F369663

General Info

Members Datasets Scaffolds Average Seq Length
260 156 260 268

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10044003|Ga0316578_100440034
Length 290
Sequence MPPAAVGITSIHRLPRTEFDMGAEANASPVSIATLRRMKAQNEKIACLTCYDASFTRVLEEAGVDVFIIGDTLGMVIQGHESTVSVTMQDMIYHAAIVARIGRRALRVVDMPFMSYASRDHALENAARLMREGGAHMVKLEGGSVMAGVVEHLARHAIPVCGHIGLLPQSVYKLGGYRVQGRDEAGAAALVDDARALEAAGADLLVIECVPAELAARLTAAVSIPTIGIGAGPACDGQVLVLYDMLGITPGRRPRFVKDFLEPAGSVPAAITAYVKAVREGNFPGPEHSF

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
102 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
103 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
117 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
118 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
119 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
120 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
123 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.54
Rhizosphere 88.85
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100028253 3300005329 Bacteria 5068
2 Ga0070690_100163484 3300005330 Bacteria 1527
3 Ga0070670_100120704 3300005331 Bacteria 2261
4 Ga0070682_100240489 3300005337 Bacteria 1299
5 Ga0070660_100068517 3300005339 Bacteria 2766
6 Ga0070660_100410246 3300005339 Bacteria 1121
7 Ga0070660_100424639 3300005339 Bacteria 1101
8 Ga0070687_100170093 3300005343 Bacteria 1296
9 Ga0070661_100012118 3300005344 Bacteria 6028
10 Ga0070692_10078034 3300005345 Bacteria 1777
11 Ga0070668_100023271 3300005347 Bacteria 4685
12 Ga0070675_100032800 3300005354 Bacteria 4205
13 Ga0070674_100483491 3300005356 Bacteria 1028
14 Ga0070659_100088637 3300005366 Bacteria 2478
15 Ga0070701_10051852 3300005438 Bacteria 2130
16 Ga0070700_100044170 3300005441 Bacteria 2743
17 Ga0070678_100028661 3300005456 Bacteria 3801
18 Ga0070678_100039382 3300005456 Bacteria 3334
19 Ga0070681_10265039 3300005458 Bacteria 1630
20 Ga0070679_100382901 3300005530 Bacteria 1353
21 Ga0070684_100088502 3300005535 Bacteria 2751
22 Ga0068853_100047599 3300005539 Bacteria 3680
23 Ga0070672_100036029 3300005543 Bacteria 3766
24 Ga0070672_100071364 3300005543 Bacteria 2763
25 Ga0070665_100026798 3300005548 Bacteria 5805
26 Ga0070704_100016857 3300005549 Bacteria 4629
27 Ga0068855_100038948 3300005563 Bacteria 5644
28 Ga0068855_100872875 3300005563 Bacteria 952
29 Ga0068856_100083469 3300005614 Unclassified 3173
30 Ga0068856_100090827 3300005614 Bacteria 3038
31 Ga0068859_100099393 3300005617 Bacteria 2965
32 Ga0068861_100067844 3300005719 Bacteria 2754
33 Ga0068870_10175897 3300005840 Bacteria 1281
34 Ga0068863_100016743 3300005841 Bacteria 7033
35 Ga0068863_100298751 3300005841 Bacteria 1562
36 Ga0068858_100026435 3300005842 Bacteria 5391
37 Ga0068860_100003098 3300005843 Bacteria 17193
38 Ga0068862_100110812 3300005844 Bacteria 2408
39 Ga0068871_100148708 3300006358 Bacteria 1996
40 Ga0068865_100023324 3300006881 Bacteria 4051
41 Ga0068865_100128402 3300006881 Bacteria 1896
42 Ga0068865_100253896 3300006881 Bacteria 1389
43 Ga0097620_100099395 3300006931 Bacteria 2965
44 Ga0105240_10222385 3300009093 Bacteria 2199
45 Ga0111539_10006383 3300009094 Bacteria 15207
46 Ga0105241_10005635 3300009174 Bacteria 9236
47 Ga0105248_10013667 3300009177 Bacteria 8937
48 Ga0105238_10036807 3300009551 Bacteria 4976
49 Ga0105238_10049879 3300009551 Bacteria 4214
50 Ga0105249_10115352 3300009553 Bacteria 2545
51 Ga0105239_10742987 3300010375 Bacteria 1123
52 Ga0105246_10023363 3300011119 Bacteria 4000
53 Ga0105246_10037421 3300011119 Bacteria 3257
54 Ga0157373_10092211 3300013100 Bacteria 2133
55 Ga0157373_10243545 3300013100 Unclassified 1271
56 Ga0157369_10010052 3300013105 Bacteria 10805
57 Ga0157369_10029634 3300013105 Bacteria 6045
58 Ga0157369_10103765 3300013105 Bacteria 3029
59 Ga0157374_10505615 3300013296 Bacteria 1213
60 Ga0163162_10236328 3300013306 Bacteria 1958
