F370338

General Info

Members Datasets Scaffolds Average Seq Length
261 160 261 109

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10266026|Ga0157369_102660262
Length 118
Sequence VFGIGLPELAVIIVVAVVVFGPDRLPEFARQAGRLVRQLRQFTQSARDDIRKELGPEFANFELTDLDPRQAVRRHIIEAWDDGEQPAPTGVNGAGHNGNGTHRPLGEGESPPYDSDAT

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
156 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 2.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 8.05
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100358467 3300005329 Bacteria 1389
2 Ga0070683_100560908 3300005329 Bacteria 1092
3 Ga0070683_101216889 3300005329 Bacteria 724
4 Ga0070683_101984459 3300005329 Bacteria 559
5 Ga0070680_101480462 3300005336 Bacteria 588
6 Ga0070682_100132778 3300005337 Bacteria 1687
7 Ga0070660_101563361 3300005339 Bacteria 561
8 Ga0070689_101227689 3300005340 Bacteria 673
9 Ga0070687_100214830 3300005343 Bacteria 1174
10 Ga0070671_100504996 3300005355 Bacteria 1040
11 Ga0070674_100488495 3300005356 Bacteria 1023
12 Ga0070659_100525267 3300005366 Bacteria 1011
13 Ga0070714_100115235 3300005435 Bacteria 2385
14 Ga0070700_100388260 3300005441 Bacteria 1046
15 Ga0070685_10676538 3300005466 Bacteria 750
16 Ga0070684_100755280 3300005535 Bacteria 908
17 Ga0070686_101075682 3300005544 Bacteria 663
18 Ga0068856_100226728 3300005614 Bacteria 1884
19 Ga0068856_100365419 3300005614 Bacteria 1462
20 Ga0070702_100238181 3300005615 Bacteria 1227
21 Ga0068852_101209612 3300005616 Bacteria 777
22 Ga0068864_101484196 3300005618 Bacteria 681
23 Ga0068861_101234002 3300005719 Bacteria 724
24 Ga0068863_101261560 3300005841 Bacteria 745
25 Ga0068860_101158129 3300005843 Bacteria 793
26 Ga0075363_100549325 3300006048 Bacteria 689
27 Ga0075362_10034464 3300006177 Bacteria 2207
28 Ga0075428_100006383 3300006844 Bacteria 13122
29 Ga0075430_100000734 3300006846 Bacteria 25115
30 Ga0075431_100004727 3300006847 Bacteria 13381
31 Ga0075429_100000366 3300006880 Bacteria 33350
32 Ga0111539_11240523 3300009094 Bacteria 866
33 Ga0105245_10339636 3300009098 Bacteria 1485
34 Ga0105245_10741615 3300009098 Bacteria 1017
35 Ga0105245_11195549 3300009098 Bacteria 808
36 Ga0114129_10018450 3300009147 Bacteria 9939
37 Ga0114129_10486436 3300009147 Bacteria 1614
38 Ga0105243_10164385 3300009148 Bacteria 1916
39 Ga0105243_10337507 3300009148 Bacteria 1379
40 Ga0105243_12539281 3300009148 Bacteria 552
41 Ga0105237_10746478 3300009545 Bacteria 985
42 Ga0105238_13017598 3300009551 Bacteria 505
43 Ga0105249_11230967 3300009553 Bacteria 820
44 Ga0105246_10635814 3300011119 Bacteria 927
45 Ga0157371_11017490 3300013102 Bacteria 633
46 Ga0157370_12042201 3300013104 Bacteria 514
47 Ga0157369_10266026 3300013105 Bacteria 1788
48 Ga0157369_11681118 3300013105 Bacteria 645
49 Ga0157369_12551676 3300013105 Bacteria 517
50 Ga0157372_10199234 3300013307 Bacteria 2319
51 Ga0157372_10549468 3300013307 Bacteria 1346
52 Ga0157372_10599443 3300013307 Bacteria 1284
53 Ga0157372_11100477 3300013307 Bacteria 919
54 Ga0157372_11557449 3300013307 Bacteria 761
55 Ga0157375_12513255 3300013308 Bacteria 615
56 Ga0163163_11421228 3300014325 Bacteria 755
57 Ga0163163_12403904 3300014325 Bacteria 585
58 Ga0182008_10143954 3300014497 Bacteria 1194
59 Ga0182008_10348817 3300014497 Bacteria 784
60 Ga0157377_10192340 3300014745 Bacteria 1290
61 Ga0157377_11578044 3300014745 Bacteria 525
62 Ga0157376_10496049 3300014969 Bacteria 1199
63 Ga0197907_10832010 3300020069 Bacteria 811
64 Ga0206356_11708181 3300020070 Bacteria 1097
65 Ga0206350_11085138 3300020080 Bacteria 1422
66 Ga0206353_10036854 3300020082 Bacteria 764
