F369663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 156 | 260 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300031728|Ga0316578_10044003|Ga0316578_100440034 |
| Length | 290 |
| Sequence | MPPAAVGITSIHRLPRTEFDMGAEANASPVSIATLRRMKAQNEKIACLTCYDASFTRVLEEAGVDVFIIGDTLGMVIQGHESTVSVTMQDMIYHAAIVARIGRRALRVVDMPFMSYASRDHALENAARLMREGGAHMVKLEGGSVMAGVVEHLARHAIPVCGHIGLLPQSVYKLGGYRVQGRDEAGAAALVDDARALEAAGADLLVIECVPAELAARLTAAVSIPTIGIGAGPACDGQVLVLYDMLGITPGRRPRFVKDFLEPAGSVPAAITAYVKAVREGNFPGPEHSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 34 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 95 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 96 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 97 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 98 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 99 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 100 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 101 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 102 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 103 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 112 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 117 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 118 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 119 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 120 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 121 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 122 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 123 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 124 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 1.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.54 |
| Rhizosphere | 88.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100028253 | 3300005329 | Bacteria | 5068 |
| 2 | Ga0070690_100163484 | 3300005330 | Bacteria | 1527 |
| 3 | Ga0070670_100120704 | 3300005331 | Bacteria | 2261 |
| 4 | Ga0070682_100240489 | 3300005337 | Bacteria | 1299 |
| 5 | Ga0070660_100068517 | 3300005339 | Bacteria | 2766 |
| 6 | Ga0070660_100410246 | 3300005339 | Bacteria | 1121 |
| 7 | Ga0070660_100424639 | 3300005339 | Bacteria | 1101 |
| 8 | Ga0070687_100170093 | 3300005343 | Bacteria | 1296 |
| 9 | Ga0070661_100012118 | 3300005344 | Bacteria | 6028 |
| 10 | Ga0070692_10078034 | 3300005345 | Bacteria | 1777 |
| 11 | Ga0070668_100023271 | 3300005347 | Bacteria | 4685 |
| 12 | Ga0070675_100032800 | 3300005354 | Bacteria | 4205 |
| 13 | Ga0070674_100483491 | 3300005356 | Bacteria | 1028 |
| 14 | Ga0070659_100088637 | 3300005366 | Bacteria | 2478 |
| 15 | Ga0070701_10051852 | 3300005438 | Bacteria | 2130 |
| 16 | Ga0070700_100044170 | 3300005441 | Bacteria | 2743 |
| 17 | Ga0070678_100028661 | 3300005456 | Bacteria | 3801 |
| 18 | Ga0070678_100039382 | 3300005456 | Bacteria | 3334 |
| 19 | Ga0070681_10265039 | 3300005458 | Bacteria | 1630 |
| 20 | Ga0070679_100382901 | 3300005530 | Bacteria | 1353 |
| 21 | Ga0070684_100088502 | 3300005535 | Bacteria | 2751 |
| 22 | Ga0068853_100047599 | 3300005539 | Bacteria | 3680 |
| 23 | Ga0070672_100036029 | 3300005543 | Bacteria | 3766 |
| 24 | Ga0070672_100071364 | 3300005543 | Bacteria | 2763 |
| 25 | Ga0070665_100026798 | 3300005548 | Bacteria | 5805 |
| 26 | Ga0070704_100016857 | 3300005549 | Bacteria | 4629 |
| 27 | Ga0068855_100038948 | 3300005563 | Bacteria | 5644 |
| 28 | Ga0068855_100872875 | 3300005563 | Bacteria | 952 |
| 29 | Ga0068856_100083469 | 3300005614 | Unclassified | 3173 |
| 30 | Ga0068856_100090827 | 3300005614 | Bacteria | 3038 |
| 31 | Ga0068859_100099393 | 3300005617 | Bacteria | 2965 |
| 32 | Ga0068861_100067844 | 3300005719 | Bacteria | 2754 |
| 33 | Ga0068870_10175897 | 3300005840 | Bacteria | 1281 |
| 34 | Ga0068863_100016743 | 3300005841 | Bacteria | 7033 |
| 35 | Ga0068863_100298751 | 3300005841 | Bacteria | 1562 |
| 36 | Ga0068858_100026435 | 3300005842 | Bacteria | 5391 |
| 37 | Ga0068860_100003098 | 3300005843 | Bacteria | 17193 |
| 38 | Ga0068862_100110812 | 3300005844 | Bacteria | 2408 |
| 39 | Ga0068871_100148708 | 3300006358 | Bacteria | 1996 |
| 40 | Ga0068865_100023324 | 3300006881 | Bacteria | 4051 |
| 41 | Ga0068865_100128402 | 3300006881 | Bacteria | 1896 |
| 42 | Ga0068865_100253896 | 3300006881 | Bacteria | 1389 |
| 43 | Ga0097620_100099395 | 3300006931 | Bacteria | 2965 |
| 44 | Ga0105240_10222385 | 3300009093 | Bacteria | 2199 |
| 45 | Ga0111539_10006383 | 3300009094 | Bacteria | 15207 |
| 46 | Ga0105241_10005635 | 3300009174 | Bacteria | 9236 |
| 47 | Ga0105248_10013667 | 3300009177 | Bacteria | 8937 |
| 48 | Ga0105238_10036807 | 3300009551 | Bacteria | 4976 |
| 49 | Ga0105238_10049879 | 3300009551 | Bacteria | 4214 |
| 50 | Ga0105249_10115352 | 3300009553 | Bacteria | 2545 |
