F369692

General Info

Members Datasets Scaffolds Average Seq Length
260 197 520 202

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0096756|Ga0373955_0096756_268_960
Length 230
Sequence MEALGIEGAWVFTPQVYQDDRGAFFEAFRGGEFAADLGYRLDVAQVNCSVSRRGVIRGIHYADVPPGQAKYVTCVRGAVLDVVADLRAGSPGFGKWEAVRLDEDSRKAVFLAEGLGHGFMALSDAATVLYLCSTPYAPGREHGVNPLDPAIGISWPLEKTDDGPVLSEKDAAAPTLDEALRQGRLPRYEDCVAYAAGLRGQPVPPALDIRPRPAWRARRVRVPRASRRWV

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
118 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
131 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
182 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
183 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
184 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
185 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
186 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
187 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
188 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
189 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
190 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
191 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
192 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
193 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
194 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
195 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
196 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
197 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.69
Metatranscriptomes 1.54
Isolates 5.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 5
Rhizosphere 87.31
Stem 0
Stem Tuber 0.38
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0096756 3300035172 Bacteria 1689
2 JGI24735J21928_10121793 3300002067 Bacteria 751
3 rootH1_10103119 3300003323 Bacteria 5915
4 Ga0070683_100236714 3300005329 Bacteria 1736
5 Ga0070683_100739733 3300005329 Bacteria 942
6 Ga0068869_100153217 3300005334 Bacteria 1789
7 Ga0070680_100013851 3300005336 Bacteria 6291
8 Ga0070660_100103052 3300005339 Bacteria 2263
9 Ga0070689_100185416 3300005340 Bacteria 1692
10 Ga0070691_10084639 3300005341 Bacteria 1557
11 Ga0070691_10483270 3300005341 Bacteria 713
12 Ga0070659_100033221 3300005366 Bacteria 4006
13 Ga0070709_10063516 3300005434 Bacteria 2359
14 Ga0070709_10174334 3300005434 Bacteria 1505
15 Ga0070714_100018674 3300005435 Bacteria 5638
16 Ga0070714_100131360 3300005435 Bacteria 2238
17 Ga0070714_100145616 3300005435 Bacteria 2131
18 Ga0070714_100190650 3300005435 Bacteria 1870
19 Ga0070713_100006959 3300005436 Bacteria 7896
20 Ga0070713_100012635 3300005436 Bacteria 6204
21 Ga0070713_100137137 3300005436 Bacteria 2163
22 Ga0070710_10040445 3300005437 Bacteria 2570
23 Ga0070711_100463276 3300005439 Bacteria 1039
24 Ga0070700_100044648 3300005441 Bacteria 2731
25 Ga0070679_100271602 3300005530 Bacteria 1649
26 Ga0070684_100039561 3300005535 Bacteria 4057
27 Ga0070684_100212168 3300005535 Bacteria 1764
28 Ga0068853_100520627 3300005539 Bacteria 1124
29 Ga0070665_100029329 3300005548 Bacteria 5538