67 Ga0224712_10154741 3300022467 Bacteria 1018
68 Ga0224712_10462212 3300022467 Bacteria 610
69 Ga0207688_10454434 3300025901 Bacteria 799
70 Ga0207671_10673159 3300025914 Bacteria 823
71 Ga0207693_10709112 3300025915 Bacteria 779
72 Ga0207662_10482730 3300025918 Bacteria 851
73 Ga0207657_11094840 3300025919 Bacteria 609
74 Ga0207687_10119360 3300025927 Bacteria 1970
75 Ga0207664_10178782 3300025929 Bacteria 1820
76 Ga0207644_11367722 3300025931 Bacteria 595
77 Ga0207690_10275056 3300025932 Bacteria 1310
78 Ga0207690_11150673 3300025932 Bacteria 647
79 Ga0207709_10665363 3300025935 Bacteria 830
80 Ga0207669_10370515 3300025937 Bacteria 1113
81 Ga0207661_10141648 3300025944 Bacteria 2070
82 Ga0207661_10841007 3300025944 Bacteria 845
83 Ga0207679_11003233 3300025945 Bacteria 765
84 Ga0207679_11256669 3300025945 Bacteria 680
85 Ga0207708_10109301 3300026075 Bacteria 2145
86 Ga0207708_10650217 3300026075 Bacteria 897
87 Ga0207702_10189120 3300026078 Bacteria 1901
88 Ga0207641_11720786 3300026088 Unclassified 629
89 Ga0207676_12161001 3300026095 Bacteria 555
90 Ga0207674_10584773 3300026116 Bacteria 1079
91 Ga0207675_101021424 3300026118 Bacteria 846
92 Ga0207698_11186146 3300026142 Bacteria 777
93 Ga0307408_101142111 3300031548 Unclassified 724
94 Ga0316575_10034252 3300031665 Bacteria 1995
95 Ga0307413_10085992 3300031824 Bacteria 2032
96 Ga0307410_10109630 3300031852 Bacteria 1995
97 Ga0307410_11719009 3300031852 Bacteria 556
98 Ga0307410_11735561 3300031852 Bacteria 554
99 Ga0307406_10323371 3300031901 Bacteria 1194
100 Ga0307407_10310691 3300031903 Bacteria 1102
101 Ga0307412_10151676 3300031911 Bacteria 1711
102 Ga0307412_10443278 3300031911 Bacteria 1068
103 Ga0307409_100054081 3300031995 Bacteria 3089
104 Ga0307409_100997575 3300031995 Bacteria 855
105 Ga0307409_101439256 3300031995 Bacteria 716
106 Ga0307416_100302582 3300032002 Bacteria 1590
107 Ga0307414_10118728 3300032004 Bacteria 2029
108 Ga0307415_100005290 3300032126 Bacteria 6835
109 Ga0373948_0146896 3300034817 Bacteria 587
110 Ga0395899_0021062 3300037312 Bacteria 4945
111 Ga0395898_0074469 3300037466 Bacteria 3279
112 Ga0395898_0152051 3300037466 Bacteria 2214
113 Ga0395901_0079349 3300038443 Bacteria 3427
114 Ga0395901_0091937 3300038443 Bacteria 3176
115 Ga0395901_2096451 3300038443 Bacteria 511
116 Ga0451802_1906852 3300041460 Bacteria 1083
117 Ga0439431_0230809 3300041997 Bacteria 545
118 Ga0466969_0077432 3300044656 Bacteria 1591
119 Ga0466972_0145767 3300044658 Bacteria 1114
120 Ga0466972_0232217 3300044658 Bacteria 863
121 Ga0466965_0093199 3300044683 Bacteria 1534
122 Ga0466966_0438001 3300044684 Bacteria 785
123 Ga0466961_0076597 3300044693 Bacteria 2119
124 Ga0466961_0592794 3300044693 Bacteria 667
125 Ga0466961_0617179 3300044693 Bacteria 652
126 Ga0466963_0882069 3300044694 Bacteria 630
127 Ga0466963_0976561 3300044694 Bacteria 596
128 Ga0466964_0854034 3300044706 Bacteria 518
129 Ga0466971_0031281 3300044719 Bacteria 2383
130 Ga0466970_0096831 3300044765 Bacteria 1605
131 Ga0466970_0167954 3300044765 Bacteria 1215
132 Ga0466970_0284690 3300044765 Bacteria 930
133 Ga0466957_0302849 3300044842 Bacteria 1074
134 Ga0466957_0728395 3300044842 Bacteria 701
135 Ga0466957_1175288 3300044842 Bacteria 555
136 Ga0466960_0056194 3300044901 Bacteria 1915
137 Ga0466960_0178399 3300044901 Bacteria 1150
138 Ga0466960_0731625 3300044901 Bacteria 595
139 Ga0466960_0795395 3300044901 Bacteria 572
140 Ga0466959_0511094 3300045049 Bacteria 812
141 Ga0466958_0054355 3300045836 Bacteria 2428
142 Ga0466958_0087682 3300045836 Bacteria 1922
143 Ga0466967_0147666 3300045976 Bacteria 2194