61 Ga0157372_10001607 3300013307 Bacteria 24528
62 Ga0157372_10237655 3300013307 Bacteria 2113
63 Ga0157372_10348570 3300013307 Bacteria 1725
64 Ga0157375_10052283 3300013308 Bacteria 4015
65 Ga0157375_10476557 3300013308 Bacteria 1413
66 Ga0163163_10019732 3300014325 Bacteria 6338
67 Ga0163163_10110981 3300014325 Bacteria 2771
68 Ga0182008_10037566 3300014497 Unclassified 2423
69 Ga0157379_10009222 3300014968 Bacteria 8594
70 Ga0157379_10316068 3300014968 Bacteria 1425
71 Ga0157376_10056355 3300014969 Bacteria 3283
72 Ga0207680_10103288 3300025903 Bacteria 1835
73 Ga0207647_10001761 3300025904 Bacteria 16619
74 Ga0207643_10022745 3300025908 Bacteria 3454
75 Ga0207684_10012739 3300025910 Bacteria 7295
76 Ga0207654_10006907 3300025911 Bacteria 5716
77 Ga0207654_10274746 3300025911 Bacteria 1138
78 Ga0207695_10000970 3300025913 Bacteria 51112
79 Ga0207671_10005239 3300025914 Bacteria 12042
80 Ga0207693_10043391 3300025915 Bacteria 3538
81 Ga0207662_10251131 3300025918 Bacteria 1161
82 Ga0207657_10043917 3300025919 Bacteria 3933
83 Ga0207657_10148114 3300025919 Bacteria 1913
84 Ga0207657_10498761 3300025919 Bacteria 954
85 Ga0207649_10046376 3300025920 Bacteria 2669
86 Ga0207681_10033120 3300025923 Bacteria 3387
87 Ga0207694_10083109 3300025924 Bacteria 2518
88 Ga0207650_10138092 3300025925 Bacteria 1914
89 Ga0207650_10263725 3300025925 Bacteria 1398
90 Ga0207659_10048046 3300025926 Bacteria 3021
91 Ga0207644_10214892 3300025931 Bacteria 1522
92 Ga0207690_10223695 3300025932 Bacteria 1441
93 Ga0207709_10044867 3300025935 Bacteria 2674
94 Ga0207669_10344210 3300025937 Bacteria 1149
95 Ga0207704_10021726 3300025938 Bacteria 3424
96 Ga0207704_10152213 3300025938 Bacteria 1634
97 Ga0207704_10248847 3300025938 Bacteria 1333
98 Ga0207691_10004824 3300025940 Bacteria 13041
99 Ga0207691_10087323 3300025940 Bacteria 2798
100 Ga0207711_10049859 3300025941 Bacteria 3584
101 Ga0207689_10093706 3300025942 Bacteria 2467
102 Ga0207689_10104543 3300025942 Bacteria 2327
103 Ga0207689_10132256 3300025942 Bacteria 2054
104 Ga0207661_10708124 3300025944 Bacteria 926
105 Ga0207679_10114443 3300025945 Bacteria 2136
106 Ga0207667_10119611 3300025949 Bacteria 2714
107 Ga0207667_10412629 3300025949 Bacteria 1374
108 Ga0207668_10070406 3300025972 Bacteria 2494
109 Ga0207668_10362588 3300025972 Bacteria 1215
110 Ga0207640_10040117 3300025981 Bacteria 2967
111 Ga0207640_10108596 3300025981 Bacteria 1961
112 Ga0207639_10000361 3300026041 Bacteria 31444
113 Ga0207639_10268683 3300026041 Bacteria 1495
114 Ga0207708_10006842 3300026075 Bacteria 8434
115 Ga0207702_10016960 3300026078 Bacteria 6026
116 Ga0207702_10046728 3300026078 Unclassified 3645
117 Ga0207702_10178600 3300026078 Bacteria 1953
118 Ga0207641_10072215 3300026088 Bacteria 2971
119 Ga0207648_10008641 3300026089 Bacteria 9836
120 Ga0207648_10077024 3300026089 Bacteria 2907
121 Ga0207674_10004738 3300026116 Bacteria 16308
122 Ga0207683_10056531 3300026121 Bacteria 3442
123 Ga0207428_10063974 3300027907 Bacteria 2905
124 Ga0268266_10109706 3300028379 Bacteria 2444
125 Ga0268265_10216265 3300028380 Bacteria 1673
126 Ga0268264_10011519 3300028381 Bacteria 7304
127 Ga0265331_10003341 3300031250 Bacteria 10410
128 Ga0265327_10000136 3300031251 Bacteria 160868
129 Ga0316575_10037832 3300031665 Bacteria 1902
130 Ga0316579_10001118 3300031691 Bacteria 9530
131 Ga0316579_10003335 3300031691 Bacteria 6241
132 Ga0316579_10010113 3300031691 Bacteria 3981
133 Ga0316579_10034654 3300031691 Bacteria 2323
134 Ga0316576_10002904 3300031727 Bacteria 9902
135 Ga0316576_10040646 3300031727 Bacteria 3344
136 Ga0316578_10004087 3300031728 Bacteria 6821
137 Ga0316578_10027739 3300031728 Bacteria 3202
138 Ga0316578_10032179 3300031728 Bacteria 2994
139 Ga0316578_10044003 3300031728 Bacteria 2595
140 Ga0316578_10136826 3300031728 Bacteria 1475
141 Ga0316578_10165932 3300031728 Bacteria 1331
