F370373

General Info

Members Datasets Scaffolds Average Seq Length
261 194 522 85

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10051652|Ga0213874_100516523
Length 108
Sequence MARRGASGYWTATNPVETLCMTDAADPVTPAADTPPDRLSNNPASPYYDEALLARGVGIRFKGVERNNVDEYCVSEGWVRLSVAGSRDRFGNPITIKQQGEVVPYFRS

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.36
Nodule 0
Rhizoplane 1.53
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10051652 3300021377 Bacteria 1263
2 MBSR1b_contig_10358512 2162886012 Unclassified 801
3 JGI25151J46595_10000285 3300003187 Bacteria 57259
4 rootH2_10021186 3300003320 Bacteria 10889
5 JGI25160J50197_1015272 3300003354 Bacteria 2529
6 Ga0065165_1049311 3300005262 Bacteria 1205
7 Ga0065712_10076074 3300005290 Unclassified 3739
8 Ga0065712_10168840 3300005290 Bacteria 1256
9 Ga0065712_10422809 3300005290 Bacteria 710
10 Ga0065715_10281386 3300005293 Unclassified 1085
11 Ga0070658_10115738 3300005327 Bacteria 2224
12 Ga0070676_10408493 3300005328 Bacteria 946
13 Ga0070670_100000607 3300005331 Bacteria 28114
14 Ga0070666_10000508 3300005335 Bacteria 23489
15 Ga0070680_100090180 3300005336 Bacteria 2537
16 Ga0068868_100622408 3300005338 Bacteria 958
17 Ga0070660_100020746 3300005339 Bacteria 4835
18 Ga0070689_101360396 3300005340 Bacteria 641
19 Ga0070691_10000889 3300005341 Bacteria 12135
20 Ga0070687_100030800 3300005343 Bacteria 2625
21 Ga0070687_100822696 3300005343 Bacteria 660
22 Ga0070661_100000266 3300005344 Bacteria 42513
23 Ga0070668_100186176 3300005347 Bacteria 1698
24 Ga0070669_101025599 3300005353 Unclassified 708
25 Ga0070675_100185806 3300005354 Bacteria 1798
26 Ga0070671_100000981 3300005355 Bacteria 20933
27 Ga0070671_100008162 3300005355 Bacteria 8381
28 Ga0070674_100264323 3300005356 Bacteria 1357
29 Ga0070673_100417674 3300005364 Bacteria 1202
30 Ga0070673_100544274 3300005364 Bacteria 1054
31 Ga0070673_100898389 3300005364 Bacteria 821
32 Ga0070688_100147166 3300005365 Bacteria 1606
33 Ga0070667_100004546 3300005367 Bacteria 11673
34 Ga0070714_100061781 3300005435 Bacteria 3218
35 Ga0070713_101480074 3300005436 Bacteria 659
36 Ga0070700_100931578 3300005441 Bacteria 709
37 Ga0070678_100333868 3300005456 Bacteria 1298
38 Ga0070678_100349574 3300005456 Bacteria 1271
39 Ga0070681_10000961 3300005458 Bacteria 24296
40 Ga0070685_10002622 3300005466 Bacteria 9214
41 Ga0070685_10082854 3300005466 Bacteria 1926
42 Ga0070679_100125500 3300005530 Bacteria 2549
43 Ga0068853_100337712 3300005539 Bacteria 1399
44 Ga0070672_100258829 3300005543 Bacteria 1467
45 Ga0070686_100006490 3300005544 Bacteria 6505
46 Ga0068855_100178968 3300005563 Bacteria 2398
47 Ga0070664_100000461 3300005564 Bacteria 30877
48 Ga0070702_100510270 3300005615 Bacteria 885
49 Ga0068852_101208270 3300005616 Bacteria 777
50 Ga0068859_100348062 3300005617 Bacteria 1577
51 Ga0068859_102520771 3300005617 Bacteria 566
52 Ga0068864_100039617 3300005618 Bacteria 4027