144 Ga0466967_0319019 3300045976 Bacteria 1498
145 Ga0466967_0645902 3300045976 Bacteria 1046
146 Ga0495664_0110206 3300046477 Bacteria 1661
147 Ga0495647_0359520 3300046681 Bacteria 664
148 Ga0495581_0488912 3300047315 Bacteria 716
149 Ga0495581_0630566 3300047315 Bacteria 620
150 Ga0496100_0039051 3300048903 Bacteria 3012
151 Ga0496101_0565316 3300048904 Bacteria 899
152 Ga0496101_1154343 3300048904 Bacteria 608
153 Ga0496102_0258531 3300048905 Bacteria 1642
154 Ga0496102_0887276 3300048905 Bacteria 813
155 Ga0496103_0108410 3300048906 Bacteria 1762
156 Ga0496104_0238579 3300048907 Bacteria 1730
157 Ga0496106_0004667 3300048909 Bacteria 10159
158 Ga0496107_0007943 3300048910 Bacteria 7323
159 Ga0496108_0039118 3300048911 Bacteria 3953
160 Ga0496108_0201501 3300048911 Bacteria 1727
161 Ga0496110_0266228 3300048913 Bacteria 1560
162 Ga0496110_0425506 3300048913 Bacteria 1210
163 Ga0496110_0988343 3300048913 Bacteria 749
164 Ga0496110_1786990 3300048913 Bacteria 525
165 Ga0496111_0380678 3300048914 Bacteria 1043
166 Ga0496113_0262189 3300048916 Bacteria 1380
167 Ga0496114_0207355 3300048917 Bacteria 1718
168 Ga0496114_0208120 3300048917 Bacteria 1715
169 Ga0496115_0304939 3300048918 Bacteria 1304
170 Ga0501031_0004407 3300049568 Bacteria 9126
171 Ga0501031_0044538 3300049568 Bacteria 2896
172 Ga0501031_0199440 3300049568 Bacteria 1306
173 Ga0501031_0555326 3300049568 Bacteria 739
174 Ga0501032_0971655 3300049569 Bacteria 534
175 Ga0501033_0411369 3300049570 Bacteria 942
176 Ga0501033_0979573 3300049570 Bacteria 566
177 Ga0501034_1079832 3300049571 Bacteria 684
178 Ga0501036_0149596 3300049572 Bacteria 1969
179 Ga0501036_0507615 3300049572 Bacteria 1003
180 Ga0501037_0046283 3300049573 Bacteria 3191
181 Ga0501038_0007981 3300049574 Bacteria 9754
182 Ga0501039_0002937 3300049575 Bacteria 12759
183 Ga0501039_0109919 3300049575 Bacteria 2155
184 Ga0501039_0420404 3300049575 Bacteria 1050
185 Ga0501040_0025281 3300049576 Bacteria 3992
186 Ga0501040_0243716 3300049576 Bacteria 1282
187 Ga0501040_0342609 3300049576 Bacteria 1070
188 Ga0501040_0703132 3300049576 Bacteria 731
189 Ga0501040_0885721 3300049576 Bacteria 646
190 Ga0501041_0016395 3300049577 Bacteria 4404
191 Ga0501041_0108975 3300049577 Bacteria 1718
192 Ga0501041_0491863 3300049577 Bacteria 780
193 Ga0501041_0542862 3300049577 Bacteria 741
194 Ga0501042_0001442 3300049578 Bacteria 13982
195 Ga0501042_0400699 3300049578 Bacteria 994
196 Ga0501042_0710971 3300049578 Bacteria 731
197 Ga0501042_0976508 3300049578 Bacteria 617
198 Ga0501042_0996421 3300049578 Bacteria 611
199 Ga0501046_0433379 3300049580 Bacteria 947
200 Ga0501048_0002900 3300049582 Bacteria 13091
201 Ga0501048_0315563 3300049582 Bacteria 1113
202 Ga0501048_0510235 3300049582 Bacteria 862
203 Ga0501067_0007375 3300049583 Bacteria 6109
204 Ga0501067_0010189 3300049583 Bacteria 5200
205 Ga0501068_0018727 3300049584 Bacteria 4012
206 Ga0501068_0321415 3300049584 Bacteria 992
207 Ga0501068_0328013 3300049584 Bacteria 982
208 Ga0501068_0562843 3300049584 Bacteria 742
209 Ga0501069_0013153 3300049585 Bacteria 4410
210 Ga0501069_0119549 3300049585 Bacteria 1504
211 Ga0501069_0185738 3300049585 Bacteria 1202
212 Ga0501070_0164386 3300049586 Bacteria 1829
213 Ga0501070_0769692 3300049586 Bacteria 758
214 Ga0501071_0036551 3300049587 Bacteria 3503
215 Ga0501071_0144189 3300049587 Bacteria 1775
216 Ga0501071_0202383 3300049587 Bacteria 1492
217 Ga0501071_1302115 3300049587 Bacteria 561
218 Ga0501072_0012534 3300049588 Bacteria 6483
219 Ga0501073_1032083 3300049589 Bacteria 566
220 Ga0501075_0100029 3300049591 Bacteria 2202
221 Ga0501075_0262409 3300049591 Bacteria 1317