142 Ga0307516_10165048 3300031730 Bacteria 1960
143 Ga0316577_10018749 3300031733 Bacteria 3828
144 Ga0316577_10020502 3300031733 Bacteria 3663
145 Ga0316577_10218622 3300031733 Bacteria 1077
146 Ga0316583_10003350 3300032133 Bacteria 5639
147 Ga0316583_10006431 3300032133 Bacteria 4220
148 Ga0316585_10024012 3300032137 Bacteria 1883
149 Ga0316585_10060365 3300032137 Bacteria 1225
150 Ga0316580_10028994 3300032139 Bacteria 1711
151 Ga0316593_10003931 3300032168 Bacteria 3752
152 Ga0316593_10004210 3300032168 Bacteria 3670
153 Ga0316592_1003781 3300033524 Bacteria 2765
154 Ga0316596_1000172 3300033541 Bacteria 9190
155 Ga0316596_1003954 3300033541 Bacteria 3285
156 Ga0373943_0187742 3300035170 Bacteria 1139
157 Ga0316574_0012338 3300035398 Bacteria 4886
158 Ga0316574_0038678 3300035398 Bacteria 2930
159 Ga0316574_0140216 3300035398 Bacteria 1557
160 Ga0373927_0002019 3300035695 Bacteria 14944
161 Ga0373927_0242543 3300035695 Bacteria 1184
162 Ga0373933_0365685 3300035724 Bacteria 938
163 Ga0373937_0286731 3300036401 Bacteria 1555
164 Ga0316582_0004674 3300036647 Bacteria 6956
165 Ga0316582_0014795 3300036647 Bacteria 4441
166 Ga0316582_0022078 3300036647 Bacteria 3773
167 Ga0316582_0041994 3300036647 Bacteria 2862
168 Ga0316582_0272391 3300036647 Bacteria 1161
169 Ga0316584_0009278 3300036712 Bacteria 6821
170 Ga0316584_0009953 3300036712 Bacteria 6624
171 Ga0316584_0077392 3300036712 Bacteria 2492
172 Ga0316584_0094332 3300036712 Bacteria 2241
173 Ga0316584_0115688 3300036712 Bacteria 2006
174 Ga0316584_0121749 3300036712 Bacteria 1949
175 Ga0316584_0134740 3300036712 Unclassified 1844
176 Ga0316584_0301659 3300036712 Bacteria 1160
177 Ga0395900_0276713 3300037418 Unclassified 1672
178 Ga0316581_0000158 3300037588 Bacteria 10718
179 Ga0316581_0051240 3300037588 Bacteria 1265
180 Ga0316581_0070777 3300037588 Bacteria 1071
181 Ga0395901_0353690 3300038443 Bacteria 1516
182 Ga0395901_0582156 3300038443 Bacteria 1131
183 Ga0400484_13143 3300038725 Bacteria 14777
184 Ga0400484_28482 3300038725 Bacteria 8687
185 Ga0400484_31130 3300038725 Bacteria 1588
186 Ga0400484_41753 3300038725 Bacteria 2597
187 Ga0400490_34427 3300038726 Bacteria 54087
188 Ga0400485_05936 3300038735 Bacteria 4029
189 Ga0400488_16254 3300038741 Bacteria 5676
190 Ga0400488_48108 3300038741 Bacteria 1783
191 Ga0400486_07711 3300038742 Bacteria 7084
192 Ga0400486_25963 3300038742 Bacteria 1759
193 Ga0400486_28024 3300038742 Bacteria 2267
194 Ga0400483_014324 3300039062 Bacteria 21091
195 Ga0400483_024657 3300039062 Bacteria 2489
196 Ga0400483_110666 3300039062 Bacteria 1682
197 Ga0400483_127740 3300039062 Bacteria 14794
198 Ga0400483_177158 3300039062 Bacteria 1768
199 Ga0400483_194764 3300039062 Bacteria 1595
200 Ga0400483_213955 3300039062 Bacteria 1807
201 Ga0400483_272952 3300039062 Bacteria 1272
202 Ga0400489_75927 3300039093 Bacteria 24329
203 Ga0400487_15776 3300039110 Bacteria 5314
204 Ga0400487_25319 3300039110 Bacteria 4672
205 Ga0400487_34970 3300039110 Bacteria 222491
206 Ga0400487_54109 3300039110 Bacteria 47250
207 Ga0439432_068677 3300042006 Bacteria 1083
208 Ga0453684_0003670 3300044712 Bacteria 34052
209 Ga0453684_0006330 3300044712 Bacteria 22598
210 Ga0453684_0022650 3300044712 Bacteria 9308
211 Ga0495580_0117261 3300046472 Bacteria 1849
212 Ga0496100_0209427 3300048903 Bacteria 1425
213 Ga0496101_0022804 3300048904 Bacteria 4315
214 Ga0496109_0169455 3300048912 Unclassified 2048
215 Ga0496114_0156841 3300048917 Bacteria 1977
216 Ga0501031_0011446 3300049568 Bacteria 5779
217 Ga0501033_0000240 3300049570 Bacteria 52539
218 Ga0501033_0001675 3300049570 Bacteria 19372
219 Ga0501033_0004527 3300049570 Bacteria 11127
220 Ga0501034_0033186 3300049571 Bacteria 5239
221 Ga0501036_0000922 3300049572 Bacteria 22063
222 Ga0501036_0113756 3300049572 Unclassified 2287
223 Ga0501037_0022211 3300049573 Bacteria 4694
