F370054

General Info

Members Datasets Scaffolds Average Seq Length
261 173 522 225

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10110264|Ga0065712_101102641
Length 241
Sequence LAADEKTLSFSIVVNFNDFTFIVVMRTRIKICCISSVNEAKLAIDHGADAIGLVAKMPSGPGPIPDWLIAEIVKTIHPPIASFLLTSEQSSEEIIYHVKRVDTNTVQIVDELTTGAYSDIRTALPHLKIVQVIHVTGEESIDEAVRISPNVDALLLDSGDPKARIKTLGGTGNVHNWDLSREIVKAVNIPVFLAGGLHANNVRQAIETVRPFAVDICSGVRTEGRLDPGKLEAFIKAVHSL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 0.38
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 14.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10110264 3300005290 Bacteria 1829
2 MBSR1b_contig_7539689 2162886012 Bacteria 3459
3 rootL2_10045078 3300003322 Bacteria 4490
4 Ga0065714_10079247 3300005288 Bacteria 2531
5 Ga0065712_10004492 3300005290 Bacteria 5348
6 Ga0065712_10091792 3300005290 Bacteria 2357
7 Ga0065712_10237799 3300005290 Bacteria 993
8 Ga0065715_10091391 3300005293 Bacteria 5827
9 Ga0065715_10160737 3300005293 Bacteria 1632
10 Ga0065707_10119808 3300005295 Bacteria 2150
11 Ga0070658_10173942 3300005327 Unclassified 1810
12 Ga0070683_100004686 3300005329 Bacteria 11300
13 Ga0070670_100082783 3300005331 Bacteria 2758
14 Ga0070677_10049180 3300005333 Bacteria 1697
15 Ga0070677_10094931 3300005333 Unclassified 1304
16 Ga0068869_100044065 3300005334 Bacteria 3208
17 Ga0070680_100004431 3300005336 Bacteria 10572
18 Ga0070680_100152248 3300005336 Unclassified 1942
19 Ga0070680_100171598 3300005336 Bacteria 1825
20 Ga0070680_100335283 3300005336 Bacteria 1285
21 Ga0070682_100004515 3300005337 Bacteria 7729
22 Ga0070682_100011750 3300005337 Bacteria 5007
23 Ga0070682_100019543 3300005337 Bacteria 3975
24 Ga0068868_100125928 3300005338 Unclassified 2093
25 Ga0070689_100033479 3300005340 Bacteria 3916
26 Ga0070691_10032300 3300005341 Unclassified 2459
27 Ga0070687_100028383 3300005343 Bacteria 2714
28 Ga0070687_100160143 3300005343 Bacteria 1330
29 Ga0070687_100258341 3300005343 Unclassified 1086
30 Ga0070661_100002112 3300005344 Bacteria 13690
31 Ga0070669_100012364 3300005353 Bacteria 6056
32 Ga0070675_100134739 3300005354 Bacteria 2107
33 Ga0070673_100019546 3300005364 Bacteria 4864
34 Ga0070673_100451653 3300005364 Bacteria 1156
35 Ga0070659_100461896 3300005366 Bacteria 1078
36 Ga0070713_100463536 3300005436 Bacteria 1192
37 Ga0070700_100219255 3300005441 Bacteria 1347
38 Ga0070708_100094667 3300005445 Bacteria 2725
39 Ga0070663_100264117 3300005455 Bacteria 1366
40 Ga0070678_100006134 3300005456 Bacteria 7020
41 Ga0070678_100093912 3300005456 Bacteria 2308
42 Ga0070662_100007084 3300005457 Bacteria 7256
43 Ga0070681_10000634 3300005458 Bacteria 28917
44 Ga0070681_10001199 3300005458 Bacteria 22496
45 Ga0070681_10022756 3300005458 Bacteria 6298
46 Ga0068867_100579994 3300005459 Bacteria 975
47 Ga0070685_10000956 3300005466 Bacteria 15505
48 Ga0070685_10053737 3300005466 Bacteria 2334
49 Ga0070685_10126946 3300005466 Bacteria 1590