30 Ga0070665_100208265 3300005548 Bacteria 1956
31 Ga0068855_100177785 3300005563 Bacteria 2407
32 Ga0070664_100805994 3300005564 Bacteria 878
33 Ga0068857_100033535 3300005577 Bacteria 4540
34 Ga0068857_100272546 3300005577 Bacteria 1555
35 Ga0068854_100130308 3300005578 Bacteria 1920
36 Ga0068854_100201386 3300005578 Bacteria 1565
37 Ga0068856_100100331 3300005614 Bacteria 2887
38 Ga0070702_100649694 3300005615 Bacteria 797
39 Ga0068852_100554443 3300005616 Bacteria 1150
40 Ga0068859_100134013 3300005617 Bacteria 2549
41 Ga0068859_100826792 3300005617 Bacteria 1013
42 Ga0068864_100073486 3300005618 Bacteria 2981
43 Ga0068861_101034122 3300005719 Bacteria 786
44 Ga0068863_100178101 3300005841 Bacteria 2041
45 Ga0068863_100324263 3300005841 Bacteria 1496
46 Ga0070717_10015096 3300006028 Bacteria 5956
47 Ga0070716_100114444 3300006173 Bacteria 1677
48 Ga0070712_100246797 3300006175 Bacteria 1424
49 Ga0070712_100282256 3300006175 Bacteria 1338
50 Ga0070712_100582415 3300006175 Bacteria 945
51 Ga0075369_10006947 3300006186 Bacteria 4298
52 Ga0075428_100005890 3300006844 Bacteria 13621
53 Ga0075430_100003460 3300006846 Bacteria 13211
54 Ga0075431_100000653 3300006847 Bacteria 29443
55 Ga0075429_100003597 3300006880 Bacteria 13211
56 Ga0075429_100440558 3300006880 Bacteria 1142
57 Ga0097620_100134015 3300006931 Bacteria 2549
58 Ga0097620_100826897 3300006931 Bacteria 1013
59 Ga0105240_10217742 3300009093 Bacteria 2226
60 Ga0105240_10359564 3300009093 Bacteria 1649
61 Ga0114129_10004600 3300009147 Bacteria 19479
62 Ga0114129_10134095 3300009147 Bacteria 3399
63 Ga0105241_10003384 3300009174 Bacteria 11880
64 Ga0105248_10128955 3300009177 Bacteria 2853
65 Ga0105248_10134771 3300009177 Bacteria 2786
66 Ga0105237_10431980 3300009545 Bacteria 1323
67 Ga0105237_10717147 3300009545 Bacteria 1007
68 Ga0105238_10018667 3300009551 Bacteria 7062
69 Ga0105239_10134378 3300010375 Bacteria 2753
70 Ga0105239_10237603 3300010375 Bacteria 2045
71 Ga0157371_10165197 3300013102 Bacteria 1581
72 Ga0157370_10069922 3300013104 Bacteria 3315
73 Ga0157369_10045005 3300013105 Bacteria 4802
74 Ga0157369_10269094 3300013105 Bacteria 1776
75 Ga0157369_10314825 3300013105 Bacteria 1627
76 Ga0157374_10024079 3300013296 Bacteria 5453
77 Ga0163163_10376066 3300014325 Bacteria 1478
78 Ga0206356_10276334 3300020070 Bacteria 1588
79 Ga0206353_10465993 3300020082 Bacteria 717
80 Ga0224712_10010468 3300022467 Bacteria 2839
81 Ga0207692_10065565 3300025898 Bacteria 1895
82 Ga0207647_10009081 3300025904 Bacteria 7079
83 Ga0207699_10381579 3300025906 Bacteria 1000
84 Ga0207699_10692312 3300025906 Bacteria 746
85 Ga0207699_10851218 3300025906 Bacteria 672
86 Ga0207705_10217112 3300025909 Bacteria 1451
87 Ga0207654_10001659 3300025911 Bacteria 11632
88 Ga0207707_10020668 3300025912 Bacteria 5749
89 Ga0207695_10000796 3300025913 Bacteria 59143
90 Ga0207695_10412256 3300025913 Bacteria 1235
91 Ga0207671_10000188 3300025914 Bacteria 95365
92 Ga0207693_10025219 3300025915 Bacteria 4715
93 Ga0207693_10404104 3300025915 Bacteria 1068
94 Ga0207693_10409689 3300025915 Bacteria 1060