224 Ga0501037_0045130 3300049573 Bacteria 3235
225 Ga0501037_0163486 3300049573 Unclassified 1586
226 Ga0501037_0427959 3300049573 Bacteria 905
227 Ga0501038_0003281 3300049574 Bacteria 15076
228 Ga0501038_0007326 3300049574 Bacteria 10177
229 Ga0501038_0055164 3300049574 Unclassified 3414
230 Ga0501039_0014677 3300049575 Bacteria 5993
231 Ga0501039_0185457 3300049575 Bacteria 1636
232 Ga0501040_0000254 3300049576 Bacteria 31274
233 Ga0501042_0306839 3300049578 Bacteria 1146
234 Ga0501043_0001577 3300049579 Bacteria 19829
235 Ga0501043_0027535 3300049579 Unclassified 4461
236 Ga0501043_0032867 3300049579 Unclassified 4080
237 Ga0501046_0000954 3300049580 Bacteria 28369
238 Ga0501046_0028705 3300049580 Bacteria 4529
239 Ga0501047_0326202 3300049581 Unclassified 1374
240 Ga0501068_0123099 3300049584 Bacteria 1618
241 Ga0501069_0109202 3300049585 Unclassified 1574
242 Ga0501070_0003742 3300049586 Bacteria 13133
243 Ga0501070_0015999 3300049586 Bacteria 6304
244 Ga0501070_0028205 3300049586 Bacteria 4707
245 Ga0501073_0025809 3300049589 Bacteria 4209
246 Ga0501074_0000801 3300049590 Bacteria 19891
247 Ga0501074_0183095 3300049590 Bacteria 1494
248 Ga0501075_0133608 3300049591 Unclassified 1890
249 Ga0501079_0110132 3300049741 Bacteria 2139
250 Ga0501080_0003668 3300049742 Bacteria 13547
251 Ga0501080_0013308 3300049742 Bacteria 7561
252 Ga0501083_0012666 3300049744 Bacteria 5901
253 Ga0501035_0001190 3300049822 Bacteria 27093
254 Ga0501035_0037156 3300049822 Bacteria 4412
255 Ga0501044_0000326 3300049823 Bacteria 60246
256 Ga0501044_0017831 3300049823 Bacteria 7615
257 Ga0501044_0104471 3300049823 Bacteria 2847
258 nmdc:mga08y16_7922_c1 3300050511 Bacteria 11118
259 nmdc:mga08x19_254844_c1 3300050514 Bacteria 1212
260 Ga0501082_0172050 3300060353 Bacteria 1883

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0582156 Ga0395901_0582156_395_1096 232
2 3300035695 Ga0373927_0242543 Ga0373927_0242543_268_1029 243
3 3300046472 Ga0495580_0117261 Ga0495580_0117261_706_1467 243
4 3300036712 Ga0316584_0094332 Ga0316584_0094332_1000_1761 245
5 3300038742 Ga0400486_28024 Ga0400486_28024_1254_2009 245
6 3300036647 Ga0316582_0004674 Ga0316582_0004674_313_1077 247
7 3300036712 Ga0316584_0301659 Ga0316584_0301659_219_983 247
8 3300010375 Ga0105239_10742987 Ga0105239_107429872 252
9 3300013105 Ga0157369_10103765 Ga0157369_101037652 252
10 3300035170 Ga0373943_0187742 Ga0373943_0187742_193_954 252
11 3300035695 Ga0373927_0002019 Ga0373927_0002019_12229_12990 252
12 3300036401 Ga0373937_0286731 Ga0373937_0286731_552_1313 252
13 3300038725 Ga0400484_13143 Ga0400484_13143_371_1132 252
14 3300042006 Ga0439432_068677 Ga0439432_068677_304_1065 252
15 3300050511 nmdc:mga08y16_7922_c1 nmdc:mga08y16_7922_c1_115_876 252
16 3300050514 nmdc:mga08x19_254844_c1 nmdc:mga08x19_254844_c1_240_1001 252
17 3300031727 Ga0316576_10040646 Ga0316576_100406463 253
18 3300036712 Ga0316584_0115688 Ga0316584_0115688_504_1268 253
19 3300036712 Ga0316584_0121749 Ga0316584_0121749_828_1595 253
20 3300031691 Ga0316579_10034654 Ga0316579_100346544 255
21 3300031727 Ga0316576_10002904 Ga0316576_100029049 255
22 3300031733 Ga0316577_10018749 Ga0316577_100187492 255
23 3300032139 Ga0316580_10028994 Ga0316580_100289942 255
24 3300037588 Ga0316581_0051240 Ga0316581_0051240_51_863 255
25 3300031733 Ga0316577_10218622 Ga0316577_102186222 258
26 3300032168 Ga0316593_10003931 Ga0316593_100039314 258
27 3300031250 Ga0265331_10003341 Ga0265331_100033415 259
28 3300031251 Ga0265327_10000136 Ga0265327_1000013611 259
29 3300035724 Ga0373933_0365685 Ga0373933_0365685_111_890 259
30 3300005347 Ga0070668_100023271 Ga0070668_1000232714 261
31 3300005354 Ga0070675_100032800 Ga0070675_1000328003 261
32 3300005456 Ga0070678_100039382 Ga0070678_1000393823 261
33 3300009553 Ga0105249_10115352 Ga0105249_101153522 261
34 3300005337 Ga0070682_100240489 Ga0070682_1002404892 262