53 Ga0068864_100040035 3300005618 Bacteria 4008
54 Ga0068851_10381216 3300005834 Bacteria 826
55 Ga0068870_10186968 3300005840 Bacteria 1247
56 Ga0068863_100000012 3300005841 Bacteria 229774
57 Ga0068863_100001867 3300005841 Bacteria 20957
58 Ga0068863_100017659 3300005841 Bacteria 6832
59 Ga0068863_100219443 3300005841 Bacteria 1832
60 Ga0068858_100516772 3300005842 Bacteria 1154
61 Ga0068858_102078730 3300005842 Bacteria 562
62 Ga0068860_100353035 3300005843 Bacteria 1447
63 Ga0068862_100894201 3300005844 Bacteria 873
64 Ga0068862_102773890 3300005844 Bacteria 501
65 Ga0075365_10140620 3300006038 Bacteria 1676
66 Ga0075369_10028203 3300006186 Bacteria 2352
67 Ga0075369_10407143 3300006186 Bacteria 641
68 Ga0097621_100058494 3300006237 Bacteria 3153
69 Ga0097621_100204213 3300006237 Bacteria 1717
70 Ga0097621_101663069 3300006237 Bacteria 608
71 Ga0097621_102025807 3300006237 Bacteria 550
72 Ga0068871_100025597 3300006358 Bacteria 4594
73 Ga0068865_101155169 3300006881 Bacteria 684
74 Ga0068865_102205298 3300006881 Unclassified 501
75 Ga0097620_100348047 3300006931 Bacteria 1577
76 Ga0097620_102521797 3300006931 Bacteria 566
77 Ga0105240_10095567 3300009093 Bacteria 3623
78 Ga0111539_10679364 3300009094 Bacteria 1199
79 Ga0111539_10891213 3300009094 Bacteria 1035
80 Ga0105245_10503102 3300009098 Bacteria 1228
81 Ga0105245_12990295 3300009098 Bacteria 524
82 Ga0114129_12924877 3300009147 Bacteria 564
83 Ga0105243_10129084 3300009148 Bacteria 2142
84 Ga0105248_10021031 3300009177 Bacteria 7230
85 Ga0105248_10344939 3300009177 Bacteria 1676
86 Ga0105249_10025216 3300009553 Bacteria 5350
87 Ga0105035_115431 3300009988 Bacteria 701
88 Ga0105239_10507901 3300010375 Bacteria 1371
89 Ga0105239_10952346 3300010375 Bacteria 986
90 Ga0105246_10395497 3300011119 Bacteria 1146
91 Ga0157373_11496701 3300013100 Bacteria 515
92 Ga0157370_10474640 3300013104 Bacteria 1149
93 Ga0157374_10025190 3300013296 Bacteria 5338
94 Ga0157378_10280370 3300013297 Bacteria 1606
95 Ga0157378_10759151 3300013297 Bacteria 993
96 Ga0163162_10000474 3300013306 Bacteria 37169
97 Ga0163162_11350565 3300013306 Bacteria 810
98 Ga0163162_11783189 3300013306 Bacteria 703
99 Ga0157372_10401675 3300013307 Bacteria 1597
100 Ga0157375_10029957 3300013308 Bacteria 5125
101 Ga0157375_11003502 3300013308 Unclassified 974
102 Ga0157375_11388572 3300013308 Bacteria 827
103 Ga0163163_10011792 3300014325 Bacteria 7945
104 Ga0163163_10212571 3300014325 Bacteria 1983
105 Ga0163163_10372938 3300014325 Bacteria 1484
106 Ga0163163_12342718 3300014325 Bacteria 593
107 Ga0157379_10525987 3300014968 Bacteria 1098
108 Ga0157376_10319368 3300014969 Bacteria 1476
109 Ga0157376_12641898 3300014969 Bacteria 542
110 Ga0213872_10133990 3300021361 Bacteria 1090
111 Ga0213876_10373922 3300021384 Bacteria 758
112 Ga0209130_1000263 3300025284 Bacteria 65894
113 Ga0209025_1000114 3300025294 Bacteria 218921
114 Ga0209758_1005459 3300025297 Bacteria 9774