50 Ga0070706_100031209 3300005467 Bacteria 4914
51 Ga0070706_100338872 3300005467 Bacteria 1402
52 Ga0070698_100009027 3300005471 Bacteria 10721
53 Ga0070698_100037131 3300005471 Bacteria 5024
54 Ga0070698_100425155 3300005471 Bacteria 1263
55 Ga0070699_100059496 3300005518 Bacteria 3310
56 Ga0070699_100143554 3300005518 Bacteria 2109
57 Ga0070679_100001705 3300005530 Bacteria 19795
58 Ga0070679_100018087 3300005530 Bacteria 6831
59 Ga0070684_100001809 3300005535 Bacteria 15650
60 Ga0070697_100058684 3300005536 Bacteria 3132
61 Ga0070672_100083503 3300005543 Bacteria 2563
62 Ga0070695_100002334 3300005545 Bacteria 10887
63 Ga0070695_100401569 3300005545 Unclassified 1039
64 Ga0070696_100011363 3300005546 Bacteria 5963
65 Ga0070696_100291353 3300005546 Bacteria 1247
66 Ga0070696_100786801 3300005546 Unclassified 782
67 Ga0070693_100001465 3300005547 Bacteria 10628
68 Ga0070704_100188517 3300005549 Bacteria 1656
69 Ga0068855_100000786 3300005563 Bacteria 39197
70 Ga0070664_100047026 3300005564 Bacteria 3645
71 Ga0068857_100108858 3300005577 Bacteria 2490
72 Ga0070702_100032046 3300005615 Bacteria 2882
73 Ga0070702_100191428 3300005615 Bacteria 1346
74 Ga0070702_100420531 3300005615 Unclassified 961
75 Ga0068852_100610364 3300005616 Bacteria 1096
76 Ga0068859_100403196 3300005617 Unclassified 1463
77 Ga0068859_100462997 3300005617 Bacteria 1364
78 Ga0068864_100252863 3300005618 Bacteria 1637
79 Ga0068866_10010723 3300005718 Bacteria 3939
80 Ga0068861_100020658 3300005719 Bacteria 4721
81 Ga0068861_100100408 3300005719 Bacteria 2300
82 Ga0068863_100126575 3300005841 Bacteria 2438
83 Ga0068863_100242329 3300005841 Bacteria 1740
84 Ga0068863_100385773 3300005841 Bacteria 1368
85 Ga0068858_100183056 3300005842 Bacteria 1979
86 Ga0068862_100177113 3300005844 Bacteria 1912
87 Ga0081539_10051562 3300005985 Bacteria 2317
88 Ga0070717_10058033 3300006028 Bacteria 3200
89 Ga0070715_10048647 3300006163 Bacteria 1814
90 Ga0097621_100544672 3300006237 Unclassified 1056
91 Ga0075428_100039735 3300006844 Bacteria 5178
92 Ga0075428_100056004 3300006844 Bacteria 4319
93 Ga0075428_100621765 3300006844 Bacteria 1153
94 Ga0075428_101338164 3300006844 Bacteria 753
95 Ga0075430_100040831 3300006846 Bacteria 3926
96 Ga0075431_100136252 3300006847 Bacteria 2531
97 Ga0075431_100651928 3300006847 Unclassified 1033
98 Ga0075433_10006321 3300006852 Bacteria 9359
99 Ga0075434_100000232 3300006871 Bacteria 38374
100 Ga0075429_100009652 3300006880 Bacteria 8370
101 Ga0075429_100056204 3300006880 Bacteria 3425
102 Ga0068865_100502976 3300006881 Bacteria 1011
103 Ga0097620_100403200 3300006931 Unclassified 1463
104 Ga0097620_100463003 3300006931 Bacteria 1364
105 Ga0111539_10141171 3300009094 Bacteria 2820
106 Ga0111539_10152052 3300009094 Bacteria 2709
107 Ga0111539_10886761 3300009094 Bacteria 1038
108 Ga0105245_10006426 3300009098 Bacteria 10347
109 Ga0105245_10007134 3300009098 Bacteria 9802
110 Ga0105245_10098562 3300009098 Bacteria 2701