35 3300005339 Ga0070660_100068517 Ga0070660_1000685172 262
36 3300005339 Ga0070660_100410246 Ga0070660_1004102461 262
37 3300005339 Ga0070660_100424639 Ga0070660_1004246391 262
38 3300005366 Ga0070659_100088637 Ga0070659_1000886372 262
39 3300005530 Ga0070679_100382901 Ga0070679_1003829011 262
40 3300005563 Ga0068855_100872875 Ga0068855_1008728751 262
41 3300005614 Ga0068856_100083469 Ga0068856_1000834693 262
42 3300009094 Ga0111539_10006383 Ga0111539_100063839 262
43 3300013100 Ga0157373_10092211 Ga0157373_100922112 262
44 3300013100 Ga0157373_10243545 Ga0157373_102435451 262
45 3300013308 Ga0157375_10476557 Ga0157375_104765572 262
46 3300014497 Ga0182008_10037566 Ga0182008_100375662 262
47 3300025919 Ga0207657_10148114 Ga0207657_101481142 262
48 3300025919 Ga0207657_10498761 Ga0207657_104987611 262
49 3300025925 Ga0207650_10263725 Ga0207650_102637252 262
50 3300026078 Ga0207702_10046728 Ga0207702_100467283 262
51 3300027907 Ga0207428_10063974 Ga0207428_100639742 262
52 3300037418 Ga0395900_0276713 Ga0395900_0276713_510_1301 262
53 3300038443 Ga0395901_0353690 Ga0395901_0353690_692_1483 262
54 3300048903 Ga0496100_0209427 Ga0496100_0209427_357_1148 262
55 3300048904 Ga0496101_0022804 Ga0496101_0022804_2892_3683 262
56 3300048912 Ga0496109_0169455 Ga0496109_0169455_134_925 262
57 3300048917 Ga0496114_0156841 Ga0496114_0156841_911_1702 262
58 3300049568 Ga0501031_0011446 Ga0501031_0011446_848_1639 262
59 3300049570 Ga0501033_0000240 Ga0501033_0000240_467_1258 262
60 3300049571 Ga0501034_0033186 Ga0501034_0033186_552_1343 262
61 3300049572 Ga0501036_0000922 Ga0501036_0000922_12751_13542 262
62 3300049572 Ga0501036_0113756 Ga0501036_0113756_20_811 262
63 3300049573 Ga0501037_0427959 Ga0501037_0427959_62_853 262
64 3300049574 Ga0501038_0007326 Ga0501038_0007326_7383_8174 262
65 3300049575 Ga0501039_0185457 Ga0501039_0185457_638_1429 262
66 3300049579 Ga0501043_0032867 Ga0501043_0032867_2265_3056 262
67 3300049823 Ga0501044_0000326 Ga0501044_0000326_45216_46007 262
68 3300049823 Ga0501044_0104471 Ga0501044_0104471_1825_2616 262
69 3300032133 Ga0316583_10006431 Ga0316583_100064312 263
70 3300044712 Ga0453684_0006330 Ga0453684_0006330_15647_16441 263
71 3300031691 Ga0316579_10010113 Ga0316579_100101136 264
72 3300032137 Ga0316585_10060365 Ga0316585_100603651 264
73 3300036647 Ga0316582_0041994 Ga0316582_0041994_1511_2305 264
74 3300038725 Ga0400484_28482 Ga0400484_28482_3540_4337 264
75 3300038725 Ga0400484_31130 Ga0400484_31130_67_864 264
76 3300038725 Ga0400484_41753 Ga0400484_41753_1506_2303 264
77 3300038726 Ga0400490_34427 Ga0400490_34427_14494_15291 264
78 3300038735 Ga0400485_05936 Ga0400485_05936_3020_3817 264
79 3300038741 Ga0400488_16254 Ga0400488_16254_2799_3596 264
80 3300038741 Ga0400488_48108 Ga0400488_48108_302_1099 264
81 3300038742 Ga0400486_07711 Ga0400486_07711_2794_3591 264
82 3300038742 Ga0400486_25963 Ga0400486_25963_358_1155 264
83 3300039062 Ga0400483_024657 Ga0400483_024657_1445_2242 264
84 3300039062 Ga0400483_110666 Ga0400483_110666_239_1036 264
85 3300039062 Ga0400483_127740 Ga0400483_127740_8984_9781 264
86 3300039062 Ga0400483_177158 Ga0400483_177158_538_1335 264
87 3300039062 Ga0400483_194764 Ga0400483_194764_321_1118 264
88 3300039062 Ga0400483_213955 Ga0400483_213955_100_897 264
89 3300039062 Ga0400483_272952 Ga0400483_272952_386_1183 264
90 3300039093 Ga0400489_75927 Ga0400489_75927_12703_13500 264
91 3300039110 Ga0400487_15776 Ga0400487_15776_1791_2588 264
92 3300039110 Ga0400487_25319 Ga0400487_25319_1144_1941 264
93 3300039110 Ga0400487_54109 Ga0400487_54109_35281_36075 264
94 3300044712 Ga0453684_0022650 Ga0453684_0022650_964_1761 264
95 3300049573 Ga0501037_0022211 Ga0501037_0022211_1075_1869 264
96 3300049573 Ga0501037_0045130 Ga0501037_0045130_2134_2928 264
97 3300049580 Ga0501046_0028705 Ga0501046_0028705_2444_3238 264
98 3300049581 Ga0501047_0326202 Ga0501047_0326202_298_1092 264