95 Ga0207663_10863647 3300025916 Bacteria 722
96 Ga0207660_10412815 3300025917 Bacteria 1088
97 Ga0207657_10035913 3300025919 Bacteria 4439
98 Ga0207652_10007986 3300025921 Bacteria 8492
99 Ga0207652_10678817 3300025921 Bacteria 920
100 Ga0207694_10000164 3300025924 Bacteria 68118
101 Ga0207700_10015113 3300025928 Bacteria 5079
102 Ga0207700_10078649 3300025928 Bacteria 2566
103 Ga0207700_10163976 3300025928 Bacteria 1848
104 Ga0207700_10447459 3300025928 Bacteria 1138
105 Ga0207664_10003186 3300025929 Bacteria 10906
106 Ga0207664_10009124 3300025929 Bacteria 6948
107 Ga0207664_10118262 3300025929 Bacteria 2214
108 Ga0207664_10539434 3300025929 Bacteria 1046
109 Ga0207670_10147255 3300025936 Bacteria 1743
110 Ga0207665_10070749 3300025939 Bacteria 2381
111 Ga0207711_10073467 3300025941 Bacteria 2972
112 Ga0207711_10169111 3300025941 Bacteria 1983
113 Ga0207661_10162382 3300025944 Bacteria 1939
114 Ga0207661_10182423 3300025944 Bacteria 1834
115 Ga0207679_10379441 3300025945 Bacteria 1239
116 Ga0207667_10340496 3300025949 Bacteria 1530
117 Ga0207640_10142153 3300025981 Bacteria 1751
118 Ga0207703_10895089 3300026035 Bacteria 850
119 Ga0207639_10475030 3300026041 Bacteria 1139
120 Ga0207678_10070312 3300026067 Bacteria 3001
121 Ga0207678_10081669 3300026067 Bacteria 2767
122 Ga0207702_10663272 3300026078 Bacteria 1026
123 Ga0207641_10056921 3300026088 Bacteria 3324
124 Ga0207676_10516284 3300026095 Bacteria 1137
125 Ga0207674_10043821 3300026116 Bacteria 4611
126 Ga0207683_10608570 3300026121 Bacteria 1012
127 Ga0207698_10301697 3300026142 Bacteria 1491
128 Ga0207698_11030039 3300026142 Bacteria 834
129 Ga0268266_10034448 3300028379 Bacteria 4307
130 Ga0268265_10398655 3300028380 Bacteria 1271
131 Ga0265337_1002026 3300028556 Bacteria 9621
132 Ga0265326_10011598 3300028558 Bacteria 2594
133 Ga0265319_1001246 3300028563 Bacteria 15553
134 Ga0265334_10000373 3300028573 Bacteria 23956
135 Ga0265318_10045474 3300028577 Bacteria 1659
136 Ga0265323_10003239 3300028653 Bacteria 7252
137 Ga0265336_10004017 3300028666 Bacteria 5620
138 Ga0265338_10009796 3300028800 Bacteria 11362
139 Ga0265338_10012550 3300028800 Bacteria 9650
140 Ga0265338_10016218 3300028800 Bacteria 8121
141 Ga0265324_10005450 3300029957 Bacteria 5494
142 Ga0265332_10004755 3300031238 Bacteria 6330
143 Ga0265329_10083975 3300031242 Bacteria 1009
144 Ga0265340_10011207 3300031247 Bacteria 4774
145 Ga0265316_10020130 3300031344 Bacteria 5686
146 Ga0307408_100111922 3300031548 Bacteria 2098
147 Ga0265313_10023599 3300031595 Bacteria 3310
148 Ga0310108_109880 3300031633 Bacteria 1025
149 Ga0265314_10026463 3300031711 Bacteria 4357
150 Ga0265342_10007372 3300031712 Bacteria 8064
151 Ga0307516_10013007 3300031730 Bacteria 8915
152 Ga0307413_10010278 3300031824 Bacteria 4530
153 Ga0307410_11079066 3300031852 Bacteria 695
154 Ga0326468_10003094 3300031889 Bacteria 1398
155 Ga0307406_10017200 3300031901 Bacteria 4209
156 Ga0307406_10309100 3300031901 Bacteria 1218
157 Ga0307409_100144783 3300031995 Bacteria 2053
158 Ga0307416_100030599 3300032002 Bacteria 4041