222 Ga0501075_0275652 3300049591 Bacteria 1282
223 Ga0501076_0019580 3300049592 Bacteria 5174
224 Ga0501076_0399069 3300049592 Bacteria 1131
225 Ga0501076_0607144 3300049592 Bacteria 903
226 Ga0501076_0673577 3300049592 Bacteria 854
227 Ga0501076_1198637 3300049592 Bacteria 625
228 Ga0501077_0187648 3300049593 Bacteria 1313
229 Ga0501079_0012066 3300049741 Bacteria 6595
230 Ga0501079_0220157 3300049741 Bacteria 1483
231 Ga0501080_0039179 3300049742 Bacteria 4423
232 Ga0501081_0194950 3300049743 Bacteria 1468
233 Ga0501081_0263855 3300049743 Bacteria 1259
234 Ga0501271_008812 3300049768 Bacteria 1041
235 Ga0501035_0028758 3300049822 Bacteria 5072
236 Ga0501035_0520181 3300049822 Bacteria 978
237 Ga0501035_0665646 3300049822 Bacteria 843
238 Ga0501044_1262332 3300049823 Bacteria 606
239 Ga0501045_0189981 3300049824 Bacteria 1531
240 Ga0501045_0214834 3300049824 Bacteria 1432
241 Ga0501045_0365030 3300049824 Bacteria 1075
242 nmdc:mga03683_45893_c1 3300050489 Bacteria 1809
243 nmdc:mga03n38_55736_c1 3300050490 Bacteria 1781
244 nmdc:mga05p37_60853_c1 3300050507 Bacteria 4649
245 nmdc:mga09592_36490_c1 3300050508 Bacteria 4118
246 nmdc:mga0qj67_51847_c1 3300050509 Bacteria 3246
247 nmdc:mga06r32_178647_c1 3300050510 Bacteria 2108
248 nmdc:mga08y16_884461_c1 3300050511 Bacteria 880
249 Ga0495601_0295340 3300053077 Bacteria 1056
250 Ga0500628_092521 3300053129 Bacteria 790
251 Ga0500620_038274 3300053155 Bacteria 1561
252 Ga0501084_0010047 3300054114 Bacteria 7822
253 Ga0501084_0468119 3300054114 Bacteria 1065
254 Ga0501084_1739475 3300054114 Unclassified 521
255 Ga0501082_0357671 3300060353 Bacteria 1273
256 Ga0501082_0619791 3300060353 Bacteria 947
257 Ga0501082_1154226 3300060353 Bacteria 677
258 Ga0466962_0074852 3300061719 Bacteria 1618
259 Ga0530510_0278856 3300061734 Bacteria 1248
260 Ga0530510_1314942 3300061734 Bacteria 554
261 Ga0530510_1474477 3300061734 Bacteria 522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0854034 Ga0466964_0854034_41_370 96
2 3300045976 Ga0466967_0319019 Ga0466967_0319019_191_520 96
3 3300045049 Ga0466959_0511094 Ga0466959_0511094_153_479 97
4 3300005841 Ga0068863_101261560 Ga0068863_1012615602 98
5 3300026088 Ga0207641_11720786 Ga0207641_117207861 98
6 3300005339 Ga0070660_101563361 Ga0070660_1015633611 99
7 3300009551 Ga0105238_13017598 Ga0105238_130175981 99
8 3300025918 Ga0207662_10482730 Ga0207662_104827302 99
9 3300025919 Ga0207657_11094840 Ga0207657_110948402 99
10 3300025932 Ga0207690_10275056 Ga0207690_102750562 99
11 3300025945 Ga0207679_11256669 Ga0207679_112566692 99
12 3300038443 Ga0395901_2096451 Ga0395901_2096451_90_419 99
13 3300044683 Ga0466965_0093199 Ga0466965_0093199_1163_1465 99
14 3300044765 Ga0466970_0284690 Ga0466970_0284690_503_805 99
15 3300044842 Ga0466957_0728395 Ga0466957_0728395_257_559 99
16 3300044901 Ga0466960_0178399 Ga0466960_0178399_716_1018 99
17 3300049584 Ga0501068_0562843 Ga0501068_0562843_250_582 100
18 3300005356 Ga0070674_100488495 Ga0070674_1004884952 101
19 3300005441 Ga0070700_100388260 Ga0070700_1003882602 101
20 3300009148 Ga0105243_10337507 Ga0105243_103375072 101
21 3300025935 Ga0207709_10665363 Ga0207709_106653632 101
22 3300025937 Ga0207669_10370515 Ga0207669_103705152 101
23 3300026075 Ga0207708_10109301 Ga0207708_101093012 101
24 3300049585 Ga0501069_0119549 Ga0501069_0119549_607_942 101
25 3300031548 Ga0307408_101142111 Ga0307408_1011421111 102
26 3300031911 Ga0307412_10443278 Ga0307412_104432782 102
27 3300044658 Ga0466972_0232217 Ga0466972_0232217_44_367 102
28 3300044901 Ga0466960_0731625 Ga0466960_0731625_14_340 102
29 3300053129 Ga0500628_092521 Ga0500628_092521_426_740 102