| 51 | Ga0105239_10742987 | 3300010375 | Bacteria | 1123 |
| 52 | Ga0105246_10023363 | 3300011119 | Bacteria | 4000 |
| 53 | Ga0105246_10037421 | 3300011119 | Bacteria | 3257 |
| 54 | Ga0157373_10092211 | 3300013100 | Bacteria | 2133 |
| 55 | Ga0157373_10243545 | 3300013100 | Unclassified | 1271 |
| 56 | Ga0157369_10010052 | 3300013105 | Bacteria | 10805 |
| 57 | Ga0157369_10029634 | 3300013105 | Bacteria | 6045 |
| 58 | Ga0157369_10103765 | 3300013105 | Bacteria | 3029 |
| 59 | Ga0157374_10505615 | 3300013296 | Bacteria | 1213 |
| 60 | Ga0163162_10236328 | 3300013306 | Bacteria | 1958 |
| 61 | Ga0157372_10001607 | 3300013307 | Bacteria | 24528 |
| 62 | Ga0157372_10237655 | 3300013307 | Bacteria | 2113 |
| 63 | Ga0157372_10348570 | 3300013307 | Bacteria | 1725 |
| 64 | Ga0157375_10052283 | 3300013308 | Bacteria | 4015 |
| 65 | Ga0157375_10476557 | 3300013308 | Bacteria | 1413 |
| 66 | Ga0163163_10019732 | 3300014325 | Bacteria | 6338 |
| 67 | Ga0163163_10110981 | 3300014325 | Bacteria | 2771 |
| 68 | Ga0182008_10037566 | 3300014497 | Unclassified | 2423 |
| 69 | Ga0157379_10009222 | 3300014968 | Bacteria | 8594 |
| 70 | Ga0157379_10316068 | 3300014968 | Bacteria | 1425 |
| 71 | Ga0157376_10056355 | 3300014969 | Bacteria | 3283 |
| 72 | Ga0207680_10103288 | 3300025903 | Bacteria | 1835 |
| 73 | Ga0207647_10001761 | 3300025904 | Bacteria | 16619 |
| 74 | Ga0207643_10022745 | 3300025908 | Bacteria | 3454 |
| 75 | Ga0207684_10012739 | 3300025910 | Bacteria | 7295 |
| 76 | Ga0207654_10006907 | 3300025911 | Bacteria | 5716 |
| 77 | Ga0207654_10274746 | 3300025911 | Bacteria | 1138 |
| 78 | Ga0207695_10000970 | 3300025913 | Bacteria | 51112 |
| 79 | Ga0207671_10005239 | 3300025914 | Bacteria | 12042 |
| 80 | Ga0207693_10043391 | 3300025915 | Bacteria | 3538 |
| 81 | Ga0207662_10251131 | 3300025918 | Bacteria | 1161 |
| 82 | Ga0207657_10043917 | 3300025919 | Bacteria | 3933 |
| 83 | Ga0207657_10148114 | 3300025919 | Bacteria | 1913 |
| 84 | Ga0207657_10498761 | 3300025919 | Bacteria | 954 |
| 85 | Ga0207649_10046376 | 3300025920 | Bacteria | 2669 |
| 86 | Ga0207681_10033120 | 3300025923 | Bacteria | 3387 |
| 87 | Ga0207694_10083109 | 3300025924 | Bacteria | 2518 |
| 88 | Ga0207650_10138092 | 3300025925 | Bacteria | 1914 |
| 89 | Ga0207650_10263725 | 3300025925 | Bacteria | 1398 |
| 90 | Ga0207659_10048046 | 3300025926 | Bacteria | 3021 |
| 91 | Ga0207644_10214892 | 3300025931 | Bacteria | 1522 |
| 92 | Ga0207690_10223695 | 3300025932 | Bacteria | 1441 |
| 93 | Ga0207709_10044867 | 3300025935 | Bacteria | 2674 |
| 94 | Ga0207669_10344210 | 3300025937 | Bacteria | 1149 |
| 95 | Ga0207704_10021726 | 3300025938 | Bacteria | 3424 |
| 96 | Ga0207704_10152213 | 3300025938 | Bacteria | 1634 |
| 97 | Ga0207704_10248847 | 3300025938 | Bacteria | 1333 |
| 98 | Ga0207691_10004824 | 3300025940 | Bacteria | 13041 |
| 99 | Ga0207691_10087323 | 3300025940 | Bacteria | 2798 |
| 100 | Ga0207711_10049859 | 3300025941 | Bacteria | 3584 |
| 101 | Ga0207689_10093706 | 3300025942 | Bacteria | 2467 |
| 102 | Ga0207689_10104543 | 3300025942 | Bacteria | 2327 |
| 103 | Ga0207689_10132256 | 3300025942 | Bacteria | 2054 |
| 104 | Ga0207661_10708124 | 3300025944 | Bacteria | 926 |
| 105 | Ga0207679_10114443 | 3300025945 | Bacteria | 2136 |
| 106 | Ga0207667_10119611 | 3300025949 | Bacteria | 2714 |
| 107 | Ga0207667_10412629 | 3300025949 | Bacteria | 1374 |
| 108 | Ga0207668_10070406 | 3300025972 | Bacteria | 2494 |
| 109 | Ga0207668_10362588 | 3300025972 | Bacteria | 1215 |
| 110 | Ga0207640_10040117 | 3300025981 | Bacteria | 2967 |
| 111 | Ga0207640_10108596 | 3300025981 | Bacteria | 1961 |
| 112 | Ga0207639_10000361 | 3300026041 | Bacteria | 31444 |
| 113 | Ga0207639_10268683 | 3300026041 | Bacteria | 1495 |
| 114 | Ga0207708_10006842 | 3300026075 | Bacteria | 8434 |
| 115 | Ga0207702_10016960 | 3300026078 | Bacteria | 6026 |
| 116 | Ga0207702_10046728 | 3300026078 | Unclassified | 3645 |
| 117 | Ga0207702_10178600 | 3300026078 | Bacteria | 1953 |
| 118 | Ga0207641_10072215 | 3300026088 | Bacteria | 2971 |
| 119 | Ga0207648_10008641 | 3300026089 | Bacteria | 9836 |
| 120 | Ga0207648_10077024 | 3300026089 | Bacteria | 2907 |
| 121 | Ga0207674_10004738 | 3300026116 | Bacteria | 16308 |
| 122 | Ga0207683_10056531 | 3300026121 | Bacteria | 3442 |
| 123 | Ga0207428_10063974 | 3300027907 | Bacteria | 2905 |
| 124 | Ga0268266_10109706 | 3300028379 | Bacteria | 2444 |
| 125 | Ga0268265_10216265 | 3300028380 | Bacteria | 1673 |
| 126 | Ga0268264_10011519 | 3300028381 | Bacteria | 7304 |
| 127 | Ga0265331_10003341 | 3300031250 | Bacteria | 10410 |
| 128 | Ga0265327_10000136 | 3300031251 | Bacteria | 160868 |
| 129 | Ga0316575_10037832 | 3300031665 | Bacteria | 1902 |
| 130 | Ga0316579_10001118 | 3300031691 | Bacteria | 9530 |