99 3300049585 Ga0501069_0109202 Ga0501069_0109202_708_1502 264
100 3300049586 Ga0501070_0015999 Ga0501070_0015999_2088_2882 264
101 3300049586 Ga0501070_0028205 Ga0501070_0028205_2136_2930 264
102 3300049590 Ga0501074_0000801 Ga0501074_0000801_6414_7208 264
103 3300049591 Ga0501075_0133608 Ga0501075_0133608_624_1418 264
104 3300049742 Ga0501080_0013308 Ga0501080_0013308_2486_3280 264
105 3300031728 Ga0316578_10136826 Ga0316578_101368262 265
106 3300031733 Ga0316577_10020502 Ga0316577_100205024 265
107 3300032137 Ga0316585_10024012 Ga0316585_100240122 265
108 3300032168 Ga0316593_10004210 Ga0316593_100042104 265
109 3300033524 Ga0316592_1003781 Ga0316592_10037813 265
110 3300033541 Ga0316596_1000172 Ga0316596_10001723 265
111 3300033541 Ga0316596_1003954 Ga0316596_10039542 265
112 3300036647 Ga0316582_0022078 Ga0316582_0022078_2271_3071 265
113 3300036712 Ga0316584_0077392 Ga0316584_0077392_1209_2009 265
114 3300039062 Ga0400483_014324 Ga0400483_014324_17211_18011 265
115 3300039110 Ga0400487_34970 Ga0400487_34970_221067_221867 265
116 3300044712 Ga0453684_0003670 Ga0453684_0003670_32197_32997 265
117 3300025910 Ga0207684_10012739 Ga0207684_100127394 266
118 3300025915 Ga0207693_10043391 Ga0207693_100433914 266
119 3300025932 Ga0207690_10223695 Ga0207690_102236952 266
120 3300025945 Ga0207679_10114443 Ga0207679_101144432 266
121 3300026041 Ga0207639_10268683 Ga0207639_102686832 266
122 3300035398 Ga0316574_0012338 Ga0316574_0012338_1404_2210 267
123 3300049570 Ga0501033_0001675 Ga0501033_0001675_13385_14209 268
124 3300049570 Ga0501033_0004527 Ga0501033_0004527_2315_3124 268
125 3300049573 Ga0501037_0163486 Ga0501037_0163486_46_870 268
126 3300049574 Ga0501038_0003281 Ga0501038_0003281_2364_3173 268
127 3300049574 Ga0501038_0055164 Ga0501038_0055164_819_1643 268
128 3300049575 Ga0501039_0014677 Ga0501039_0014677_2119_2943 268
129 3300049579 Ga0501043_0001577 Ga0501043_0001577_2128_2937 268
130 3300049579 Ga0501043_0027535 Ga0501043_0027535_2207_3031 268
131 3300049580 Ga0501046_0000954 Ga0501046_0000954_15332_16156 268
132 3300049584 Ga0501068_0123099 Ga0501068_0123099_351_1160 268
133 3300049586 Ga0501070_0003742 Ga0501070_0003742_6411_7235 268
134 3300049589 Ga0501073_0025809 Ga0501073_0025809_3267_4076 268
135 3300049590 Ga0501074_0183095 Ga0501074_0183095_623_1432 268
136 3300049741 Ga0501079_0110132 Ga0501079_0110132_1318_2127 268
137 3300049742 Ga0501080_0003668 Ga0501080_0003668_9341_10150 268
138 3300049744 Ga0501083_0012666 Ga0501083_0012666_1606_2415 268
139 3300049822 Ga0501035_0001190 Ga0501035_0001190_15876_16700 268
140 3300049822 Ga0501035_0037156 Ga0501035_0037156_284_1093 268
141 3300049823 Ga0501044_0017831 Ga0501044_0017831_3606_4415 268
142 3300060353 Ga0501082_0172050 Ga0501082_0172050_232_1041 268
143 3300031728 Ga0316578_10027739 Ga0316578_100277393 270
144 3300031728 Ga0316578_10044003 Ga0316578_100440034 270
145 3300031728 Ga0316578_10165932 Ga0316578_101659322 270
146 3300032133 Ga0316583_10003350 Ga0316583_100033508 270
147 3300035398 Ga0316574_0038678 Ga0316574_0038678_884_1696 270
148 3300035398 Ga0316574_0140216 Ga0316574_0140216_285_1097 270
149 3300036647 Ga0316582_0272391 Ga0316582_0272391_271_1083 270
150 3300036712 Ga0316584_0009953 Ga0316584_0009953_2666_3478 270
151 3300036712 Ga0316584_0134740 Ga0316584_0134740_975_1793 270
152 3300037588 Ga0316581_0070777 Ga0316581_0070777_165_1037 270
153 3300049576 Ga0501040_0000254 Ga0501040_0000254_768_1583 270
154 3300049578 Ga0501042_0306839 Ga0501042_0306839_122_937 270
155 3300025942 Ga0207689_10093706 Ga0207689_100937062 271
156 3300031665 Ga0316575_10037832 Ga0316575_100378322 272
157 3300031691 Ga0316579_10003335 Ga0316579_100033356 272
158 3300005329 Ga0070683_100028253 Ga0070683_1000282535 273
159 3300005330 Ga0070690_100163484 Ga0070690_1001634842 273
160 3300005331 Ga0070670_100120704 Ga0070670_1001207042 273