30 3300005329 Ga0070683_101216889 Ga0070683_1012168891 103
31 3300014969 Ga0157376_10496049 Ga0157376_104960492 103
32 3300041460 Ga0451802_1906852 Ga0451802_1906852_494_823 103
33 3300005614 Ga0068856_100226728 Ga0068856_1002267283 104
34 3300026078 Ga0207702_10189120 Ga0207702_101891203 104
35 3300044694 Ga0466963_0976561 Ga0466963_0976561_125_463 104
36 3300044765 Ga0466970_0096831 Ga0466970_0096831_638_961 104
37 3300049568 Ga0501031_0199440 Ga0501031_0199440_797_1135 104
38 3300049576 Ga0501040_0885721 Ga0501040_0885721_136_474 104
39 3300049577 Ga0501041_0491863 Ga0501041_0491863_317_655 104
40 3300049578 Ga0501042_0976508 Ga0501042_0976508_204_542 104
41 3300049585 Ga0501069_0185738 Ga0501069_0185738_747_1073 104
42 3300049592 Ga0501076_0399069 Ga0501076_0399069_752_1090 104
43 3300049743 Ga0501081_0263855 Ga0501081_0263855_537_875 104
44 3300049822 Ga0501035_0665646 Ga0501035_0665646_356_694 104
45 3300049823 Ga0501044_1262332 Ga0501044_1262332_221_559 104
46 3300049824 Ga0501045_0189981 Ga0501045_0189981_929_1267 104
47 3300060353 Ga0501082_0619791 Ga0501082_0619791_246_584 104
48 3300005355 Ga0070671_100504996 Ga0070671_1005049962 105
49 3300006048 Ga0075363_100549325 Ga0075363_1005493251 105
50 3300006177 Ga0075362_10034464 Ga0075362_100344642 105
51 3300013102 Ga0157371_11017490 Ga0157371_110174902 105
52 3300025915 Ga0207693_10709112 Ga0207693_107091121 105
53 3300031665 Ga0316575_10034252 Ga0316575_100342522 105
54 3300031852 Ga0307410_11735561 Ga0307410_117355611 105
55 3300045976 Ga0466967_0645902 Ga0466967_0645902_349_678 105
56 3300046477 Ga0495664_0110206 Ga0495664_0110206_93_416 105
57 3300046681 Ga0495647_0359520 Ga0495647_0359520_282_605 105
58 3300047315 Ga0495581_0488912 Ga0495581_0488912_371_700 105
59 3300049568 Ga0501031_0004407 Ga0501031_0004407_85_420 105
60 3300049570 Ga0501033_0411369 Ga0501033_0411369_499_834 105
61 3300049571 Ga0501034_1079832 Ga0501034_1079832_135_470 105
62 3300049572 Ga0501036_0149596 Ga0501036_0149596_824_1159 105
63 3300049573 Ga0501037_0046283 Ga0501037_0046283_2828_3163 105
64 3300049574 Ga0501038_0007981 Ga0501038_0007981_3626_3961 105
65 3300049575 Ga0501039_0002937 Ga0501039_0002937_8568_8903 105
66 3300049576 Ga0501040_0025281 Ga0501040_0025281_1177_1512 105
67 3300049577 Ga0501041_0016395 Ga0501041_0016395_1273_1608 105
68 3300049578 Ga0501042_0001442 Ga0501042_0001442_12811_13146 105
69 3300049578 Ga0501042_0710971 Ga0501042_0710971_243_590 105
70 3300049582 Ga0501048_0002900 Ga0501048_0002900_767_1102 105
71 3300049584 Ga0501068_0321415 Ga0501068_0321415_197_532 105
72 3300049585 Ga0501069_0013153 Ga0501069_0013153_1875_2210 105
73 3300049586 Ga0501070_0164386 Ga0501070_0164386_512_847 105
74 3300049587 Ga0501071_0036551 Ga0501071_0036551_2345_2680 105
75 3300049588 Ga0501072_0012534 Ga0501072_0012534_3676_4011 105
76 3300049591 Ga0501075_0100029 Ga0501075_0100029_657_992 105
77 3300049592 Ga0501076_0019580 Ga0501076_0019580_1278_1613 105
78 3300049593 Ga0501077_0187648 Ga0501077_0187648_637_972 105
79 3300049741 Ga0501079_0012066 Ga0501079_0012066_2885_3220 105
80 3300049742 Ga0501080_0039179 Ga0501080_0039179_2185_2520 105
81 3300049822 Ga0501035_0028758 Ga0501035_0028758_4310_4645 105
82 3300050489 nmdc:mga03683_45893_c1 nmdc:mga03683_45893_c1_238_567 105
83 3300050490 nmdc:mga03n38_55736_c1 nmdc:mga03n38_55736_c1_409_738 105
84 3300053077 Ga0495601_0295340 Ga0495601_0295340_141_464 105
85 3300054114 Ga0501084_0010047 Ga0501084_0010047_837_1172 105
86 3300060353 Ga0501082_0357671 Ga0501082_0357671_723_1058 105
87 3300061734 Ga0530510_1314942 Ga0530510_1314942_188_523 105