111 Ga0114129_10078699 3300009147 Unclassified 4585
112 Ga0114129_11808343 3300009147 Bacteria 743
113 Ga0105241_10708077 3300009174 Unclassified 920
114 Ga0105242_10450565 3300009176 Bacteria 1213
115 Ga0105242_10762383 3300009176 Unclassified 954
116 Ga0105249_10024665 3300009553 Bacteria 5406
117 Ga0105249_10051584 3300009553 Bacteria 3753
118 Ga0105249_10472102 3300009553 Bacteria 1296
119 Ga0105249_10563807 3300009553 Bacteria 1191
120 Ga0105249_11152577 3300009553 Unclassified 846
121 Ga0105246_10031444 3300011119 Bacteria 3513
122 Ga0157374_11291371 3300013296 Unclassified 752
123 Ga0157378_10009724 3300013297 Bacteria 8377
124 Ga0157378_10034917 3300013297 Bacteria 4446
125 Ga0157378_10052420 3300013297 Bacteria 3630
126 Ga0157378_10745375 3300013297 Bacteria 1002
127 Ga0163162_10249396 3300013306 Bacteria 1907
128 Ga0163162_10614075 3300013306 Bacteria 1213
129 Ga0157372_10012291 3300013307 Bacteria 9121
130 Ga0157372_10180842 3300013307 Bacteria 2441
131 Ga0157372_10389703 3300013307 Unclassified 1623
132 Ga0163163_10608950 3300014325 Bacteria 1155
133 Ga0163163_10723692 3300014325 Bacteria 1059
134 Ga0157380_10065161 3300014326 Bacteria 2927
135 Ga0157380_10113516 3300014326 Bacteria 2281
136 Ga0157380_10330186 3300014326 Bacteria 1418
137 Ga0157380_10427098 3300014326 Bacteria 1266
138 Ga0157377_10063253 3300014745 Unclassified 2119
139 Ga0157379_10099073 3300014968 Bacteria 2616
140 Ga0157376_10067972 3300014969 Bacteria 3016
141 Ga0163161_10164898 3300017792 Bacteria 1691
142 Ga0213876_10038842 3300021384 Bacteria 2514
143 Ga0207682_10004309 3300025893 Bacteria 5981
144 Ga0207642_10007677 3300025899 Bacteria 3653
145 Ga0207685_10223899 3300025905 Unclassified 896
146 Ga0207645_10081255 3300025907 Bacteria 2078
147 Ga0207643_10002416 3300025908 Bacteria 10111
148 Ga0207707_10004020 3300025912 Bacteria 13051
149 Ga0207707_10031176 3300025912 Bacteria 4664
150 Ga0207707_10266965 3300025912 Bacteria 1484
151 Ga0207660_10001575 3300025917 Bacteria 15294
152 Ga0207660_10128238 3300025917 Unclassified 1928
153 Ga0207662_10007245 3300025918 Bacteria 6032
154 Ga0207662_10010676 3300025918 Bacteria 5078
155 Ga0207662_10211819 3300025918 Unclassified 1258
156 Ga0207652_10002181 3300025921 Bacteria 16720
157 Ga0207652_10075675 3300025921 Unclassified 2934
158 Ga0207681_10035727 3300025923 Bacteria 3276
159 Ga0207681_10546742 3300025923 Bacteria 953
160 Ga0207659_10279947 3300025926 Bacteria 1363
161 Ga0207700_10036381 3300025928 Bacteria 3555
162 Ga0207700_10276497 3300025928 Bacteria 1443
163 Ga0207706_10012538 3300025933 Bacteria 7719
164 Ga0207686_10000367 3300025934 Bacteria 31650
165 Ga0207670_10008044 3300025936 Bacteria 5928
166 Ga0207669_10169118 3300025937 Bacteria 1554
167 Ga0207704_10020538 3300025938 Unclassified 3497
168 Ga0207704_10071192 3300025938 Bacteria 2206
169 Ga0207691_10216641 3300025940 Bacteria 1661
170 Ga0207711_10761444 3300025941 Bacteria 902
171 Ga0207689_10088185 3300025942 Bacteria 2549