115 Ga0207426_1000436 3300025302 Bacteria 67619
116 Ga0207645_10648383 3300025907 Unclassified 717
117 Ga0207705_10000461 3300025909 Bacteria 34817
118 Ga0207707_10002225 3300025912 Bacteria 17523
119 Ga0207707_10076819 3300025912 Bacteria 2914
120 Ga0207695_10147285 3300025913 Bacteria 2297
121 Ga0207660_10000617 3300025917 Bacteria 24010
122 Ga0207662_10039144 3300025918 Bacteria 2780
123 Ga0207657_10003947 3300025919 Bacteria 15749
124 Ga0207649_10000031 3300025920 Bacteria 146217
125 Ga0207652_10017908 3300025921 Bacteria 5805
126 Ga0207652_10099642 3300025921 Bacteria 2564
127 Ga0207681_10155913 3300025923 Unclassified 1716
128 Ga0207694_10176139 3300025924 Bacteria 1733
129 Ga0207650_10327473 3300025925 Bacteria 1256
130 Ga0207650_10351511 3300025925 Bacteria 1212
131 Ga0207659_10463085 3300025926 Bacteria 1069
132 Ga0207659_11230152 3300025926 Bacteria 643
133 Ga0207700_11635628 3300025928 Bacteria 569
134 Ga0207664_10007745 3300025929 Bacteria 7456
135 Ga0207644_10000118 3300025931 Bacteria 58554
136 Ga0207669_10275648 3300025937 Unclassified 1266
137 Ga0207691_11423198 3300025940 Bacteria 569
138 Ga0207711_12125082 3300025941 Bacteria 504
139 Ga0207667_10299346 3300025949 Bacteria 1643
140 Ga0207651_10376680 3300025960 Bacteria 1202
141 Ga0207651_11739444 3300025960 Unclassified 561
142 Ga0207668_11405137 3300025972 Bacteria 629
143 Ga0207703_10066776 3300026035 Bacteria 2959
144 Ga0207678_10010779 3300026067 Bacteria 8031
145 Ga0207708_10992325 3300026075 Bacteria 729
146 Ga0207702_10419061 3300026078 Bacteria 1294
147 Ga0207641_10000024 3300026088 Bacteria 250751
148 Ga0207641_10456584 3300026088 Bacteria 1235
149 Ga0207676_10012153 3300026095 Bacteria 6163
150 Ga0207674_10057360 3300026116 Bacteria 3947
151 Ga0209969_1013039 3300027360 Bacteria 1202
152 Ga0210002_1020126 3300027617 Bacteria 1074
153 Ga0209983_1000498 3300027665 Bacteria 8462
154 Ga0209971_1002655 3300027682 Bacteria 4279
155 Ga0209974_10010276 3300027876 Bacteria 3160
156 Ga0209974_10071363 3300027876 Bacteria 1185
157 Ga0268265_10148701 3300028380 Bacteria 1972
158 Ga0268265_11001313 3300028380 Bacteria 825
159 Ga0268264_10108963 3300028381 Bacteria 2422
160 Ga0268264_11403345 3300028381 Bacteria 709
161 Ga0265338_10031863 3300028800 Bacteria 5159
162 Ga0265339_10465281 3300031249 Bacteria 586
163 Ga0265331_10000037 3300031250 Bacteria 197251
164 Ga0265331_10156391 3300031250 Bacteria 1034
165 Ga0265327_10000481 3300031251 Bacteria 70259
166 Ga0307408_100009458 3300031548 Bacteria 6430
167 Ga0265314_10011158 3300031711 Bacteria 7445
168 Ga0265314_10013854 3300031711 Bacteria 6491
169 Ga0265314_10313540 3300031711 Bacteria 875
170 Ga0307405_10038915 3300031731 Bacteria 2870
171 Ga0307413_10770017 3300031824 Bacteria 806
172 Ga0307413_12028804 3300031824 Bacteria 519
173 Ga0307410_11600035 3300031852 Bacteria 576
174 Ga0307406_10028397 3300031901 Bacteria 3380
175 Ga0307406_10542494 3300031901 Bacteria 950