88 3300009545 Ga0105237_10746478 Ga0105237_107464781 106
89 3300025914 Ga0207671_10673159 Ga0207671_106731592 106
90 3300044658 Ga0466972_0145767 Ga0466972_0145767_756_1085 106
91 3300005366 Ga0070659_100525267 Ga0070659_1005252672 107
92 3300013307 Ga0157372_10549468 Ga0157372_105494682 107
93 3300020069 Ga0197907_10832010 Ga0197907_108320102 107
94 3300020070 Ga0206356_11708181 Ga0206356_117081812 107
95 3300020080 Ga0206350_11085138 Ga0206350_110851382 107
96 3300020082 Ga0206353_10036854 Ga0206353_100368542 107
97 3300022467 Ga0224712_10154741 Ga0224712_101547412 107
98 3300025932 Ga0207690_11150673 Ga0207690_111506731 107
99 3300037312 Ga0395899_0021062 Ga0395899_0021062_4499_4831 107
100 3300037466 Ga0395898_0074469 Ga0395898_0074469_2695_3027 107
101 3300038443 Ga0395901_0079349 Ga0395901_0079349_2241_2573 107
102 3300044656 Ga0466969_0077432 Ga0466969_0077432_313_645 107
103 3300044684 Ga0466966_0438001 Ga0466966_0438001_75_407 107
104 3300044693 Ga0466961_0076597 Ga0466961_0076597_705_1037 107
105 3300044693 Ga0466961_0592794 Ga0466961_0592794_285_617 107
106 3300044694 Ga0466963_0882069 Ga0466963_0882069_154_486 107
107 3300044719 Ga0466971_0031281 Ga0466971_0031281_204_536 107
108 3300044765 Ga0466970_0167954 Ga0466970_0167954_100_432 107
109 3300044842 Ga0466957_0302849 Ga0466957_0302849_311_640 107
110 3300044842 Ga0466957_1175288 Ga0466957_1175288_135_467 107
111 3300044901 Ga0466960_0795395 Ga0466960_0795395_127_456 107
112 3300045836 Ga0466958_0054355 Ga0466958_0054355_1295_1627 107
113 3300045836 Ga0466958_0087682 Ga0466958_0087682_938_1267 107
114 3300049587 Ga0501071_1302115 Ga0501071_1302115_25_357 107
115 3300049592 Ga0501076_0673577 Ga0501076_0673577_139_471 107
116 3300061719 Ga0466962_0074852 Ga0466962_0074852_1099_1431 107
117 3300005329 Ga0070683_101984459 Ga0070683_1019844592 108
118 3300005336 Ga0070680_101480462 Ga0070680_1014804622 108
119 3300005343 Ga0070687_100214830 Ga0070687_1002148302 108
120 3300005435 Ga0070714_100115235 Ga0070714_1001152352 108
121 3300005719 Ga0068861_101234002 Ga0068861_1012340022 108
122 3300006844 Ga0075428_100006383 Ga0075428_1000063832 108
123 3300006846 Ga0075430_100000734 Ga0075430_10000073417 108
124 3300006847 Ga0075431_100004727 Ga0075431_1000047272 108
125 3300006880 Ga0075429_100000366 Ga0075429_10000036610 108
126 3300009098 Ga0105245_10339636 Ga0105245_103396362 108
127 3300009098 Ga0105245_11195549 Ga0105245_111955492 108
128 3300009147 Ga0114129_10018450 Ga0114129_100184503 108
129 3300009553 Ga0105249_11230967 Ga0105249_112309672 108
130 3300013104 Ga0157370_12042201 Ga0157370_120422011 108
131 3300013105 Ga0157369_10266026 Ga0157369_102660262 108
132 3300013105 Ga0157369_11681118 Ga0157369_116811181 108
133 3300013307 Ga0157372_10199234 Ga0157372_101992342 108
134 3300013307 Ga0157372_10599443 Ga0157372_105994432 108
135 3300013307 Ga0157372_11557449 Ga0157372_115574492 108
136 3300013308 Ga0157375_12513255 Ga0157375_125132552 108
137 3300014325 Ga0163163_11421228 Ga0163163_114212282 108
138 3300014745 Ga0157377_11578044 Ga0157377_115780442 108
139 3300022467 Ga0224712_10462212 Ga0224712_104622122 108
140 3300025929 Ga0207664_10178782 Ga0207664_101787822 108
141 3300025931 Ga0207644_11367722 Ga0207644_113677222 108
142 3300025944 Ga0207661_10841007 Ga0207661_108410072 108
143 3300025945 Ga0207679_11003233 Ga0207679_110032332 108
144 3300026116 Ga0207674_10584773 Ga0207674_105847732 108
145 3300026118 Ga0207675_101021424 Ga0207675_1010214242 108
146 3300031852 Ga0307410_11719009 Ga0307410_117190092 108
147 3300031995 Ga0307409_100997575 Ga0307409_1009975752 108