172 Ga0207689_10730723 3300025942 Unclassified 835
173 Ga0207661_10003053 3300025944 Bacteria 11587
174 Ga0207667_10136804 3300025949 Unclassified 2522
175 Ga0207651_10129934 3300025960 Bacteria 1926
176 Ga0207651_10374964 3300025960 Unclassified 1204
177 Ga0207712_10010939 3300025961 Bacteria 5774
178 Ga0207712_10020303 3300025961 Bacteria 4350
179 Ga0207640_10052936 3300025981 Bacteria 2647
180 Ga0207658_10256700 3300025986 Bacteria 1488
181 Ga0207677_10015141 3300026023 Bacteria 4526
182 Ga0207703_10203736 3300026035 Bacteria 1759
183 Ga0207639_10099858 3300026041 Bacteria 2343
184 Ga0207708_10002821 3300026075 Bacteria 12769
185 Ga0207708_10255786 3300026075 Bacteria 1412
186 Ga0207641_10000873 3300026088 Bacteria 31566
187 Ga0207648_10202663 3300026089 Bacteria 1760
188 Ga0207648_10294904 3300026089 Bacteria 1453
189 Ga0207648_10867100 3300026089 Unclassified 842
190 Ga0207676_10015440 3300026095 Bacteria 5509
191 Ga0207674_10126301 3300026116 Unclassified 2523
192 Ga0207674_10143273 3300026116 Bacteria 2349
193 Ga0207675_100138164 3300026118 Bacteria 2313
194 Ga0207683_10018499 3300026121 Bacteria 5945
195 Ga0209996_1021979 3300027395 Unclassified 901
196 Ga0209996_1022519 3300027395 Unclassified 892
197 Ga0209999_1002956 3300027543 Bacteria 3015
198 Ga0209966_1002144 3300027695 Bacteria 3294
199 Ga0209998_10001135 3300027717 Bacteria 6587
200 Ga0209974_10026828 3300027876 Bacteria 1905
201 Ga0268265_10278774 3300028380 Bacteria 1495
202 Ga0268265_10308278 3300028380 Bacteria 1428
203 Ga0265323_10032950 3300028653 Bacteria 1921
204 Ga0265338_10001114 3300028800 Bacteria 44609
205 Ga0265320_10021599 3300031240 Bacteria 3458
206 Ga0265320_10193943 3300031240 Unclassified 908
207 Ga0265325_10003682 3300031241 Bacteria 9921
208 Ga0265325_10094616 3300031241 Bacteria 1469
209 Ga0265325_10144436 3300031241 Unclassified 1129
210 Ga0265331_10072556 3300031250 Bacteria 1608
211 Ga0265316_10437442 3300031344 Bacteria 939
212 Ga0307408_100881625 3300031548 Bacteria 818
213 Ga0265313_10070096 3300031595 Bacteria 1616
214 Ga0265313_10077263 3300031595 Unclassified 1520
215 Ga0265314_10016684 3300031711 Bacteria 5790
216 Ga0307405_10279594 3300031731 Bacteria 1256
217 Ga0307406_10235052 3300031901 Bacteria 1371
218 Ga0373944_0073940 3300035089 Bacteria 1115
219 Ga0373935_0640864 3300035692 Bacteria 779
220 Ga0395905_0016531 3300037471 Bacteria 7014
221 Ga0395901_0004197 3300038443 Bacteria 14527
222 Ga0436365_0401065 3300039437 Unclassified 754
223 Ga0436365_0596811 3300039437 Bacteria 6859
224 Ga0451853_0185214 3300041512 Bacteria 1694
225 Ga0466963_0480270 3300044694 Bacteria 877
226 Ga0466957_1059593 3300044842 Bacteria 584
227 Ga0495594_0163906 3300046499 Bacteria 1264
228 Ga0495621_0091596 3300046539 Bacteria 1146
229 Ga0496112_0010154 3300048915 Bacteria 8531
230 Ga0501033_0531701 3300049570 Bacteria 811
231 Ga0501036_0202615 3300049572 Bacteria 1669
232 Ga0501040_0238020 3300049576 Bacteria 1297