| 131 | Ga0316579_10003335 | 3300031691 | Bacteria | 6241 |
| 132 | Ga0316579_10010113 | 3300031691 | Bacteria | 3981 |
| 133 | Ga0316579_10034654 | 3300031691 | Bacteria | 2323 |
| 134 | Ga0316576_10002904 | 3300031727 | Bacteria | 9902 |
| 135 | Ga0316576_10040646 | 3300031727 | Bacteria | 3344 |
| 136 | Ga0316578_10004087 | 3300031728 | Bacteria | 6821 |
| 137 | Ga0316578_10027739 | 3300031728 | Bacteria | 3202 |
| 138 | Ga0316578_10032179 | 3300031728 | Bacteria | 2994 |
| 139 | Ga0316578_10044003 | 3300031728 | Bacteria | 2595 |
| 140 | Ga0316578_10136826 | 3300031728 | Bacteria | 1475 |
| 141 | Ga0316578_10165932 | 3300031728 | Bacteria | 1331 |
| 142 | Ga0307516_10165048 | 3300031730 | Bacteria | 1960 |
| 143 | Ga0316577_10018749 | 3300031733 | Bacteria | 3828 |
| 144 | Ga0316577_10020502 | 3300031733 | Bacteria | 3663 |
| 145 | Ga0316577_10218622 | 3300031733 | Bacteria | 1077 |
| 146 | Ga0316583_10003350 | 3300032133 | Bacteria | 5639 |
| 147 | Ga0316583_10006431 | 3300032133 | Bacteria | 4220 |
| 148 | Ga0316585_10024012 | 3300032137 | Bacteria | 1883 |
| 149 | Ga0316585_10060365 | 3300032137 | Bacteria | 1225 |
| 150 | Ga0316580_10028994 | 3300032139 | Bacteria | 1711 |
| 151 | Ga0316593_10003931 | 3300032168 | Bacteria | 3752 |
| 152 | Ga0316593_10004210 | 3300032168 | Bacteria | 3670 |
| 153 | Ga0316592_1003781 | 3300033524 | Bacteria | 2765 |
| 154 | Ga0316596_1000172 | 3300033541 | Bacteria | 9190 |
| 155 | Ga0316596_1003954 | 3300033541 | Bacteria | 3285 |
| 156 | Ga0373943_0187742 | 3300035170 | Bacteria | 1139 |
| 157 | Ga0316574_0012338 | 3300035398 | Bacteria | 4886 |
| 158 | Ga0316574_0038678 | 3300035398 | Bacteria | 2930 |
| 159 | Ga0316574_0140216 | 3300035398 | Bacteria | 1557 |
| 160 | Ga0373927_0002019 | 3300035695 | Bacteria | 14944 |
| 161 | Ga0373927_0242543 | 3300035695 | Bacteria | 1184 |
| 162 | Ga0373933_0365685 | 3300035724 | Bacteria | 938 |
| 163 | Ga0373937_0286731 | 3300036401 | Bacteria | 1555 |
| 164 | Ga0316582_0004674 | 3300036647 | Bacteria | 6956 |
| 165 | Ga0316582_0014795 | 3300036647 | Bacteria | 4441 |
| 166 | Ga0316582_0022078 | 3300036647 | Bacteria | 3773 |
| 167 | Ga0316582_0041994 | 3300036647 | Bacteria | 2862 |
| 168 | Ga0316582_0272391 | 3300036647 | Bacteria | 1161 |
| 169 | Ga0316584_0009278 | 3300036712 | Bacteria | 6821 |
| 170 | Ga0316584_0009953 | 3300036712 | Bacteria | 6624 |
| 171 | Ga0316584_0077392 | 3300036712 | Bacteria | 2492 |
| 172 | Ga0316584_0094332 | 3300036712 | Bacteria | 2241 |
| 173 | Ga0316584_0115688 | 3300036712 | Bacteria | 2006 |
| 174 | Ga0316584_0121749 | 3300036712 | Bacteria | 1949 |
| 175 | Ga0316584_0134740 | 3300036712 | Unclassified | 1844 |
| 176 | Ga0316584_0301659 | 3300036712 | Bacteria | 1160 |
| 177 | Ga0395900_0276713 | 3300037418 | Unclassified | 1672 |
| 178 | Ga0316581_0000158 | 3300037588 | Bacteria | 10718 |
| 179 | Ga0316581_0051240 | 3300037588 | Bacteria | 1265 |
| 180 | Ga0316581_0070777 | 3300037588 | Bacteria | 1071 |
| 181 | Ga0395901_0353690 | 3300038443 | Bacteria | 1516 |
| 182 | Ga0395901_0582156 | 3300038443 | Bacteria | 1131 |
| 183 | Ga0400484_13143 | 3300038725 | Bacteria | 14777 |
| 184 | Ga0400484_28482 | 3300038725 | Bacteria | 8687 |
| 185 | Ga0400484_31130 | 3300038725 | Bacteria | 1588 |
| 186 | Ga0400484_41753 | 3300038725 | Bacteria | 2597 |
| 187 | Ga0400490_34427 | 3300038726 | Bacteria | 54087 |
| 188 | Ga0400485_05936 | 3300038735 | Bacteria | 4029 |
| 189 | Ga0400488_16254 | 3300038741 | Bacteria | 5676 |
| 190 | Ga0400488_48108 | 3300038741 | Bacteria | 1783 |
| 191 | Ga0400486_07711 | 3300038742 | Bacteria | 7084 |
| 192 | Ga0400486_25963 | 3300038742 | Bacteria | 1759 |
| 193 | Ga0400486_28024 | 3300038742 | Bacteria | 2267 |
| 194 | Ga0400483_014324 | 3300039062 | Bacteria | 21091 |
| 195 | Ga0400483_024657 | 3300039062 | Bacteria | 2489 |
| 196 | Ga0400483_110666 | 3300039062 | Bacteria | 1682 |
| 197 | Ga0400483_127740 | 3300039062 | Bacteria | 14794 |
| 198 | Ga0400483_177158 | 3300039062 | Bacteria | 1768 |
| 199 | Ga0400483_194764 | 3300039062 | Bacteria | 1595 |
| 200 | Ga0400483_213955 | 3300039062 | Bacteria | 1807 |
| 201 | Ga0400483_272952 | 3300039062 | Bacteria | 1272 |
| 202 | Ga0400489_75927 | 3300039093 | Bacteria | 24329 |
| 203 | Ga0400487_15776 | 3300039110 | Bacteria | 5314 |
| 204 | Ga0400487_25319 | 3300039110 | Bacteria | 4672 |
| 205 | Ga0400487_34970 | 3300039110 | Bacteria | 222491 |
| 206 | Ga0400487_54109 | 3300039110 | Bacteria | 47250 |
| 207 | Ga0439432_068677 | 3300042006 | Bacteria | 1083 |
| 208 | Ga0453684_0003670 | 3300044712 | Bacteria | 34052 |
| 209 | Ga0453684_0006330 | 3300044712 | Bacteria | 22598 |
| 210 | Ga0453684_0022650 | 3300044712 | Bacteria | 9308 |
| 211 | Ga0495580_0117261 | 3300046472 | Bacteria | 1849 |