176 Ga0307412_11539485 3300031911 Bacteria 606
177 Ga0307409_100279928 3300031995 Bacteria 1541
178 Ga0307409_100533345 3300031995 Bacteria 1149
179 Ga0307409_101674894 3300031995 Bacteria 665
180 Ga0307416_100480304 3300032002 Bacteria 1302
181 Ga0307414_10105394 3300032004 Bacteria 2132
182 Ga0307414_10375768 3300032004 Bacteria 1227
183 Ga0307411_10070582 3300032005 Bacteria 2364
184 Ga0307411_11501232 3300032005 Bacteria 619
185 Ga0307415_100055842 3300032126 Bacteria 2704
186 Ga0373955_0945147 3300035172 Bacteria 531
187 Ga0373935_1144555 3300035692 Bacteria 579
188 Ga0373933_0497168 3300035724 Bacteria 799
189 Ga0373937_2017094 3300036401 Bacteria 523
190 Ga0436365_1599161 3300039437 Bacteria 1650
191 Ga0436361_0014585 3300039447 Bacteria 905
192 Ga0436361_0057517 3300039447 Bacteria 5185
193 Ga0436361_0068404 3300039447 Bacteria 824
194 Ga0436363_1012460 3300039450 Bacteria 2006
195 Ga0451800_1281408 3300041459 Bacteria 550
196 Ga0451807_0431709 3300041486 Bacteria 558
197 Ga0450907_027620 3300042146 Bacteria 962
198 Ga0439435_0253578 3300042436 Bacteria 593
199 Ga0451576_0001556 3300045051 Bacteria 38648
200 Ga0451576_0182661 3300045051 Bacteria 2190
201 Ga0495592_0345247 3300046454 Bacteria 956
202 Ga0495603_0349757 3300046455 Bacteria 848
203 Ga0495639_0124894 3300046475 Bacteria 1229
204 Ga0495610_0174881 3300046512 Bacteria 897
205 Ga0495663_0113703 3300046525 Bacteria 901
206 Ga0495586_0151259 3300046535 Bacteria 1306
207 Ga0495621_0238584 3300046539 Unclassified 740
208 Ga0495656_0606183 3300046615 Bacteria 586
209 Ga0495668_0038024 3300046616 Bacteria 2691
210 Ga0495634_0654287 3300046642 Bacteria 607
211 Ga0495659_0390066 3300046664 Bacteria 600
212 Ga0495647_0130156 3300046681 Bacteria 1066
213 Ga0495658_0868304 3300046683 Bacteria 577
214 Ga0495636_0223259 3300047318 Bacteria 865
215 Ga0495672_0036527 3300047320 Bacteria 3016
216 Ga0495683_0292502 3300047323 Bacteria 702
217 Ga0495675_0304054 3300047444 Bacteria 947
218 Ga0495684_0122592 3300047471 Bacteria 1957
219 Ga0496109_1618666 3300048912 Bacteria 582
220 Ga0496110_0027918 3300048913 Bacteria 4842
221 Ga0495682_0126649 3300049460 Bacteria 914
222 Ga0501032_0257784 3300049569 Bacteria 1131
223 Ga0501033_0226311 3300049570 Bacteria 1330
224 Ga0501033_0330973 3300049570 Bacteria 1069
225 Ga0501033_0594342 3300049570 Bacteria 759
226 Ga0501034_0420393 3300049571 Bacteria 1258
227 Ga0501036_0191421 3300049572 Bacteria 1721
228 Ga0501037_0006947 3300049573 Bacteria 8271
229 Ga0501037_0522731 3300049573 Bacteria 803
230 Ga0501038_0036153 3300049574 Bacteria 4335
231 Ga0501038_0051869 3300049574 Bacteria 3538
232 Ga0501039_0463552 3300049575 Bacteria 995
233 Ga0501042_0541417 3300049578 Bacteria 846
234 Ga0501043_0211687 3300049579 Bacteria 1502
235 Ga0501046_1281224 3300049580 Bacteria 501
236 Ga0501047_0392346 3300049581 Bacteria 1221
237 Ga0501047_0462746 3300049581 Bacteria 1097