233 Ga0501041_0277555 3300049577 Bacteria 1054
234 Ga0501043_0458365 3300049579 Bacteria 957
235 Ga0501046_0078096 3300049580 Bacteria 2562
236 Ga0501068_0015987 3300049584 Bacteria 4322
237 Ga0501068_0695834 3300049584 Bacteria 665
238 Ga0501069_0051204 3300049585 Bacteria 2298
239 Ga0501071_0827936 3300049587 Bacteria 714
240 Ga0501072_0065746 3300049588 Bacteria 2860
241 Ga0501075_0071206 3300049591 Bacteria 2628
242 Ga0501075_0178083 3300049591 Bacteria 1622
243 Ga0501076_0169725 3300049592 Bacteria 1778
244 Ga0501080_0184136 3300049742 Bacteria 1921
245 Ga0501081_0100702 3300049743 Bacteria 2042
246 Ga0501081_0237528 3300049743 Bacteria 1328
247 Ga0501045_0077225 3300049824 Bacteria 2454
248 Ga0501045_0179158 3300049824 Bacteria 1579
249 nmdc:mga09592_4440_c1 3300050508 Bacteria 11354
250 nmdc:mga09592_464780_c1 3300050508 Unclassified 1091
251 nmdc:mga0qj67_174008_c1 3300050509 Bacteria 1748
252 nmdc:mga0qj67_66091_c1 3300050509 Bacteria 2880
253 nmdc:mga06r32_1134781_c1 3300050510 Bacteria 730
254 nmdc:mga08y16_422165_c1 3300050511 Bacteria 1363
255 nmdc:mga08y16_615919_c1 3300050511 Bacteria 1093
256 nmdc:mga0n895_74619_c1 3300050512 Bacteria 3370
257 nmdc:mga0a205_117765_c1 3300050515 Bacteria 2555
258 Ga0500642_0009462 3300053130 Bacteria 3384
259 Ga0500611_000120 3300053727 Bacteria 16925
260 Ga0501082_0134065 3300060353 Bacteria 2149
261 Ga0530510_0647823 3300061734 Bacteria 804
262 Ga0065712_10110264
263 MBSR1b_contig_7539689
264 rootL2_10045078
265 Ga0065714_10079247
266 Ga0065712_10004492
267 Ga0065712_10091792
268 Ga0065712_10237799
269 Ga0065715_10091391
270 Ga0065715_10160737
271 Ga0065707_10119808
272 Ga0070658_10173942
273 Ga0070683_100004686
274 Ga0070670_100082783
275 Ga0070677_10049180
276 Ga0070677_10094931
277 Ga0068869_100044065
278 Ga0070680_100004431
279 Ga0070680_100152248
280 Ga0070680_100171598
281 Ga0070680_100335283
282 Ga0070682_100004515
283 Ga0070682_100011750
284 Ga0070682_100019543
285 Ga0068868_100125928
286 Ga0070689_100033479
287 Ga0070691_10032300
288 Ga0070687_100028383
289 Ga0070687_100160143
290 Ga0070687_100258341
291 Ga0070661_100002112
292 Ga0070669_100012364
293 Ga0070675_100134739
294 Ga0070673_100019546
295 Ga0070673_100451653
296 Ga0070659_100461896
297 Ga0070713_100463536
298 Ga0070700_100219255
299 Ga0070708_100094667
300 Ga0070663_100264117
301 Ga0070678_100006134
302 Ga0070678_100093912
303 Ga0070662_100007084
304 Ga0070681_10000634
305 Ga0070681_10001199
306 Ga0070681_10022756
307 Ga0068867_100579994
308 Ga0070685_10000956
309 Ga0070685_10053737
310 Ga0070685_10126946
311 Ga0070706_100031209
312 Ga0070706_100338872
313 Ga0070698_100009027
314 Ga0070698_100037131
315 Ga0070698_100425155
316 Ga0070699_100059496
317 Ga0070699_100143554
318 Ga0070679_100001705
319 Ga0070679_100018087
320 Ga0070684_100001809
321 Ga0070697_100058684
322 Ga0070672_100083503
323 Ga0070695_100002334
324 Ga0070695_100401569
325 Ga0070696_100011363
326 Ga0070696_100291353
327 Ga0070696_100786801