159 Ga0307416_100746164 3300032002 Bacteria 1071
160 Ga0307411_10173538 3300032005 Bacteria 1629
161 Ga0307415_100081527 3300032126 Bacteria 2311
162 Ga0316214_1000482 3300033545 Bacteria 4073
163 Ga0316212_1003331 3300033547 Bacteria 2316
164 Ga0373934_0012249 3300035086 Bacteria 3237
165 Ga0373923_0005794 3300035111 Bacteria 4218
166 Ga0373936_0206357 3300035113 Bacteria 868
167 Ga0373953_0017318 3300035117 Bacteria 2647
168 Ga0373953_0020643 3300035117 Bacteria 2462
169 Ga0373956_0253144 3300035119 Bacteria 837
170 Ga0373957_0013050 3300035120 Bacteria 2811
171 Ga0373937_0259471 3300036401 Bacteria 1638
172 Ga0373937_0271984 3300036401 Bacteria 1599
173 Ga0395900_0264653 3300037418 Bacteria 1716
174 Ga0395898_0159363 3300037466 Bacteria 2158
175 Ga0395901_0805794 3300038443 Bacteria 928
176 Ga0451853_2176132 3300041512 Bacteria 1320
177 Ga0439463_025034 3300042016 Bacteria 1496
178 Ga0439459_0011830 3300042438 Bacteria 1544
179 Ga0466969_0029892 3300044656 Bacteria 2779
180 Ga0466966_0094965 3300044684 Bacteria 1848
181 Ga0466961_0178641 3300044693 Bacteria 1318
182 Ga0466970_0092237 3300044765 Bacteria 1645
183 Ga0466970_0108807 3300044765 Bacteria 1513
184 Ga0466970_0413452 3300044765 Bacteria 770
185 Ga0466959_0061272 3300045049 Bacteria 2736
186 Ga0466958_0159867 3300045836 Bacteria 1423
187 Ga0466967_0027623 3300045976 Bacteria 4723
188 Ga0466967_0730903 3300045976 Bacteria 981
189 Ga0466967_1337048 3300045976 Bacteria 714
190 Ga0495653_0059073 3300046463 Bacteria 2912
191 Ga0495662_0123742 3300046476 Bacteria 1270
192 Ga0495662_0252104 3300046476 Bacteria 869
193 Ga0495664_0069284 3300046477 Bacteria 2105
194 Ga0495608_0039487 3300046511 Bacteria 3163
195 Ga0495608_0305732 3300046511 Bacteria 984
196 Ga0495618_0181734 3300046514 Bacteria 1336
197 Ga0495628_0056365 3300046516 Bacteria 3093
198 Ga0495630_0146770 3300046517 Bacteria 1794
199 Ga0495652_0024425 3300046529 Bacteria 5349
200 Ga0495586_0019942 3300046535 Bacteria 3571
201 Ga0495587_0019981 3300046536 Bacteria 4140
202 Ga0495645_0187652 3300046543 Bacteria 1411
203 Ga0495634_0031626 3300046642 Bacteria 3643
204 Ga0495635_0027723 3300046663 Bacteria 3939
205 Ga0495657_0150435 3300046675 Bacteria 1445
206 Ga0495599_0047029 3300046678 Bacteria 2704
207 Ga0495646_0126416 3300046680 Bacteria 1442
208 Ga0495613_0020255 3300046689 Bacteria 4959
209 Ga0495613_0360044 3300046689 Unclassified 998
210 Ga0495600_0003021 3300046809 Bacteria 9821
211 Ga0495604_0011914 3300047317 Bacteria 6915
212 Ga0495680_0035184 3300047322 Bacteria 4036
213 Ga0495680_0264863 3300047322 Bacteria 1215
214 Ga0495602_0366397 3300048088 Bacteria 1036
215 Ga0496102_0242033 3300048905 Bacteria 1701
216 Ga0496104_0253335 3300048907 Bacteria 1673
217 Ga0496104_0278278 3300048907 Bacteria 1586
218 Ga0496108_0019825 3300048911 Bacteria 5525
219 Ga0496108_0128574 3300048911 Bacteria 2176
220 Ga0496108_0435186 3300048911 Bacteria 1146
221 Ga0496110_0051616 3300048913 Bacteria 3614
222 Ga0496112_0186697 3300048915 Bacteria 2036
223 Ga0496112_0275479 3300048915 Bacteria 1630