148 3300045976 Ga0466967_0147666 Ga0466967_0147666_1295_1621 108
149 3300048913 Ga0496110_0988343 Ga0496110_0988343_281_610 108
150 3300049576 Ga0501040_0703132 Ga0501040_0703132_386_718 108
151 3300049592 Ga0501076_1198637 Ga0501076_1198637_236_580 108
152 3300050507 nmdc:mga05p37_60853_c1 nmdc:mga05p37_60853_c1_980_1330 108
153 3300050508 nmdc:mga09592_36490_c1 nmdc:mga09592_36490_c1_3073_3423 108
154 3300050509 nmdc:mga0qj67_51847_c1 nmdc:mga0qj67_51847_c1_1573_1923 108
155 3300050510 nmdc:mga06r32_178647_c1 nmdc:mga06r32_178647_c1_916_1266 108
156 3300005329 Ga0070683_100358467 Ga0070683_1003584672 109
157 3300005329 Ga0070683_100560908 Ga0070683_1005609081 109
158 3300005337 Ga0070682_100132778 Ga0070682_1001327782 109
159 3300005340 Ga0070689_101227689 Ga0070689_1012276892 109
160 3300005466 Ga0070685_10676538 Ga0070685_106765382 109
161 3300005535 Ga0070684_100755280 Ga0070684_1007552802 109
162 3300005544 Ga0070686_101075682 Ga0070686_1010756822 109
163 3300005614 Ga0068856_100365419 Ga0068856_1003654192 109
164 3300005615 Ga0070702_100238181 Ga0070702_1002381811 109
165 3300005616 Ga0068852_101209612 Ga0068852_1012096122 109
166 3300005618 Ga0068864_101484196 Ga0068864_1014841962 109
167 3300005843 Ga0068860_101158129 Ga0068860_1011581292 109
168 3300009094 Ga0111539_11240523 Ga0111539_112405232 109
169 3300009098 Ga0105245_10741615 Ga0105245_107416152 109
170 3300009147 Ga0114129_10486436 Ga0114129_104864361 109
171 3300009148 Ga0105243_10164385 Ga0105243_101643852 109
172 3300009148 Ga0105243_12539281 Ga0105243_125392811 109
173 3300011119 Ga0105246_10635814 Ga0105246_106358142 109
174 3300013105 Ga0157369_12551676 Ga0157369_125516762 109
175 3300013307 Ga0157372_11100477 Ga0157372_111004772 109
176 3300014325 Ga0163163_12403904 Ga0163163_124039042 109
177 3300014497 Ga0182008_10143954 Ga0182008_101439542 109
178 3300014497 Ga0182008_10348817 Ga0182008_103488172 109
179 3300014745 Ga0157377_10192340 Ga0157377_101923402 109
180 3300025901 Ga0207688_10454434 Ga0207688_104544342 109
181 3300025927 Ga0207687_10119360 Ga0207687_101193602 109
182 3300025944 Ga0207661_10141648 Ga0207661_101416482 109
183 3300026075 Ga0207708_10650217 Ga0207708_106502172 109
184 3300026095 Ga0207676_12161001 Ga0207676_121610012 109
185 3300026142 Ga0207698_11186146 Ga0207698_111861462 109
186 3300031824 Ga0307413_10085992 Ga0307413_100859922 109
187 3300031852 Ga0307410_10109630 Ga0307410_101096302 109
188 3300031901 Ga0307406_10323371 Ga0307406_103233712 109
189 3300031903 Ga0307407_10310691 Ga0307407_103106912 109
190 3300031911 Ga0307412_10151676 Ga0307412_101516762 109
191 3300031995 Ga0307409_100054081 Ga0307409_1000540814 109
192 3300031995 Ga0307409_101439256 Ga0307409_1014392561 109
193 3300032002 Ga0307416_100302582 Ga0307416_1003025822 109
194 3300032004 Ga0307414_10118728 Ga0307414_101187282 109
195 3300032126 Ga0307415_100005290 Ga0307415_1000052906 109
196 3300034817 Ga0373948_0146896 Ga0373948_0146896_43_378 109
197 3300037466 Ga0395898_0152051 Ga0395898_0152051_974_1306 109
198 3300038443 Ga0395901_0091937 Ga0395901_0091937_2122_2454 109
199 3300041997 Ga0439431_0230809 Ga0439431_0230809_119_454 109
200 3300044693 Ga0466961_0617179 Ga0466961_0617179_243_581 109
201 3300044901 Ga0466960_0056194 Ga0466960_0056194_348_677 109
202 3300047315 Ga0495581_0630566 Ga0495581_0630566_127_456 109
203 3300048903 Ga0496100_0039051 Ga0496100_0039051_2175_2504 109
204 3300048904 Ga0496101_0565316 Ga0496101_0565316_508_843 109
205 3300048904 Ga0496101_1154343 Ga0496101_1154343_26_355 109
206 3300048905 Ga0496102_0258531 Ga0496102_0258531_1247_1582 109