| 212 | Ga0496100_0209427 | 3300048903 | Bacteria | 1425 |
| 213 | Ga0496101_0022804 | 3300048904 | Bacteria | 4315 |
| 214 | Ga0496109_0169455 | 3300048912 | Unclassified | 2048 |
| 215 | Ga0496114_0156841 | 3300048917 | Bacteria | 1977 |
| 216 | Ga0501031_0011446 | 3300049568 | Bacteria | 5779 |
| 217 | Ga0501033_0000240 | 3300049570 | Bacteria | 52539 |
| 218 | Ga0501033_0001675 | 3300049570 | Bacteria | 19372 |
| 219 | Ga0501033_0004527 | 3300049570 | Bacteria | 11127 |
| 220 | Ga0501034_0033186 | 3300049571 | Bacteria | 5239 |
| 221 | Ga0501036_0000922 | 3300049572 | Bacteria | 22063 |
| 222 | Ga0501036_0113756 | 3300049572 | Unclassified | 2287 |
| 223 | Ga0501037_0022211 | 3300049573 | Bacteria | 4694 |
| 224 | Ga0501037_0045130 | 3300049573 | Bacteria | 3235 |
| 225 | Ga0501037_0163486 | 3300049573 | Unclassified | 1586 |
| 226 | Ga0501037_0427959 | 3300049573 | Bacteria | 905 |
| 227 | Ga0501038_0003281 | 3300049574 | Bacteria | 15076 |
| 228 | Ga0501038_0007326 | 3300049574 | Bacteria | 10177 |
| 229 | Ga0501038_0055164 | 3300049574 | Unclassified | 3414 |
| 230 | Ga0501039_0014677 | 3300049575 | Bacteria | 5993 |
| 231 | Ga0501039_0185457 | 3300049575 | Bacteria | 1636 |
| 232 | Ga0501040_0000254 | 3300049576 | Bacteria | 31274 |
| 233 | Ga0501042_0306839 | 3300049578 | Bacteria | 1146 |
| 234 | Ga0501043_0001577 | 3300049579 | Bacteria | 19829 |
| 235 | Ga0501043_0027535 | 3300049579 | Unclassified | 4461 |
| 236 | Ga0501043_0032867 | 3300049579 | Unclassified | 4080 |
| 237 | Ga0501046_0000954 | 3300049580 | Bacteria | 28369 |
| 238 | Ga0501046_0028705 | 3300049580 | Bacteria | 4529 |
| 239 | Ga0501047_0326202 | 3300049581 | Unclassified | 1374 |
| 240 | Ga0501068_0123099 | 3300049584 | Bacteria | 1618 |
| 241 | Ga0501069_0109202 | 3300049585 | Unclassified | 1574 |
| 242 | Ga0501070_0003742 | 3300049586 | Bacteria | 13133 |
| 243 | Ga0501070_0015999 | 3300049586 | Bacteria | 6304 |
| 244 | Ga0501070_0028205 | 3300049586 | Bacteria | 4707 |
| 245 | Ga0501073_0025809 | 3300049589 | Bacteria | 4209 |
| 246 | Ga0501074_0000801 | 3300049590 | Bacteria | 19891 |
| 247 | Ga0501074_0183095 | 3300049590 | Bacteria | 1494 |
| 248 | Ga0501075_0133608 | 3300049591 | Unclassified | 1890 |
| 249 | Ga0501079_0110132 | 3300049741 | Bacteria | 2139 |
| 250 | Ga0501080_0003668 | 3300049742 | Bacteria | 13547 |
| 251 | Ga0501080_0013308 | 3300049742 | Bacteria | 7561 |
| 252 | Ga0501083_0012666 | 3300049744 | Bacteria | 5901 |
| 253 | Ga0501035_0001190 | 3300049822 | Bacteria | 27093 |
| 254 | Ga0501035_0037156 | 3300049822 | Bacteria | 4412 |
| 255 | Ga0501044_0000326 | 3300049823 | Bacteria | 60246 |
| 256 | Ga0501044_0017831 | 3300049823 | Bacteria | 7615 |
| 257 | Ga0501044_0104471 | 3300049823 | Bacteria | 2847 |
| 258 | nmdc:mga08y16_7922_c1 | 3300050511 | Bacteria | 11118 |
| 259 | nmdc:mga08x19_254844_c1 | 3300050514 | Bacteria | 1212 |
| 260 | Ga0501082_0172050 | 3300060353 | Bacteria | 1883 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0582156 | Ga0395901_0582156_395_1096 | 232 |
| 2 | 3300035695 | Ga0373927_0242543 | Ga0373927_0242543_268_1029 | 243 |
| 3 | 3300046472 | Ga0495580_0117261 | Ga0495580_0117261_706_1467 | 243 |
| 4 | 3300036712 | Ga0316584_0094332 | Ga0316584_0094332_1000_1761 | 245 |
| 5 | 3300038742 | Ga0400486_28024 | Ga0400486_28024_1254_2009 | 245 |
| 6 | 3300036647 | Ga0316582_0004674 | Ga0316582_0004674_313_1077 | 247 |
| 7 | 3300036712 | Ga0316584_0301659 | Ga0316584_0301659_219_983 | 247 |
| 8 | 3300010375 | Ga0105239_10742987 | Ga0105239_107429872 | 252 |
| 9 | 3300013105 | Ga0157369_10103765 | Ga0157369_101037652 | 252 |
| 10 | 3300035170 | Ga0373943_0187742 | Ga0373943_0187742_193_954 | 252 |
| 11 | 3300035695 | Ga0373927_0002019 | Ga0373927_0002019_12229_12990 | 252 |
| 12 | 3300036401 | Ga0373937_0286731 | Ga0373937_0286731_552_1313 | 252 |
| 13 | 3300038725 | Ga0400484_13143 | Ga0400484_13143_371_1132 | 252 |
| 14 | 3300042006 | Ga0439432_068677 | Ga0439432_068677_304_1065 | 252 |
| 15 | 3300050511 | nmdc:mga08y16_7922_c1 | nmdc:mga08y16_7922_c1_115_876 | 252 |
| 16 | 3300050514 | nmdc:mga08x19_254844_c1 | nmdc:mga08x19_254844_c1_240_1001 | 252 |
| 17 | 3300031727 | Ga0316576_10040646 | Ga0316576_100406463 | 253 |
| 18 | 3300036712 | Ga0316584_0115688 | Ga0316584_0115688_504_1268 | 253 |
| 19 | 3300036712 | Ga0316584_0121749 | Ga0316584_0121749_828_1595 | 253 |
| 20 | 3300031691 | Ga0316579_10034654 | Ga0316579_100346544 | 255 |
| 21 | 3300031727 | Ga0316576_10002904 | Ga0316576_100029049 | 255 |
| 22 | 3300031733 | Ga0316577_10018749 | Ga0316577_100187492 | 255 |
| 23 | 3300032139 | Ga0316580_10028994 | Ga0316580_100289942 | 255 |
| 24 | 3300037588 | Ga0316581_0051240 | Ga0316581_0051240_51_863 | 255 |