328 Ga0070693_100001465
329 Ga0070704_100188517
330 Ga0068855_100000786
331 Ga0070664_100047026
332 Ga0068857_100108858
333 Ga0070702_100032046
334 Ga0070702_100191428
335 Ga0070702_100420531
336 Ga0068852_100610364
337 Ga0068859_100403196
338 Ga0068859_100462997
339 Ga0068864_100252863
340 Ga0068866_10010723
341 Ga0068861_100020658
342 Ga0068861_100100408
343 Ga0068863_100126575
344 Ga0068863_100242329
345 Ga0068863_100385773
346 Ga0068858_100183056
347 Ga0068862_100177113
348 Ga0081539_10051562
349 Ga0070717_10058033
350 Ga0070715_10048647
351 Ga0097621_100544672
352 Ga0075428_100039735
353 Ga0075428_100056004
354 Ga0075428_100621765
355 Ga0075428_101338164
356 Ga0075430_100040831
357 Ga0075431_100136252
358 Ga0075431_100651928
359 Ga0075433_10006321
360 Ga0075434_100000232
361 Ga0075429_100009652
362 Ga0075429_100056204
363 Ga0068865_100502976
364 Ga0097620_100403200
365 Ga0097620_100463003
366 Ga0111539_10141171
367 Ga0111539_10152052
368 Ga0111539_10886761
369 Ga0105245_10006426
370 Ga0105245_10007134
371 Ga0105245_10098562
372 Ga0114129_10078699
373 Ga0114129_11808343
374 Ga0105241_10708077
375 Ga0105242_10450565
376 Ga0105242_10762383
377 Ga0105249_10024665
378 Ga0105249_10051584
379 Ga0105249_10472102
380 Ga0105249_10563807
381 Ga0105249_11152577
382 Ga0105246_10031444
383 Ga0157374_11291371
384 Ga0157378_10009724
385 Ga0157378_10034917
386 Ga0157378_10052420
387 Ga0157378_10745375
388 Ga0163162_10249396
389 Ga0163162_10614075
390 Ga0157372_10012291
391 Ga0157372_10180842
392 Ga0157372_10389703
393 Ga0163163_10608950
394 Ga0163163_10723692
395 Ga0157380_10065161
396 Ga0157380_10113516
397 Ga0157380_10330186
398 Ga0157380_10427098
399 Ga0157377_10063253
400 Ga0157379_10099073
401 Ga0157376_10067972
402 Ga0163161_10164898
403 Ga0213876_10038842
404 Ga0207682_10004309
405 Ga0207642_10007677
406 Ga0207685_10223899
407 Ga0207645_10081255
408 Ga0207643_10002416
409 Ga0207707_10004020
410 Ga0207707_10031176
411 Ga0207707_10266965
412 Ga0207660_10001575
413 Ga0207660_10128238
414 Ga0207662_10007245
415 Ga0207662_10010676
416 Ga0207662_10211819
417 Ga0207652_10002181
418 Ga0207652_10075675
419 Ga0207681_10035727
420 Ga0207681_10546742
421 Ga0207659_10279947
422 Ga0207700_10036381
423 Ga0207700_10276497
424 Ga0207706_10012538
425 Ga0207686_10000367
426 Ga0207670_10008044
427 Ga0207669_10169118
428 Ga0207704_10020538
429 Ga0207704_10071192
430 Ga0207691_10216641
431 Ga0207711_10761444
432 Ga0207689_10088185
433 Ga0207689_10730723
434 Ga0207661_10003053
435 Ga0207667_10136804
436 Ga0207651_10129934
437 Ga0207651_10374964
438 Ga0207712_10010939
439 Ga0207712_10020303
440 Ga0207640_10052936
441 Ga0207658_10256700
442 Ga0207677_10015141
443 Ga0207703_10203736
444 Ga0207639_10099858
445 Ga0207708_10002821
446 Ga0207708_10255786
447 Ga0207641_10000873
448 Ga0207648_10202663
449 Ga0207648_10294904
450 Ga0207648_10867100
451 Ga0207676_10015440
452 Ga0207674_10126301
453 Ga0207674_10143273
454 Ga0207675_100138164