224 Ga0496113_0370400 3300048916 Bacteria 1150
225 Ga0496113_0443318 3300048916 Bacteria 1043
226 Ga0496114_0027755 3300048917 Bacteria 4640
227 Ga0496115_0359173 3300048918 Bacteria 1187
228 Ga0496117_0001796 3300048920 Bacteria 29192
229 Ga0496119_0059837 3300048922 Bacteria 2285
230 Ga0496124_0003516 3300048927 Bacteria 19082
231 Ga0496126_0021509 3300048929 Bacteria 6299
232 Ga0501070_0026852 3300049586 Bacteria 4829
233 Ga0501080_0017544 3300049742 Bacteria 6620
234 Ga0501080_0975486 3300049742 Bacteria 736
235 nmdc:mga06z11_155062_c1 3300050494 Bacteria 1305
236 nmdc:mga05p37_1060963_c1 3300050507 Bacteria 853
237 nmdc:mga05p37_8305_c1 3300050507 Bacteria 12276
238 nmdc:mga09592_3087_c1 3300050508 Bacteria 13515
239 nmdc:mga09592_544587_c1 3300050508 Bacteria 997
240 nmdc:mga0qj67_286_c1 3300050509 Bacteria 35189
241 nmdc:mga06r32_460_c1 3300050510 Bacteria 34832
242 Ga0495595_0034362 3300053084 Bacteria 2293
243 Ga0495619_0235508 3300053085 Bacteria 1269
244 Ga0500646_0000289 3300053090 Bacteria 15420
245 Ga0500600_0147668 3300053149 Bacteria 1174
246 2753302581 2751185788 Bacteria 4541048
247 2842889850 2842888712 Bacteria 4279094
248 2867308543 2867302475 Bacteria 7087181
249 2899373106 2899370129 Bacteria 6781179
250 2904433598 2904430863 Bacteria 3486923
251 2904503879 2904501621 Bacteria 3401437
252 2908676845 2908674828 Bacteria 3382763
253 2909076968 2909074476 Bacteria 3436050
254 2912730448 2912723979 Bacteria 8557534
255 2919042977 2919042368 Bacteria 3905917
256 2928105907 2928104781 Bacteria 3877447
257 2928501987 2928500415 Bacteria 3384541
258 2956940707 2956939328 Bacteria 3474458
259 2984554739 2984551494 Bacteria 3877562
260 3001120387 3001119090 Bacteria 3449530
261 Ga0373955_0096756
262 JGI24735J21928_10121793
263 rootH1_10103119
264 Ga0070683_100236714
265 Ga0070683_100739733
266 Ga0068869_100153217
267 Ga0070680_100013851
268 Ga0070660_100103052
269 Ga0070689_100185416
270 Ga0070691_10084639
271 Ga0070691_10483270
272 Ga0070659_100033221
273 Ga0070709_10063516
274 Ga0070709_10174334
275 Ga0070714_100018674
276 Ga0070714_100131360
277 Ga0070714_100145616
278 Ga0070714_100190650
279 Ga0070713_100006959
280 Ga0070713_100012635
281 Ga0070713_100137137
282 Ga0070710_10040445
283 Ga0070711_100463276
284 Ga0070700_100044648
285 Ga0070679_100271602
286 Ga0070684_100039561
287 Ga0070684_100212168
288 Ga0068853_100520627
289 Ga0070665_100029329
290 Ga0070665_100208265
291 Ga0068855_100177785
292 Ga0070664_100805994
293 Ga0068857_100033535
294 Ga0068857_100272546
295 Ga0068854_100130308
296 Ga0068854_100201386
297 Ga0068856_100100331
298 Ga0070702_100649694
299 Ga0068852_100554443
300 Ga0068859_100134013
301 Ga0068859_100826792
302 Ga0068864_100073486
303 Ga0068861_101034122
304 Ga0068863_100178101
305 Ga0068863_100324263
306 Ga0070717_10015096
307 Ga0070716_100114444
308 Ga0070712_100246797
309 Ga0070712_100282256
310 Ga0070712_100582415
311 Ga0075369_10006947
312 Ga0075428_100005890
313 Ga0075430_100003460
314 Ga0075431_100000653
315 Ga0075429_100003597
316 Ga0075429_100440558
317 Ga0097620_100134015