| 25 | 3300031733 | Ga0316577_10218622 | Ga0316577_102186222 | 258 |
| 26 | 3300032168 | Ga0316593_10003931 | Ga0316593_100039314 | 258 |
| 27 | 3300031250 | Ga0265331_10003341 | Ga0265331_100033415 | 259 |
| 28 | 3300031251 | Ga0265327_10000136 | Ga0265327_1000013611 | 259 |
| 29 | 3300035724 | Ga0373933_0365685 | Ga0373933_0365685_111_890 | 259 |
| 30 | 3300005347 | Ga0070668_100023271 | Ga0070668_1000232714 | 261 |
| 31 | 3300005354 | Ga0070675_100032800 | Ga0070675_1000328003 | 261 |
| 32 | 3300005456 | Ga0070678_100039382 | Ga0070678_1000393823 | 261 |
| 33 | 3300009553 | Ga0105249_10115352 | Ga0105249_101153522 | 261 |
| 34 | 3300005337 | Ga0070682_100240489 | Ga0070682_1002404892 | 262 |
| 35 | 3300005339 | Ga0070660_100068517 | Ga0070660_1000685172 | 262 |
| 36 | 3300005339 | Ga0070660_100410246 | Ga0070660_1004102461 | 262 |
| 37 | 3300005339 | Ga0070660_100424639 | Ga0070660_1004246391 | 262 |
| 38 | 3300005366 | Ga0070659_100088637 | Ga0070659_1000886372 | 262 |
| 39 | 3300005530 | Ga0070679_100382901 | Ga0070679_1003829011 | 262 |
| 40 | 3300005563 | Ga0068855_100872875 | Ga0068855_1008728751 | 262 |
| 41 | 3300005614 | Ga0068856_100083469 | Ga0068856_1000834693 | 262 |
| 42 | 3300009094 | Ga0111539_10006383 | Ga0111539_100063839 | 262 |
| 43 | 3300013100 | Ga0157373_10092211 | Ga0157373_100922112 | 262 |
| 44 | 3300013100 | Ga0157373_10243545 | Ga0157373_102435451 | 262 |
| 45 | 3300013308 | Ga0157375_10476557 | Ga0157375_104765572 | 262 |
| 46 | 3300014497 | Ga0182008_10037566 | Ga0182008_100375662 | 262 |
| 47 | 3300025919 | Ga0207657_10148114 | Ga0207657_101481142 | 262 |
| 48 | 3300025919 | Ga0207657_10498761 | Ga0207657_104987611 | 262 |
| 49 | 3300025925 | Ga0207650_10263725 | Ga0207650_102637252 | 262 |
| 50 | 3300026078 | Ga0207702_10046728 | Ga0207702_100467283 | 262 |
| 51 | 3300027907 | Ga0207428_10063974 | Ga0207428_100639742 | 262 |
| 52 | 3300037418 | Ga0395900_0276713 | Ga0395900_0276713_510_1301 | 262 |
| 53 | 3300038443 | Ga0395901_0353690 | Ga0395901_0353690_692_1483 | 262 |
| 54 | 3300048903 | Ga0496100_0209427 | Ga0496100_0209427_357_1148 | 262 |
| 55 | 3300048904 | Ga0496101_0022804 | Ga0496101_0022804_2892_3683 | 262 |
| 56 | 3300048912 | Ga0496109_0169455 | Ga0496109_0169455_134_925 | 262 |
| 57 | 3300048917 | Ga0496114_0156841 | Ga0496114_0156841_911_1702 | 262 |
| 58 | 3300049568 | Ga0501031_0011446 | Ga0501031_0011446_848_1639 | 262 |
| 59 | 3300049570 | Ga0501033_0000240 | Ga0501033_0000240_467_1258 | 262 |
| 60 | 3300049571 | Ga0501034_0033186 | Ga0501034_0033186_552_1343 | 262 |
| 61 | 3300049572 | Ga0501036_0000922 | Ga0501036_0000922_12751_13542 | 262 |
| 62 | 3300049572 | Ga0501036_0113756 | Ga0501036_0113756_20_811 | 262 |
| 63 | 3300049573 | Ga0501037_0427959 | Ga0501037_0427959_62_853 | 262 |
| 64 | 3300049574 | Ga0501038_0007326 | Ga0501038_0007326_7383_8174 | 262 |
| 65 | 3300049575 | Ga0501039_0185457 | Ga0501039_0185457_638_1429 | 262 |
| 66 | 3300049579 | Ga0501043_0032867 | Ga0501043_0032867_2265_3056 | 262 |
| 67 | 3300049823 | Ga0501044_0000326 | Ga0501044_0000326_45216_46007 | 262 |
| 68 | 3300049823 | Ga0501044_0104471 | Ga0501044_0104471_1825_2616 | 262 |
| 69 | 3300032133 | Ga0316583_10006431 | Ga0316583_100064312 | 263 |
| 70 | 3300044712 | Ga0453684_0006330 | Ga0453684_0006330_15647_16441 | 263 |
| 71 | 3300031691 | Ga0316579_10010113 | Ga0316579_100101136 | 264 |
| 72 | 3300032137 | Ga0316585_10060365 | Ga0316585_100603651 | 264 |
| 73 | 3300036647 | Ga0316582_0041994 | Ga0316582_0041994_1511_2305 | 264 |
| 74 | 3300038725 | Ga0400484_28482 | Ga0400484_28482_3540_4337 | 264 |
| 75 | 3300038725 | Ga0400484_31130 | Ga0400484_31130_67_864 | 264 |
| 76 | 3300038725 | Ga0400484_41753 | Ga0400484_41753_1506_2303 | 264 |
| 77 | 3300038726 | Ga0400490_34427 | Ga0400490_34427_14494_15291 | 264 |
| 78 | 3300038735 | Ga0400485_05936 | Ga0400485_05936_3020_3817 | 264 |
| 79 | 3300038741 | Ga0400488_16254 | Ga0400488_16254_2799_3596 | 264 |
| 80 | 3300038741 | Ga0400488_48108 | Ga0400488_48108_302_1099 | 264 |
| 81 | 3300038742 | Ga0400486_07711 | Ga0400486_07711_2794_3591 | 264 |
| 82 | 3300038742 | Ga0400486_25963 | Ga0400486_25963_358_1155 | 264 |
| 83 | 3300039062 | Ga0400483_024657 | Ga0400483_024657_1445_2242 | 264 |
| 84 | 3300039062 | Ga0400483_110666 | Ga0400483_110666_239_1036 | 264 |
| 85 | 3300039062 | Ga0400483_127740 | Ga0400483_127740_8984_9781 | 264 |
| 86 | 3300039062 | Ga0400483_177158 | Ga0400483_177158_538_1335 | 264 |
| 87 | 3300039062 | Ga0400483_194764 | Ga0400483_194764_321_1118 | 264 |
| 88 | 3300039062 | Ga0400483_213955 | Ga0400483_213955_100_897 | 264 |
| 89 | 3300039062 | Ga0400483_272952 | Ga0400483_272952_386_1183 | 264 |
| 90 | 3300039093 | Ga0400489_75927 | Ga0400489_75927_12703_13500 | 264 |