238 Ga0501069_0104524 3300049585 Bacteria 1609
239 Ga0501069_0971805 3300049585 Bacteria 518
240 Ga0501070_0000185 3300049586 Bacteria 58378
241 Ga0501070_0266022 3300049586 Bacteria 1401
242 Ga0501074_0310205 3300049590 Bacteria 1121
243 Ga0501080_0006751 3300049742 Bacteria 10339
244 Ga0501080_1526788 3300049742 Bacteria 567
245 Ga0501083_0095481 3300049744 Bacteria 1962
246 Ga0501035_0036170 3300049822 Bacteria 4476
247 Ga0501035_0076106 3300049822 Bacteria 2968
248 Ga0501044_0021749 3300049823 Bacteria 6838
249 Ga0501044_0088062 3300049823 Bacteria 3135
250 Ga0501044_0461285 3300049823 Bacteria 1176
251 Ga0501044_0888954 3300049823 Bacteria 766
252 nmdc:mga06z11_856128_c1 3300050494 Bacteria 554
253 nmdc:mga0qj67_868159_c1 3300050509 Unclassified 712
254 nmdc:mga08y16_1324707_c1 3300050511 Bacteria 686
255 nmdc:mga0n895_2062051_c1 3300050512 Bacteria 527
256 Ga0500643_000173 3300053087 Bacteria 63279
257 Ga0500573_0446300 3300053140 Bacteria 599
258 Ga0500622_0064904 3300053156 Bacteria 1856
259 Ga0501084_0761364 3300054114 Bacteria 816
260 Ga0501082_0720695 3300060353 Bacteria 873
261 Ga0530510_0881191 3300061734 Bacteria 684
262 Ga0213874_10051652
263 MBSR1b_contig_10358512
264 JGI25151J46595_10000285
265 rootH2_10021186
266 JGI25160J50197_1015272
267 Ga0065165_1049311
268 Ga0065712_10076074
269 Ga0065712_10168840
270 Ga0065712_10422809
271 Ga0065715_10281386
272 Ga0070658_10115738
273 Ga0070676_10408493
274 Ga0070670_100000607
275 Ga0070666_10000508
276 Ga0070680_100090180
277 Ga0068868_100622408
278 Ga0070660_100020746
279 Ga0070689_101360396
280 Ga0070691_10000889
281 Ga0070687_100030800
282 Ga0070687_100822696
283 Ga0070661_100000266
284 Ga0070668_100186176
285 Ga0070669_101025599
286 Ga0070675_100185806
287 Ga0070671_100000981
288 Ga0070671_100008162
289 Ga0070674_100264323
290 Ga0070673_100417674
291 Ga0070673_100544274
292 Ga0070673_100898389
293 Ga0070688_100147166
294 Ga0070667_100004546
295 Ga0070714_100061781
296 Ga0070713_101480074
297 Ga0070700_100931578
298 Ga0070678_100333868
299 Ga0070678_100349574
300 Ga0070681_10000961
301 Ga0070685_10002622
302 Ga0070685_10082854
303 Ga0070679_100125500
304 Ga0068853_100337712
305 Ga0070672_100258829
306 Ga0070686_100006490
307 Ga0068855_100178968
308 Ga0070664_100000461
309 Ga0070702_100510270
310 Ga0068852_101208270
311 Ga0068859_100348062
312 Ga0068859_102520771
313 Ga0068864_100039617
314 Ga0068864_100040035
315 Ga0068851_10381216
316 Ga0068870_10186968
317 Ga0068863_100000012
318 Ga0068863_100001867
319 Ga0068863_100017659
320 Ga0068863_100219443
321 Ga0068858_100516772
322 Ga0068858_102078730
323 Ga0068860_100353035
324 Ga0068862_100894201
325 Ga0068862_102773890
326 Ga0075365_10140620
327 Ga0075369_10028203
328 Ga0075369_10407143
329 Ga0097621_100058494
330 Ga0097621_100204213
331 Ga0097621_101663069
332 Ga0097621_102025807
333 Ga0068871_100025597
334 Ga0068865_101155169
335 Ga0068865_102205298
336 Ga0097620_100348047