318 Ga0097620_100826897
319 Ga0105240_10217742
320 Ga0105240_10359564
321 Ga0114129_10004600
322 Ga0114129_10134095
323 Ga0105241_10003384
324 Ga0105248_10128955
325 Ga0105248_10134771
326 Ga0105237_10431980
327 Ga0105237_10717147
328 Ga0105238_10018667
329 Ga0105239_10134378
330 Ga0105239_10237603
331 Ga0157371_10165197
332 Ga0157370_10069922
333 Ga0157369_10045005
334 Ga0157369_10269094
335 Ga0157369_10314825
336 Ga0157374_10024079
337 Ga0163163_10376066
338 Ga0206356_10276334
339 Ga0206353_10465993
340 Ga0224712_10010468
341 Ga0207692_10065565
342 Ga0207647_10009081
343 Ga0207699_10381579
344 Ga0207699_10692312
345 Ga0207699_10851218
346 Ga0207705_10217112
347 Ga0207654_10001659
348 Ga0207707_10020668
349 Ga0207695_10000796
350 Ga0207695_10412256
351 Ga0207671_10000188
352 Ga0207693_10025219
353 Ga0207693_10404104
354 Ga0207693_10409689
355 Ga0207663_10863647
356 Ga0207660_10412815
357 Ga0207657_10035913
358 Ga0207652_10007986
359 Ga0207652_10678817
360 Ga0207694_10000164
361 Ga0207700_10015113
362 Ga0207700_10078649
363 Ga0207700_10163976
364 Ga0207700_10447459
365 Ga0207664_10003186
366 Ga0207664_10009124
367 Ga0207664_10118262
368 Ga0207664_10539434
369 Ga0207670_10147255
370 Ga0207665_10070749
371 Ga0207711_10073467
372 Ga0207711_10169111
373 Ga0207661_10162382
374 Ga0207661_10182423
375 Ga0207679_10379441
376 Ga0207667_10340496
377 Ga0207640_10142153
378 Ga0207703_10895089
379 Ga0207639_10475030
380 Ga0207678_10070312
381 Ga0207678_10081669
382 Ga0207702_10663272
383 Ga0207641_10056921
384 Ga0207676_10516284
385 Ga0207674_10043821
386 Ga0207683_10608570
387 Ga0207698_10301697
388 Ga0207698_11030039
389 Ga0268266_10034448
390 Ga0268265_10398655
391 Ga0265337_1002026
392 Ga0265326_10011598
393 Ga0265319_1001246
394 Ga0265334_10000373
395 Ga0265318_10045474
396 Ga0265323_10003239
397 Ga0265336_10004017
398 Ga0265338_10009796
399 Ga0265338_10012550
400 Ga0265338_10016218
401 Ga0265324_10005450
402 Ga0265332_10004755
403 Ga0265329_10083975
404 Ga0265340_10011207
405 Ga0265316_10020130
406 Ga0307408_100111922
407 Ga0265313_10023599
408 Ga0310108_109880
409 Ga0265314_10026463
410 Ga0265342_10007372
411 Ga0307516_10013007
412 Ga0307413_10010278
413 Ga0307410_11079066
414 Ga0326468_10003094
415 Ga0307406_10017200
416 Ga0307406_10309100
417 Ga0307409_100144783
418 Ga0307416_100030599
419 Ga0307416_100746164
420 Ga0307411_10173538
421 Ga0307415_100081527
422 Ga0316214_1000482
423 Ga0316212_1003331
424 Ga0373934_0012249
425 Ga0373923_0005794
426 Ga0373936_0206357
427 Ga0373953_0017318
428 Ga0373953_0020643
429 Ga0373956_0253144
430 Ga0373957_0013050
431 Ga0373937_0259471
432 Ga0373937_0271984
433 Ga0395900_0264653
434 Ga0395898_0159363
435 Ga0395901_0805794
436 Ga0451853_2176132
437 Ga0439463_025034
438 Ga0439459_0011830
439 Ga0466969_0029892
440 Ga0466966_0094965
441 Ga0466961_0178641
442 Ga0466970_0092237
443 Ga0466970_0108807
444 Ga0466970_0413452
445 Ga0466959_0061272
446 Ga0466958_0159867
447 Ga0466967_0027623
448 Ga0466967_0730903
449 Ga0466967_1337048
450 Ga0495653_0059073
451 Ga0495662_0123742