455 Ga0207683_10018499
456 Ga0209996_1021979
457 Ga0209996_1022519
458 Ga0209999_1002956
459 Ga0209966_1002144
460 Ga0209998_10001135
461 Ga0209974_10026828
462 Ga0268265_10278774
463 Ga0268265_10308278
464 Ga0265323_10032950
465 Ga0265338_10001114
466 Ga0265320_10021599
467 Ga0265320_10193943
468 Ga0265325_10003682
469 Ga0265325_10094616
470 Ga0265325_10144436
471 Ga0265331_10072556
472 Ga0265316_10437442
473 Ga0307408_100881625
474 Ga0265313_10070096
475 Ga0265313_10077263
476 Ga0265314_10016684
477 Ga0307405_10279594
478 Ga0307406_10235052
479 Ga0373944_0073940
480 Ga0373935_0640864
481 Ga0395905_0016531
482 Ga0395901_0004197
483 Ga0436365_0401065
484 Ga0436365_0596811
485 Ga0451853_0185214
486 Ga0466963_0480270
487 Ga0466957_1059593
488 Ga0495594_0163906
489 Ga0495621_0091596
490 Ga0496112_0010154
491 Ga0501033_0531701
492 Ga0501036_0202615
493 Ga0501040_0238020
494 Ga0501041_0277555
495 Ga0501043_0458365
496 Ga0501046_0078096
497 Ga0501068_0015987
498 Ga0501068_0695834
499 Ga0501069_0051204
500 Ga0501071_0827936
501 Ga0501072_0065746
502 Ga0501075_0071206
503 Ga0501075_0178083
504 Ga0501076_0169725
505 Ga0501080_0184136
506 Ga0501081_0100702
507 Ga0501081_0237528
508 Ga0501045_0077225
509 Ga0501045_0179158
510 nmdc:mga09592_4440_c1
511 nmdc:mga09592_464780_c1
512 nmdc:mga0qj67_174008_c1
513 nmdc:mga0qj67_66091_c1
514 nmdc:mga06r32_1134781_c1
515 nmdc:mga08y16_422165_c1
516 nmdc:mga08y16_615919_c1
517 nmdc:mga0n895_74619_c1
518 nmdc:mga0a205_117765_c1
519 Ga0500642_0009462
520 Ga0500611_000120
521 Ga0501082_0134065
522 Ga0530510_0647823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

29

237

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9118 19 232
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9074 19 230
4aaj-assembly1.cif.gz_A structure of n-(5'-phosphoribosyl)anthranilate isomerase from pyrococcus furiosus 0.9045 19 230
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.8981 19 232
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.8859 19 230
ID Description Score Start End Superfamily
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9158 19 227 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9118 19 232 3.20.20.70
4aajA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9045 19 230 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8981 19 232 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8865 19 227 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A350BP87-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase 0.9961 19 105 GO:0016853
AF-A0A838TJH5-F1-model_v4 Phosphoribosylanthranilate isomerase 0.9842 17 95 GO:0016853
AF-A0A7Y2P4P6-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9816 61 229 GO:0000162
GO:0004640
GO:0006568
AF-A0A3B9YYZ1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase 0.979 17 117 GO:0016853
AF-A0A838TH98-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9783 99 230 GO:0000162
GO:0004640
GO:0006568

Map