161 3300005343 Ga0070687_100170093 Ga0070687_1001700931 273
162 3300005344 Ga0070661_100012118 Ga0070661_1000121184 273
163 3300005345 Ga0070692_10078034 Ga0070692_100780342 273
164 3300005356 Ga0070674_100483491 Ga0070674_1004834911 273
165 3300005438 Ga0070701_10051852 Ga0070701_100518523 273
166 3300005441 Ga0070700_100044170 Ga0070700_1000441703 273
167 3300005456 Ga0070678_100028661 Ga0070678_1000286612 273
168 3300005458 Ga0070681_10265039 Ga0070681_102650391 273
169 3300005535 Ga0070684_100088502 Ga0070684_1000885022 273
170 3300005539 Ga0068853_100047599 Ga0068853_1000475992 273
171 3300005543 Ga0070672_100036029 Ga0070672_1000360293 273
172 3300005543 Ga0070672_100071364 Ga0070672_1000713642 273
173 3300005548 Ga0070665_100026798 Ga0070665_1000267984 273
174 3300005549 Ga0070704_100016857 Ga0070704_1000168572 273
175 3300005563 Ga0068855_100038948 Ga0068855_1000389487 273
176 3300005614 Ga0068856_100090827 Ga0068856_1000908273 273
177 3300005617 Ga0068859_100099393 Ga0068859_1000993932 273
178 3300005719 Ga0068861_100067844 Ga0068861_1000678442 273
179 3300005840 Ga0068870_10175897 Ga0068870_101758972 273
180 3300005841 Ga0068863_100016743 Ga0068863_1000167437 273
181 3300005841 Ga0068863_100298751 Ga0068863_1002987512 273
182 3300005842 Ga0068858_100026435 Ga0068858_1000264354 273
183 3300005843 Ga0068860_100003098 Ga0068860_10000309815 273
184 3300005844 Ga0068862_100110812 Ga0068862_1001108123 273
185 3300006358 Ga0068871_100148708 Ga0068871_1001487082 273
186 3300006881 Ga0068865_100023324 Ga0068865_1000233242 273
187 3300006881 Ga0068865_100128402 Ga0068865_1001284023 273
188 3300006881 Ga0068865_100253896 Ga0068865_1002538962 273
189 3300006931 Ga0097620_100099395 Ga0097620_1000993952 273
190 3300009093 Ga0105240_10222385 Ga0105240_102223852 273
191 3300009174 Ga0105241_10005635 Ga0105241_100056357 273
192 3300009177 Ga0105248_10013667 Ga0105248_100136674 273
193 3300009551 Ga0105238_10036807 Ga0105238_100368072 273
194 3300009551 Ga0105238_10049879 Ga0105238_100498793 273
195 3300011119 Ga0105246_10023363 Ga0105246_100233633 273
196 3300011119 Ga0105246_10037421 Ga0105246_100374213 273
197 3300013105 Ga0157369_10010052 Ga0157369_100100524 273
198 3300013105 Ga0157369_10029634 Ga0157369_100296348 273
199 3300013296 Ga0157374_10505615 Ga0157374_105056152 273
200 3300013306 Ga0163162_10236328 Ga0163162_102363281 273
201 3300013307 Ga0157372_10001607 Ga0157372_1000160717 273
202 3300013307 Ga0157372_10237655 Ga0157372_102376551 273
203 3300013307 Ga0157372_10348570 Ga0157372_103485702 273
204 3300013308 Ga0157375_10052283 Ga0157375_100522833 273
205 3300014325 Ga0163163_10019732 Ga0163163_100197324 273
206 3300014325 Ga0163163_10110981 Ga0163163_101109813 273
207 3300014968 Ga0157379_10009222 Ga0157379_100092224 273
208 3300014968 Ga0157379_10316068 Ga0157379_103160682 273
209 3300014969 Ga0157376_10056355 Ga0157376_100563553 273
210 3300025903 Ga0207680_10103288 Ga0207680_101032882 273
211 3300025904 Ga0207647_10001761 Ga0207647_100017616 273
212 3300025908 Ga0207643_10022745 Ga0207643_100227453 273
213 3300025911 Ga0207654_10006907 Ga0207654_100069073 273
214 3300025911 Ga0207654_10274746 Ga0207654_102747462 273
215 3300025913 Ga0207695_10000970 Ga0207695_1000097030 273
216 3300025914 Ga0207671_10005239 Ga0207671_100052393 273
217 3300025918 Ga0207662_10251131 Ga0207662_102511312 273
218 3300025919 Ga0207657_10043917 Ga0207657_100439173 273
219 3300025920 Ga0207649_10046376 Ga0207649_100463762 273
220 3300025923 Ga0207681_10033120 Ga0207681_100331202 273
221 3300025924 Ga0207694_10083109 Ga0207694_100831092 273
222 3300025925 Ga0207650_10138092 Ga0207650_101380922 273
223 3300025926 Ga0207659_10048046 Ga0207659_100480463 273
224 3300025931 Ga0207644_10214892 Ga0207644_102148921 273
225 3300025935 Ga0207709_10044867 Ga0207709_100448673 273
226 3300025937 Ga0207669_10344210 Ga0207669_103442102 273