452 Ga0495662_0252104
453 Ga0495664_0069284
454 Ga0495608_0039487
455 Ga0495608_0305732
456 Ga0495618_0181734
457 Ga0495628_0056365
458 Ga0495630_0146770
459 Ga0495652_0024425
460 Ga0495586_0019942
461 Ga0495587_0019981
462 Ga0495645_0187652
463 Ga0495634_0031626
464 Ga0495635_0027723
465 Ga0495657_0150435
466 Ga0495599_0047029
467 Ga0495646_0126416
468 Ga0495613_0020255
469 Ga0495613_0360044
470 Ga0495600_0003021
471 Ga0495604_0011914
472 Ga0495680_0035184
473 Ga0495680_0264863
474 Ga0495602_0366397
475 Ga0496102_0242033
476 Ga0496104_0253335
477 Ga0496104_0278278
478 Ga0496108_0019825
479 Ga0496108_0128574
480 Ga0496108_0435186
481 Ga0496110_0051616
482 Ga0496112_0186697
483 Ga0496112_0275479
484 Ga0496113_0370400
485 Ga0496113_0443318
486 Ga0496114_0027755
487 Ga0496115_0359173
488 Ga0496117_0001796
489 Ga0496119_0059837
490 Ga0496124_0003516
491 Ga0496126_0021509
492 Ga0501070_0026852
493 Ga0501080_0017544
494 Ga0501080_0975486
495 nmdc:mga06z11_155062_c1
496 nmdc:mga05p37_1060963_c1
497 nmdc:mga05p37_8305_c1
498 nmdc:mga09592_3087_c1
499 nmdc:mga09592_544587_c1
500 nmdc:mga0qj67_286_c1
501 nmdc:mga06r32_460_c1
502 Ga0495595_0034362
503 Ga0495619_0235508
504 Ga0500646_0000289
505 Ga0500600_0147668
506 2753302581
507 2842889850
508 2867308543
509 2899373106
510 2904433598
511 2904503879
512 2908676845
513 2909076968
514 2912730448
515 2919042977
516 2928105907
517 2928501987
518 2956940707
519 2984554739
520 3001120387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

3

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c0z-assembly1.cif.gz_A-2 the 1.6 a resolution crystal structure of novw: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of streptomyces spheroides 0.9942 1 189
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9843 1 196
4hn0-assembly1.cif.gz_B crystal structure of chmj, a 3'-monoepimerase apoenzyme from streptomyces bikiniensis 0.979 5 198
4hn1-assembly1.cif.gz_B crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp 0.9783 5 200
7pwh-assembly1.cif.gz_AAA structure of the dtdp-sugar epimerase strm 0.9761 2 200
ID Description Score Start End Superfamily
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9942 1 189 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9868 1 193 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9839 1 189 2.60.120.10
1ofnB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9661 1 197 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.958 2 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1C4WY84-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) 0.9992 6 186 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A841EA54-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) 0.9991 1 198 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3N1L4I9-F1-model_v4 deleted 0.9989 1 197
AF-A0A4Q3XJV0-F1-model_v4 dTDP-4-keto-6-deoxy-D-glucose epimerase 0.9987 1 137 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A0W7XBU8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9977 1 197 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map