337 Ga0097620_102521797
338 Ga0105240_10095567
339 Ga0111539_10679364
340 Ga0111539_10891213
341 Ga0105245_10503102
342 Ga0105245_12990295
343 Ga0114129_12924877
344 Ga0105243_10129084
345 Ga0105248_10021031
346 Ga0105248_10344939
347 Ga0105249_10025216
348 Ga0105035_115431
349 Ga0105239_10507901
350 Ga0105239_10952346
351 Ga0105246_10395497
352 Ga0157373_11496701
353 Ga0157370_10474640
354 Ga0157374_10025190
355 Ga0157378_10280370
356 Ga0157378_10759151
357 Ga0163162_10000474
358 Ga0163162_11350565
359 Ga0163162_11783189
360 Ga0157372_10401675
361 Ga0157375_10029957
362 Ga0157375_11003502
363 Ga0157375_11388572
364 Ga0163163_10011792
365 Ga0163163_10212571
366 Ga0163163_10372938
367 Ga0163163_12342718
368 Ga0157379_10525987
369 Ga0157376_10319368
370 Ga0157376_12641898
371 Ga0213872_10133990
372 Ga0213876_10373922
373 Ga0209130_1000263
374 Ga0209025_1000114
375 Ga0209758_1005459
376 Ga0207426_1000436
377 Ga0207645_10648383
378 Ga0207705_10000461
379 Ga0207707_10002225
380 Ga0207707_10076819
381 Ga0207695_10147285
382 Ga0207660_10000617
383 Ga0207662_10039144
384 Ga0207657_10003947
385 Ga0207649_10000031
386 Ga0207652_10017908
387 Ga0207652_10099642
388 Ga0207681_10155913
389 Ga0207694_10176139
390 Ga0207650_10327473
391 Ga0207650_10351511
392 Ga0207659_10463085
393 Ga0207659_11230152
394 Ga0207700_11635628
395 Ga0207664_10007745
396 Ga0207644_10000118
397 Ga0207669_10275648
398 Ga0207691_11423198
399 Ga0207711_12125082
400 Ga0207667_10299346
401 Ga0207651_10376680
402 Ga0207651_11739444
403 Ga0207668_11405137
404 Ga0207703_10066776
405 Ga0207678_10010779
406 Ga0207708_10992325
407 Ga0207702_10419061
408 Ga0207641_10000024
409 Ga0207641_10456584
410 Ga0207676_10012153
411 Ga0207674_10057360
412 Ga0209969_1013039
413 Ga0210002_1020126
414 Ga0209983_1000498
415 Ga0209971_1002655
416 Ga0209974_10010276
417 Ga0209974_10071363
418 Ga0268265_10148701
419 Ga0268265_11001313
420 Ga0268264_10108963
421 Ga0268264_11403345
422 Ga0265338_10031863
423 Ga0265339_10465281
424 Ga0265331_10000037
425 Ga0265331_10156391
426 Ga0265327_10000481
427 Ga0307408_100009458
428 Ga0265314_10011158
429 Ga0265314_10013854
430 Ga0265314_10313540
431 Ga0307405_10038915
432 Ga0307413_10770017
433 Ga0307413_12028804
434 Ga0307410_11600035
435 Ga0307406_10028397
436 Ga0307406_10542494
437 Ga0307412_11539485
438 Ga0307409_100279928
439 Ga0307409_100533345
440 Ga0307409_101674894
441 Ga0307416_100480304
442 Ga0307414_10105394
443 Ga0307414_10375768
444 Ga0307411_10070582
445 Ga0307411_11501232
446 Ga0307415_100055842
447 Ga0373955_0945147
448 Ga0373935_1144555
449 Ga0373933_0497168
450 Ga0373937_2017094
451 Ga0436365_1599161
452 Ga0436361_0014585
453 Ga0436361_0057517
454 Ga0436361_0068404
455 Ga0436363_1012460
456 Ga0451800_1281408
457 Ga0451807_0431709
458 Ga0450907_027620
459 Ga0439435_0253578
460 Ga0451576_0001556
461 Ga0451576_0182661
462 Ga0495592_0345247
463 Ga0495603_0349757
464 Ga0495639_0124894
465 Ga0495610_0174881