| 91 | 3300039110 | Ga0400487_15776 | Ga0400487_15776_1791_2588 | 264 |
| 92 | 3300039110 | Ga0400487_25319 | Ga0400487_25319_1144_1941 | 264 |
| 93 | 3300039110 | Ga0400487_54109 | Ga0400487_54109_35281_36075 | 264 |
| 94 | 3300044712 | Ga0453684_0022650 | Ga0453684_0022650_964_1761 | 264 |
| 95 | 3300049573 | Ga0501037_0022211 | Ga0501037_0022211_1075_1869 | 264 |
| 96 | 3300049573 | Ga0501037_0045130 | Ga0501037_0045130_2134_2928 | 264 |
| 97 | 3300049580 | Ga0501046_0028705 | Ga0501046_0028705_2444_3238 | 264 |
| 98 | 3300049581 | Ga0501047_0326202 | Ga0501047_0326202_298_1092 | 264 |
| 99 | 3300049585 | Ga0501069_0109202 | Ga0501069_0109202_708_1502 | 264 |
| 100 | 3300049586 | Ga0501070_0015999 | Ga0501070_0015999_2088_2882 | 264 |
| 101 | 3300049586 | Ga0501070_0028205 | Ga0501070_0028205_2136_2930 | 264 |
| 102 | 3300049590 | Ga0501074_0000801 | Ga0501074_0000801_6414_7208 | 264 |
| 103 | 3300049591 | Ga0501075_0133608 | Ga0501075_0133608_624_1418 | 264 |
| 104 | 3300049742 | Ga0501080_0013308 | Ga0501080_0013308_2486_3280 | 264 |
| 105 | 3300031728 | Ga0316578_10136826 | Ga0316578_101368262 | 265 |
| 106 | 3300031733 | Ga0316577_10020502 | Ga0316577_100205024 | 265 |
| 107 | 3300032137 | Ga0316585_10024012 | Ga0316585_100240122 | 265 |
| 108 | 3300032168 | Ga0316593_10004210 | Ga0316593_100042104 | 265 |
| 109 | 3300033524 | Ga0316592_1003781 | Ga0316592_10037813 | 265 |
| 110 | 3300033541 | Ga0316596_1000172 | Ga0316596_10001723 | 265 |
| 111 | 3300033541 | Ga0316596_1003954 | Ga0316596_10039542 | 265 |
| 112 | 3300036647 | Ga0316582_0022078 | Ga0316582_0022078_2271_3071 | 265 |
| 113 | 3300036712 | Ga0316584_0077392 | Ga0316584_0077392_1209_2009 | 265 |
| 114 | 3300039062 | Ga0400483_014324 | Ga0400483_014324_17211_18011 | 265 |
| 115 | 3300039110 | Ga0400487_34970 | Ga0400487_34970_221067_221867 | 265 |
| 116 | 3300044712 | Ga0453684_0003670 | Ga0453684_0003670_32197_32997 | 265 |
| 117 | 3300025910 | Ga0207684_10012739 | Ga0207684_100127394 | 266 |
| 118 | 3300025915 | Ga0207693_10043391 | Ga0207693_100433914 | 266 |
| 119 | 3300025932 | Ga0207690_10223695 | Ga0207690_102236952 | 266 |
| 120 | 3300025945 | Ga0207679_10114443 | Ga0207679_101144432 | 266 |
| 121 | 3300026041 | Ga0207639_10268683 | Ga0207639_102686832 | 266 |
| 122 | 3300035398 | Ga0316574_0012338 | Ga0316574_0012338_1404_2210 | 267 |
| 123 | 3300049570 | Ga0501033_0001675 | Ga0501033_0001675_13385_14209 | 268 |
| 124 | 3300049570 | Ga0501033_0004527 | Ga0501033_0004527_2315_3124 | 268 |
| 125 | 3300049573 | Ga0501037_0163486 | Ga0501037_0163486_46_870 | 268 |
| 126 | 3300049574 | Ga0501038_0003281 | Ga0501038_0003281_2364_3173 | 268 |
| 127 | 3300049574 | Ga0501038_0055164 | Ga0501038_0055164_819_1643 | 268 |
| 128 | 3300049575 | Ga0501039_0014677 | Ga0501039_0014677_2119_2943 | 268 |
| 129 | 3300049579 | Ga0501043_0001577 | Ga0501043_0001577_2128_2937 | 268 |
| 130 | 3300049579 | Ga0501043_0027535 | Ga0501043_0027535_2207_3031 | 268 |
| 131 | 3300049580 | Ga0501046_0000954 | Ga0501046_0000954_15332_16156 | 268 |
| 132 | 3300049584 | Ga0501068_0123099 | Ga0501068_0123099_351_1160 | 268 |
| 133 | 3300049586 | Ga0501070_0003742 | Ga0501070_0003742_6411_7235 | 268 |
| 134 | 3300049589 | Ga0501073_0025809 | Ga0501073_0025809_3267_4076 | 268 |
| 135 | 3300049590 | Ga0501074_0183095 | Ga0501074_0183095_623_1432 | 268 |
| 136 | 3300049741 | Ga0501079_0110132 | Ga0501079_0110132_1318_2127 | 268 |
| 137 | 3300049742 | Ga0501080_0003668 | Ga0501080_0003668_9341_10150 | 268 |
| 138 | 3300049744 | Ga0501083_0012666 | Ga0501083_0012666_1606_2415 | 268 |
| 139 | 3300049822 | Ga0501035_0001190 | Ga0501035_0001190_15876_16700 | 268 |
| 140 | 3300049822 | Ga0501035_0037156 | Ga0501035_0037156_284_1093 | 268 |
| 141 | 3300049823 | Ga0501044_0017831 | Ga0501044_0017831_3606_4415 | 268 |
| 142 | 3300060353 | Ga0501082_0172050 | Ga0501082_0172050_232_1041 | 268 |
| 143 | 3300031728 | Ga0316578_10027739 | Ga0316578_100277393 | 270 |
| 144 | 3300031728 | Ga0316578_10044003 | Ga0316578_100440034 | 270 |
| 145 | 3300031728 | Ga0316578_10165932 | Ga0316578_101659322 | 270 |
| 146 | 3300032133 | Ga0316583_10003350 | Ga0316583_100033508 | 270 |
| 147 | 3300035398 | Ga0316574_0038678 | Ga0316574_0038678_884_1696 | 270 |
| 148 | 3300035398 | Ga0316574_0140216 | Ga0316574_0140216_285_1097 | 270 |
| 149 | 3300036647 | Ga0316582_0272391 | Ga0316582_0272391_271_1083 | 270 |
| 150 | 3300036712 | Ga0316584_0009953 | Ga0316584_0009953_2666_3478 | 270 |
| 151 | 3300036712 | Ga0316584_0134740 | Ga0316584_0134740_975_1793 | 270 |
| 152 | 3300037588 | Ga0316581_0070777 | Ga0316581_0070777_165_1037 | 270 |
| 153 | 3300049576 | Ga0501040_0000254 | Ga0501040_0000254_768_1583 | 270 |
| 154 | 3300049578 | Ga0501042_0306839 | Ga0501042_0306839_122_937 | 270 |
