053496
409 Ga0307416_100130229
410 Ga0307416_100213374
411 Ga0316583_10038963
412 Ga0316574_0098385
413 Ga0373937_0092557
414 Ga0316582_0153726
415 Ga0395899_0024111
416 Ga0395905_0038265
417 Ga0436364_0353909
418 Ga0395901_0545967
419 Ga0436365_0439026
420 Ga0436361_0231868
421 Ga0466967_0109201
422 Ga0495641_0288143
423 Ga0495651_0056816
424 Ga0495653_0026468
425 Ga0495608_0020933
426 Ga0495608_0344579
427 Ga0495631_0167456
428 Ga0495648_0027677
429 Ga0495587_0008662
430 Ga0495667_0001401
431 Ga0495635_0116830
432 Ga0495657_0002333
433 Ga0495623_0084379
434 Ga0495671_0073930
435 Ga0495600_0131876
436 Ga0495676_0298441
437 Ga0495680_0001093
438 Ga0495602_0466639
439 Ga0496100_0037839
440 Ga0496101_0002955
441 Ga0496101_0035572
442 Ga0496102_0003499
443 Ga0496102_0011120
444 Ga0496102_0022021
445 Ga0496103_0009068
446 Ga0496103_0084452
447 Ga0496104_0002264
448 Ga0496104_0014595
449 Ga0496105_0004099
450 Ga0496105_0057761
451 Ga0496105_0204871
452 Ga0496105_0214258
453 Ga0496106_0060593
454 Ga0496106_0081554
455 Ga0496107_0006826
456 Ga0496107_0023757
457 Ga0496107_0187769
458 Ga0496108_0181097
459 Ga0496109_0014003
460 Ga0496109_0023247
461 Ga0496109_0049245
462 Ga0496109_0159727
463 Ga0496110_0001115
464 Ga0496110_0005465
465 Ga0496110_0135424
466 Ga0496110_0168056
467 Ga0496110_0978367
468 Ga0496111_0003391
469 Ga0496111_0041885
470 Ga0496111_0191475
471 Ga0496111_0220528
472 Ga0496111_0430982
473 Ga0496112_0009724
474 Ga0496112_0058606
475 Ga0496112_0138892
476 Ga0496113_0038117
477 Ga0496113_0148299
478 Ga0496113_0564998
479 Ga0496114_0008344
480 Ga0496114_0012651
481 Ga0496114_0149079
482 Ga0496115_0052470
483 Ga0496115_0106357
484 Ga0496121_0002801
485 Ga0496125_0002671
486 Ga0501032_0159405
487 Ga0501033_0000576
488 Ga0501034_0006294
489 Ga0501034_0010341
490 Ga0501034_0451626
491 Ga0501037_0030360
492 Ga0501046_0013092
493 Ga0501047_0206638
494 Ga0501069_0034379
495 Ga0501070_0009804
496 Ga0501070_0105328
497 Ga0501071_0331812
498 Ga0501223_000095
499 Ga0501224_000014
500 Ga0501233_000102
501 Ga0501235_000356
502 Ga0501225_0000027
503 Ga0501234_014772
504 Ga0501080_0070838
505 Ga0501080_0157752
506 Ga0501044_0015874
507 Ga0501044_0076248
508 Ga0501044_0249805
509 Ga0501044_0518952
510 Ga0501226_000037
511 nmdc:mga00v17_45135_c1
512 nmdc:mga0yw44_328349_c1
513 nmdc:mga0yw44_42783_c1
514 nmdc:mga0yw44_463307_c1
515 nmdc:mga0rr50_253548_c1
516 Ga0495619_0010306
517 Ga0500566_0000386
518 Ga0500562_032358
519 Ga0500594_0020818
520 Ga0500652_000117
521 Ga0500616_0000289
522 2644029669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

50

243

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

56

291

0.95

PF08659

KR

KR domain

50

223

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uf0-assembly1.cif.gz_A crystal structure of a putative nad(p) dependent gluconate 5-dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy) 0.9745 3 250
4ibo-assembly1.cif.gz_C crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target efi-506446) 0.9711 3 254
3enn-assembly1.cif.gz_B 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9663 4 253
3emk-assembly1.cif.gz_B 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9657 5 253
4ag3-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with nadph at 1.8a resolution 0.9649 6 250
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9686 87 250 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9666 4 254 3.40.50.720
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9663 4 253 3.40.50.720
2c07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9639 4 250 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 6 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2T6B3D5-F1-model_v4 Gluconate 5-dehydrogenase 0.9791 2 254 GO:0016491
AF-A0A2V9MMU3-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.976 4 251 GO:0016616
AF-A0A556QDL1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9753 10 251 GO:0004316
GO:0006633
GO:0051287
AF-A0A7Z9LA13-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9747 2 250 GO:0047936
AF-A0A1W9U1H6-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9735 4 240 GO:0016616

Map