466 Ga0495663_0113703
467 Ga0495586_0151259
468 Ga0495621_0238584
469 Ga0495656_0606183
470 Ga0495668_0038024
471 Ga0495634_0654287
472 Ga0495659_0390066
473 Ga0495647_0130156
474 Ga0495658_0868304
475 Ga0495636_0223259
476 Ga0495672_0036527
477 Ga0495683_0292502
478 Ga0495675_0304054
479 Ga0495684_0122592
480 Ga0496109_1618666
481 Ga0496110_0027918
482 Ga0495682_0126649
483 Ga0501032_0257784
484 Ga0501033_0226311
485 Ga0501033_0330973
486 Ga0501033_0594342
487 Ga0501034_0420393
488 Ga0501036_0191421
489 Ga0501037_0006947
490 Ga0501037_0522731
491 Ga0501038_0036153
492 Ga0501038_0051869
493 Ga0501039_0463552
494 Ga0501042_0541417
495 Ga0501043_0211687
496 Ga0501046_1281224
497 Ga0501047_0392346
498 Ga0501047_0462746
499 Ga0501069_0104524
500 Ga0501069_0971805
501 Ga0501070_0000185
502 Ga0501070_0266022
503 Ga0501074_0310205
504 Ga0501080_0006751
505 Ga0501080_1526788
506 Ga0501083_0095481
507 Ga0501035_0036170
508 Ga0501035_0076106
509 Ga0501044_0021749
510 Ga0501044_0088062
511 Ga0501044_0461285
512 Ga0501044_0888954
513 nmdc:mga06z11_856128_c1
514 nmdc:mga0qj67_868159_c1
515 nmdc:mga08y16_1324707_c1
516 nmdc:mga0n895_2062051_c1
517 Ga0500643_000173
518 Ga0500573_0446300
519 Ga0500622_0064904
520 Ga0501084_0761364
521 Ga0501082_0720695
522 Ga0530510_0881191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11730

DUF3297

Protein of unknown function (DUF3297)

36

106

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pdr-assembly1.cif.gz_A rigid body fit of assembled hmpv n-rna spiral bound to the c-terminal region of p 0.6809 48 75
8pdp-assembly1.cif.gz_A 10-mer ring of hmpv n-rna bound to the c-terminal region of p 0.5973 48 81
2icg-assembly1.cif.gz_A crystal structure of a protein of unknown function (np_472245.1) from listeria innocua at 1.65 a resolution 0.5471 47 69
7dve-assembly2.cif.gz_B crystal structure of fad-dependent c-glycoside oxidase 0.5228 35 73
5bwe-assembly1.cif.gz_B benzylsuccinate synthase alpha-beta-gamma complex with bound toluene and fumarate 0.4771 48 77
ID Description Score Start End Superfamily
af_A0A0R0LD71_429_810_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6472 36 70 3.40.850.10
af_Q8H5X6_117_561_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.6133 44 70 3.50.50.100
af_O94393_116_213_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.5644 48 71 2.30.42.10
af_P11875_109_453_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5637 46 68 3.40.50.620
af_A0A1D6LPC7_51_198_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5607 45 70 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4Q4CZW6-F1-model_v4 DUF3297 family protein 0.999 5 79
AF-A0A258LBC9-F1-model_v4 Glutathione peroxidase 0.996 5 78 GO:0004601
AF-A0A0Q7TP90-F1-model_v4 Glutathione peroxidase 0.9947 6 82 GO:0004601
AF-A0A1D2SQ15-F1-model_v4 Glutathione peroxidase 0.9926 4 77 GO:0004601
AF-A0A1H8QL57-F1-model_v4 Glutathione peroxidase 0.9915 4 79

Map