| 155 | 3300025942 | Ga0207689_10093706 | Ga0207689_100937062 | 271 |
| 156 | 3300031665 | Ga0316575_10037832 | Ga0316575_100378322 | 272 |
| 157 | 3300031691 | Ga0316579_10003335 | Ga0316579_100033356 | 272 |
| 158 | 3300005329 | Ga0070683_100028253 | Ga0070683_1000282535 | 273 |
| 159 | 3300005330 | Ga0070690_100163484 | Ga0070690_1001634842 | 273 |
| 160 | 3300005331 | Ga0070670_100120704 | Ga0070670_1001207042 | 273 |
| 161 | 3300005343 | Ga0070687_100170093 | Ga0070687_1001700931 | 273 |
| 162 | 3300005344 | Ga0070661_100012118 | Ga0070661_1000121184 | 273 |
| 163 | 3300005345 | Ga0070692_10078034 | Ga0070692_100780342 | 273 |
| 164 | 3300005356 | Ga0070674_100483491 | Ga0070674_1004834911 | 273 |
| 165 | 3300005438 | Ga0070701_10051852 | Ga0070701_100518523 | 273 |
| 166 | 3300005441 | Ga0070700_100044170 | Ga0070700_1000441703 | 273 |
| 167 | 3300005456 | Ga0070678_100028661 | Ga0070678_1000286612 | 273 |
| 168 | 3300005458 | Ga0070681_10265039 | Ga0070681_102650391 | 273 |
| 169 | 3300005535 | Ga0070684_100088502 | Ga0070684_1000885022 | 273 |
| 170 | 3300005539 | Ga0068853_100047599 | Ga0068853_1000475992 | 273 |
| 171 | 3300005543 | Ga0070672_100036029 | Ga0070672_1000360293 | 273 |
| 172 | 3300005543 | Ga0070672_100071364 | Ga0070672_1000713642 | 273 |
| 173 | 3300005548 | Ga0070665_100026798 | Ga0070665_1000267984 | 273 |
| 174 | 3300005549 | Ga0070704_100016857 | Ga0070704_1000168572 | 273 |
| 175 | 3300005563 | Ga0068855_100038948 | Ga0068855_1000389487 | 273 |
| 176 | 3300005614 | Ga0068856_100090827 | Ga0068856_1000908273 | 273 |
| 177 | 3300005617 | Ga0068859_100099393 | Ga0068859_1000993932 | 273 |
| 178 | 3300005719 | Ga0068861_100067844 | Ga0068861_1000678442 | 273 |
| 179 | 3300005840 | Ga0068870_10175897 | Ga0068870_101758972 | 273 |
| 180 | 3300005841 | Ga0068863_100016743 | Ga0068863_1000167437 | 273 |
| 181 | 3300005841 | Ga0068863_100298751 | Ga0068863_1002987512 | 273 |
| 182 | 3300005842 | Ga0068858_100026435 | Ga0068858_1000264354 | 273 |
| 183 | 3300005843 | Ga0068860_100003098 | Ga0068860_10000309815 | 273 |
| 184 | 3300005844 | Ga0068862_100110812 | Ga0068862_1001108123 | 273 |
| 185 | 3300006358 | Ga0068871_100148708 | Ga0068871_1001487082 | 273 |
| 186 | 3300006881 | Ga0068865_100023324 | Ga0068865_1000233242 | 273 |
| 187 | 3300006881 | Ga0068865_100128402 | Ga0068865_1001284023 | 273 |
| 188 | 3300006881 | Ga0068865_100253896 | Ga0068865_1002538962 | 273 |
| 189 | 3300006931 | Ga0097620_100099395 | Ga0097620_1000993952 | 273 |
| 190 | 3300009093 | Ga0105240_10222385 | Ga0105240_102223852 | 273 |
| 191 | 3300009174 | Ga0105241_10005635 | Ga0105241_100056357 | 273 |
| 192 | 3300009177 | Ga0105248_10013667 | Ga0105248_100136674 | 273 |
| 193 | 3300009551 | Ga0105238_10036807 | Ga0105238_100368072 | 273 |
| 194 | 3300009551 | Ga0105238_10049879 | Ga0105238_100498793 | 273 |
| 195 | 3300011119 | Ga0105246_10023363 | Ga0105246_100233633 | 273 |
| 196 | 3300011119 | Ga0105246_10037421 | Ga0105246_100374213 | 273 |
| 197 | 3300013105 | Ga0157369_10010052 | Ga0157369_100100524 | 273 |
| 198 | 3300013105 | Ga0157369_10029634 | Ga0157369_100296348 | 273 |
| 199 | 3300013296 | Ga0157374_10505615 | Ga0157374_105056152 | 273 |
| 200 | 3300013306 | Ga0163162_10236328 | Ga0163162_102363281 | 273 |
| 201 | 3300013307 | Ga0157372_10001607 | Ga0157372_1000160717 | 273 |
| 202 | 3300013307 | Ga0157372_10237655 | Ga0157372_102376551 | 273 |
| 203 | 3300013307 | Ga0157372_10348570 | Ga0157372_103485702 | 273 |
| 204 | 3300013308 | Ga0157375_10052283 | Ga0157375_100522833 | 273 |
| 205 | 3300014325 | Ga0163163_10019732 | Ga0163163_100197324 | 273 |
| 206 | 3300014325 | Ga0163163_10110981 | Ga0163163_101109813 | 273 |
| 207 | 3300014968 | Ga0157379_10009222 | Ga0157379_100092224 | 273 |
| 208 | 3300014968 | Ga0157379_10316068 | Ga0157379_103160682 | 273 |
| 209 | 3300014969 | Ga0157376_10056355 | Ga0157376_100563553 | 273 |
| 210 | 3300025903 | Ga0207680_10103288 | Ga0207680_101032882 | 273 |
| 211 | 3300025904 | Ga0207647_10001761 | Ga0207647_100017616 | 273 |
| 212 | 3300025908 | Ga0207643_10022745 | Ga0207643_100227453 | 273 |
| 213 | 3300025911 | Ga0207654_10006907 | Ga0207654_100069073 | 273 |
| 214 | 3300025911 | Ga0207654_10274746 | Ga0207654_102747462 | 273 |
| 215 | 3300025913 | Ga0207695_10000970 | Ga0207695_1000097030 | 273 |
| 216 | 3300025914 | Ga0207671_10005239 | Ga0207671_100052393 | 273 |
| 217 | 3300025918 | Ga0207662_10251131 | Ga0207662_102511312 | 273 |
| 218 | 3300025919 | Ga0207657_10043917 | Ga0207657_100439173 | 273 |
| 219 | 3300025920 | Ga0207649_10046376 | Ga0207649_100463762 | 273 |
| 220 | 3300025923 | Ga0207681_10033120 | Ga0207681_100331202 | 273 |
| 221 | 3300025924 | Ga0207694_10083109 | Ga0207694_100831092 | 273 |