227 3300025938 Ga0207704_10021726 Ga0207704_100217262 273
228 3300025938 Ga0207704_10152213 Ga0207704_101522133 273
229 3300025938 Ga0207704_10248847 Ga0207704_102488472 273
230 3300025940 Ga0207691_10004824 Ga0207691_1000482414 273
231 3300025940 Ga0207691_10087323 Ga0207691_100873233 273
232 3300025941 Ga0207711_10049859 Ga0207711_100498593 273
233 3300025942 Ga0207689_10104543 Ga0207689_101045433 273
234 3300025942 Ga0207689_10132256 Ga0207689_101322563 273
235 3300025944 Ga0207661_10708124 Ga0207661_107081241 273
236 3300025949 Ga0207667_10119611 Ga0207667_101196112 273
237 3300025949 Ga0207667_10412629 Ga0207667_104126292 273
238 3300025972 Ga0207668_10070406 Ga0207668_100704062 273
239 3300025972 Ga0207668_10362588 Ga0207668_103625881 273
240 3300025981 Ga0207640_10040117 Ga0207640_100401174 273
241 3300025981 Ga0207640_10108596 Ga0207640_101085963 273
242 3300026041 Ga0207639_10000361 Ga0207639_1000036116 273
243 3300026075 Ga0207708_10006842 Ga0207708_100068426 273
244 3300026078 Ga0207702_10016960 Ga0207702_100169604 273
245 3300026078 Ga0207702_10178600 Ga0207702_101786002 273
246 3300026088 Ga0207641_10072215 Ga0207641_100722152 273
247 3300026089 Ga0207648_10008641 Ga0207648_100086416 273
248 3300026089 Ga0207648_10077024 Ga0207648_100770243 273
249 3300026116 Ga0207674_10004738 Ga0207674_100047384 273
250 3300026121 Ga0207683_10056531 Ga0207683_100565313 273
251 3300028379 Ga0268266_10109706 Ga0268266_101097062 273
252 3300028380 Ga0268265_10216265 Ga0268265_102162652 273
253 3300028381 Ga0268264_10011519 Ga0268264_100115198 273
254 3300031691 Ga0316579_10001118 Ga0316579_100011183 273
255 3300031728 Ga0316578_10004087 Ga0316578_100040874 273
256 3300031728 Ga0316578_10032179 Ga0316578_100321793 273
257 3300031730 Ga0307516_10165048 Ga0307516_101650482 273
258 3300036647 Ga0316582_0014795 Ga0316582_0014795_912_1739 273
259 3300036712 Ga0316584_0009278 Ga0316584_0009278_3748_4575 273
260 3300037588 Ga0316581_0000158 Ga0316581_0000158_971_1798 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02548

Pantoate_transf

Ketopantoate hydroxymethyltransferase

29

286

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ez4-assembly1.cif.gz_I crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei 0.987 12 273
3vav-assembly1.cif.gz_G crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9869 10 273
3ez4-assembly1.cif.gz_J crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei 0.9865 12 273
3vav-assembly1.cif.gz_I crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9861 10 273
3vav-assembly1.cif.gz_F crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9857 10 273
ID Description Score Start End Superfamily
3vavB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.979 10 273 3.20.20.60
3vavB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9753 10 273 3.20.20.60
af_A0A0R0J726_27_197_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9595 10 172 3.20.20.60
af_A0A0R0J726_27_197_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9106 10 172 3.20.20.60
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.867 10 272 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A1W9L1W3-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9936 10 154 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A7Z9XPV4-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9881 11 273 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A1W9L1W3-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9868 10 154 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A353VUZ7-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9854 10 273 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-M4UAA2-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9851 10 273 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.53 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map