207 3300048905 Ga0496102_0887276 Ga0496102_0887276_209_538 109
208 3300048906 Ga0496103_0108410 Ga0496103_0108410_27_356 109
209 3300048907 Ga0496104_0238579 Ga0496104_0238579_823_1152 109
210 3300048909 Ga0496106_0004667 Ga0496106_0004667_6189_6518 109
211 3300048910 Ga0496107_0007943 Ga0496107_0007943_186_515 109
212 3300048911 Ga0496108_0039118 Ga0496108_0039118_2460_2789 109
213 3300048911 Ga0496108_0201501 Ga0496108_0201501_135_470 109
214 3300048913 Ga0496110_0266228 Ga0496110_0266228_367_702 109
215 3300048913 Ga0496110_0425506 Ga0496110_0425506_792_1121 109
216 3300048913 Ga0496110_1786990 Ga0496110_1786990_171_503 109
217 3300048914 Ga0496111_0380678 Ga0496111_0380678_301_630 109
218 3300048916 Ga0496113_0262189 Ga0496113_0262189_376_705 109
219 3300048917 Ga0496114_0207355 Ga0496114_0207355_703_1032 109
220 3300048917 Ga0496114_0208120 Ga0496114_0208120_716_1051 109
221 3300048918 Ga0496115_0304939 Ga0496115_0304939_790_1125 109
222 3300049568 Ga0501031_0044538 Ga0501031_0044538_2071_2403 109
223 3300049568 Ga0501031_0555326 Ga0501031_0555326_305_643 109
224 3300049569 Ga0501032_0971655 Ga0501032_0971655_90_431 109
225 3300049570 Ga0501033_0979573 Ga0501033_0979573_180_512 109
226 3300049572 Ga0501036_0507615 Ga0501036_0507615_19_357 109
227 3300049575 Ga0501039_0109919 Ga0501039_0109919_456_788 109
228 3300049575 Ga0501039_0420404 Ga0501039_0420404_473_811 109
229 3300049576 Ga0501040_0243716 Ga0501040_0243716_440_778 109
230 3300049576 Ga0501040_0342609 Ga0501040_0342609_448_780 109
231 3300049577 Ga0501041_0108975 Ga0501041_0108975_67_399 109
232 3300049577 Ga0501041_0542862 Ga0501041_0542862_210_545 109
233 3300049578 Ga0501042_0400699 Ga0501042_0400699_607_939 109
234 3300049578 Ga0501042_0996421 Ga0501042_0996421_205_546 109
235 3300049580 Ga0501046_0433379 Ga0501046_0433379_221_559 109
236 3300049582 Ga0501048_0315563 Ga0501048_0315563_376_717 109
237 3300049582 Ga0501048_0510235 Ga0501048_0510235_318_656 109
238 3300049583 Ga0501067_0007375 Ga0501067_0007375_1739_2068 109
239 3300049583 Ga0501067_0010189 Ga0501067_0010189_1619_1954 109
240 3300049584 Ga0501068_0018727 Ga0501068_0018727_2634_2969 109
241 3300049584 Ga0501068_0328013 Ga0501068_0328013_601_930 109
242 3300049586 Ga0501070_0769692 Ga0501070_0769692_213_542 109
243 3300049587 Ga0501071_0144189 Ga0501071_0144189_1070_1411 109
244 3300049587 Ga0501071_0202383 Ga0501071_0202383_449_781 109
245 3300049589 Ga0501073_1032083 Ga0501073_1032083_192_524 109
246 3300049591 Ga0501075_0262409 Ga0501075_0262409_808_1146 109
247 3300049591 Ga0501075_0275652 Ga0501075_0275652_605_937 109
248 3300049592 Ga0501076_0607144 Ga0501076_0607144_116_448 109
249 3300049741 Ga0501079_0220157 Ga0501079_0220157_851_1183 109
250 3300049743 Ga0501081_0194950 Ga0501081_0194950_534_866 109
251 3300049768 Ga0501271_008812 Ga0501271_008812_393_725 109
252 3300049822 Ga0501035_0520181 Ga0501035_0520181_352_693 109
253 3300049824 Ga0501045_0214834 Ga0501045_0214834_174_506 109
254 3300049824 Ga0501045_0365030 Ga0501045_0365030_404_742 109
255 3300050511 nmdc:mga08y16_884461_c1 nmdc:mga08y16_884461_c1_27_356 109
256 3300053155 Ga0500620_038274 Ga0500620_038274_887_1219 109
257 3300054114 Ga0501084_0468119 Ga0501084_0468119_630_962 109
258 3300054114 Ga0501084_1739475 Ga0501084_1739475_165_506 109
259 3300060353 Ga0501082_1154226 Ga0501082_1154226_109_441 109
260 3300061734 Ga0530510_0278856 Ga0530510_0278856_39_371 109
261 3300061734 Ga0530510_1474477 Ga0530510_1474477_81_422 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

4

55

0.94

Feature Viewer

pLDDT pTM Quality
73.21 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map