| 222 | 3300025925 | Ga0207650_10138092 | Ga0207650_101380922 | 273 |
| 223 | 3300025926 | Ga0207659_10048046 | Ga0207659_100480463 | 273 |
| 224 | 3300025931 | Ga0207644_10214892 | Ga0207644_102148921 | 273 |
| 225 | 3300025935 | Ga0207709_10044867 | Ga0207709_100448673 | 273 |
| 226 | 3300025937 | Ga0207669_10344210 | Ga0207669_103442102 | 273 |
| 227 | 3300025938 | Ga0207704_10021726 | Ga0207704_100217262 | 273 |
| 228 | 3300025938 | Ga0207704_10152213 | Ga0207704_101522133 | 273 |
| 229 | 3300025938 | Ga0207704_10248847 | Ga0207704_102488472 | 273 |
| 230 | 3300025940 | Ga0207691_10004824 | Ga0207691_1000482414 | 273 |
| 231 | 3300025940 | Ga0207691_10087323 | Ga0207691_100873233 | 273 |
| 232 | 3300025941 | Ga0207711_10049859 | Ga0207711_100498593 | 273 |
| 233 | 3300025942 | Ga0207689_10104543 | Ga0207689_101045433 | 273 |
| 234 | 3300025942 | Ga0207689_10132256 | Ga0207689_101322563 | 273 |
| 235 | 3300025944 | Ga0207661_10708124 | Ga0207661_107081241 | 273 |
| 236 | 3300025949 | Ga0207667_10119611 | Ga0207667_101196112 | 273 |
| 237 | 3300025949 | Ga0207667_10412629 | Ga0207667_104126292 | 273 |
| 238 | 3300025972 | Ga0207668_10070406 | Ga0207668_100704062 | 273 |
| 239 | 3300025972 | Ga0207668_10362588 | Ga0207668_103625881 | 273 |
| 240 | 3300025981 | Ga0207640_10040117 | Ga0207640_100401174 | 273 |
| 241 | 3300025981 | Ga0207640_10108596 | Ga0207640_101085963 | 273 |
| 242 | 3300026041 | Ga0207639_10000361 | Ga0207639_1000036116 | 273 |
| 243 | 3300026075 | Ga0207708_10006842 | Ga0207708_100068426 | 273 |
| 244 | 3300026078 | Ga0207702_10016960 | Ga0207702_100169604 | 273 |
| 245 | 3300026078 | Ga0207702_10178600 | Ga0207702_101786002 | 273 |
| 246 | 3300026088 | Ga0207641_10072215 | Ga0207641_100722152 | 273 |
| 247 | 3300026089 | Ga0207648_10008641 | Ga0207648_100086416 | 273 |
| 248 | 3300026089 | Ga0207648_10077024 | Ga0207648_100770243 | 273 |
| 249 | 3300026116 | Ga0207674_10004738 | Ga0207674_100047384 | 273 |
| 250 | 3300026121 | Ga0207683_10056531 | Ga0207683_100565313 | 273 |
| 251 | 3300028379 | Ga0268266_10109706 | Ga0268266_101097062 | 273 |
| 252 | 3300028380 | Ga0268265_10216265 | Ga0268265_102162652 | 273 |
| 253 | 3300028381 | Ga0268264_10011519 | Ga0268264_100115198 | 273 |
| 254 | 3300031691 | Ga0316579_10001118 | Ga0316579_100011183 | 273 |
| 255 | 3300031728 | Ga0316578_10004087 | Ga0316578_100040874 | 273 |
| 256 | 3300031728 | Ga0316578_10032179 | Ga0316578_100321793 | 273 |
| 257 | 3300031730 | Ga0307516_10165048 | Ga0307516_101650482 | 273 |
| 258 | 3300036647 | Ga0316582_0014795 | Ga0316582_0014795_912_1739 | 273 |
| 259 | 3300036712 | Ga0316584_0009278 | Ga0316584_0009278_3748_4575 | 273 |
| 260 | 3300037588 | Ga0316581_0000158 | Ga0316581_0000158_971_1798 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ez4-assembly1.cif.gz_I | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei | 0.987 | 12 | 273 |
| 3vav-assembly1.cif.gz_G | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis | 0.9869 | 10 | 273 |
| 3ez4-assembly1.cif.gz_J | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei | 0.9865 | 12 | 273 |
| 3vav-assembly1.cif.gz_I | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis | 0.9861 | 10 | 273 |
| 3vav-assembly1.cif.gz_F | crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis | 0.9857 | 10 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3vavB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.979 | 10 | 273 | 3.20.20.60 |
| 3vavB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9753 | 10 | 273 | 3.20.20.60 |
| af_A0A0R0J726_27_197_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9595 | 10 | 172 | 3.20.20.60 |
| af_A0A0R0J726_27_197_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9106 | 10 | 172 | 3.20.20.60 |
| af_Q9AWZ7_81_360_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.867 | 10 | 272 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9L1W3-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) | 0.9936 | 10 | 154 |
GO:0000287
GO:0003864 GO:0005737 GO:0008168 GO:0015940 GO:0032259 |
| AF-A0A7Z9XPV4-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) | 0.9881 | 11 | 273 |
GO:0000287
GO:0003864 GO:0005737 GO:0008168 GO:0015940 GO:0032259 |
| AF-A0A1W9L1W3-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) | 0.9868 | 10 | 154 |
GO:0000287
GO:0003864 GO:0005737 GO:0008168 GO:0015940 GO:0032259 |
| AF-A0A353VUZ7-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) | 0.9854 | 10 | 273 |
GO:0000287
GO:0003864 GO:0005737 GO:0008168 GO:0015940 GO:0032259 |
| AF-M4UAA2-F1-model_v4 | 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) | 0.9851 | 10 | 273 |
GO:0000287
GO:0003864 GO:0005737 GO:0008168 GO:0015940 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar