F369599

General Info

Members Datasets Scaffolds Average Seq Length
260 153 520 484

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10021464|Ga0207646_100214642
Length 555
Sequence VPQRYSFQQFFIGAGFQKGVQMRKPMTFRRLSAAAGAAGLTVLSWGAGVGAGQAFAAGTTSSYLVVFKSSQVPSSAAGTIQNAGGTLVATYDQIGVALARSDNQYFRSNLLADATVDDASSTAGLGYQLFDGQAETDTASGPAPGDLPNSPAADSDSLSPLQWDMRQIKTPQAHAITGGSPAVLIGDIDTGVDFNHPDLKQNLDVADSVNCVSGKPVPGQAAQDDNGHGTHTAGTMVAAAKGFGIVGVAPNVRLAAIKAGNSDGFFFPESVVCAFMWAGTHHVDVTNNSYFADPFLFNCRNDATQRAIWKAEDRAIRFAMQNGVTVVAAEGNESDDLTHPTQDVTSPDTIPNPSPRPVTNACVVIPVEIPGVIGVTAAGNSLQDPANPQNGYLKSFFSSYGMGVTQVVAPGGDSLFGRTPQAVNGRVLSTFPPNQFCRRSVKEPSSDPIEPTVVYCYLQGTSMASPHAAGTAALIISEFGNLSSSKGKMSPGQVAAMLEQTADSQPCPATLPPGYAAFVSVSNGAPQQCSGGSGYNSWYGHGQVDALRAVTHTTA

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
75 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
76 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
151 2643221647 Streptomyces sp. Root369 Isolate Unclassified
152 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
153 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0.38
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 5
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10021464 3300025922 Bacteria 5965
2 JGI25406J46586_10001283 3300003203 Bacteria 11808
3 rootL2_10040494 3300003322 Bacteria 3295
4 Ga0070683_100023892 3300005329 Bacteria 5472
5 Ga0070683_100048843 3300005329 Bacteria 3912
6 Ga0070670_100076895 3300005331 Bacteria 2868
7 Ga0070680_100086569 3300005336 Bacteria 2590
8 Ga0070674_100099133 3300005356 Bacteria 2119
9 Ga0070703_10000005 3300005406 Bacteria 127348
10 Ga0070714_100022001 3300005435 Bacteria 5223
11 Ga0070714_100061933 3300005435 Bacteria 3214
12 Ga0070713_100037003 3300005436 Bacteria 3943
13 Ga0070705_100002304 3300005440 Bacteria 9646
14 Ga0070705_100038778 3300005440 Bacteria 2698
15 Ga0070705_100056845 3300005440 Bacteria 2305
16 Ga0070708_100000001 3300005445 Bacteria 245117
17 Ga0070708_100000685 3300005445 Bacteria 25748
18 Ga0070708_100008749 3300005445 Bacteria 8138
19 Ga0070708_100170102 3300005445 Bacteria 2034
20 Ga0070681_10016532 3300005458 Bacteria 7367
21 Ga0068867_100069248 3300005459 Bacteria 2635
22 Ga0068867_100097719 3300005459 Bacteria 2238
23 Ga0070706_100000004 3300005467 Bacteria 281790
24 Ga0070706_100000036 3300005467 Bacteria 151766
25 Ga0070706_100000231 3300005467 Bacteria 68414
26 Ga0070706_100000536 3300005467 Bacteria 44180
27 Ga0070706_100001798 3300005467 Bacteria 22203
28 Ga0070706_100033101 3300005467 Bacteria 4771
29 Ga0070706_100177655 3300005467 Bacteria 1988
30 Ga0070707_100000002 3300005468 Bacteria 291540
31 Ga0070707_100002755 3300005468 Bacteria 16736
32 Ga0070707_100003166 3300005468 Bacteria 15576
33 Ga0070707_100006357 3300005468 Bacteria 10987
34 Ga0070707_100006537 3300005468 Bacteria 10820
35 Ga0070707_100006629 3300005468 Bacteria 10735
36 Ga0070707_100014194 3300005468 Bacteria 7465
37 Ga0070707_100014831 3300005468 Bacteria 7306
38 Ga0070707_100037177 3300005468 Bacteria 4646
39 Ga0070698_100000129 3300005471 Bacteria 65832
40 Ga0070698_100002508 3300005471 Bacteria 20244
41 Ga0070698_100008230 3300005471 Bacteria 11281
42 Ga0070698_100009053 3300005471 Bacteria 10704
43 Ga0070698_100012870 3300005471 Bacteria 8860
44 Ga0070698_100056577 3300005471 Bacteria 3974
45 Ga0070699_100000111 3300005518 Bacteria 75509
46 Ga0070699_100010699 3300005518 Bacteria 7940
47 Ga0070699_100038017 3300005518 Bacteria 4167
48 Ga0070699_100043328 3300005518 Bacteria 3896
49 Ga0070699_100058050 3300005518 Bacteria 3352
50 Ga0070679_100049814 3300005530 Bacteria 4172
51 Ga0070679_100260998 3300005530 Bacteria 1688
52 Ga0070684_100109346 3300005535 Bacteria 2478
53 Ga0070697_100003852 3300005536 Bacteria 11523
54 Ga0070697_100014002 3300005536 Bacteria 6298
55 Ga0070697_100015599 3300005536 Bacteria 5965
56 Ga0070697_100023861 3300005536 Bacteria 4867
57 Ga0070697_100025484 3300005536 Bacteria 4717
58 Ga0070697_100050898 3300005536 Bacteria 3364
59 Ga0070697_100069026 3300005536 Bacteria 2894
60 Ga0068853_100048525 3300005539 Bacteria 3647
61 Ga0070696_100010456 3300005546 Bacteria 6219
62 Ga0070665_100025186 3300005548 Bacteria 5995
63 Ga0070665_100030782 3300005548 Bacteria 5401
64 Ga0070664_100037229 3300005564 Bacteria 4089
65 Ga0068857_100108178 3300005577 Bacteria 2498
66 Ga0068856_100082031 3300005614 Bacteria 3200
67 Ga0068856_100104309 3300005614 Bacteria 2829
68 Ga0068856_100192868 3300005614 Bacteria 2051
69 Ga0068852_100160638 3300005616 Bacteria 2098
70 Ga0068864_100092659 3300005618 Bacteria 2668
71 Ga0081455_10016092 3300005937 Bacteria 7235
72 Ga0081538_10005894 3300005981 Bacteria 10919
73 Ga0081539_10000347 3300005985 Bacteria 101910
74 Ga0075365_10012837 3300006038 Bacteria 4990
75 Ga0075363_100027998 3300006048 Bacteria 2895
76 Ga0075364_10028455 3300006051 Bacteria 3578
77 Ga0070716_100007058 3300006173 Bacteria 5513
78 Ga0070716_100067099 3300006173 Bacteria 2095
79 Ga0075428_100101762 3300006844 Unclassified 3132
80 Ga0075433_10008959 3300006852 Bacteria 7990
81 Ga0075434_100023358 3300006871 Bacteria 6024
82 Ga0075429_100128432 3300006880 Unclassified 2217
83 Ga0075436_100014206 3300006914 Bacteria 5451
84 Ga0075435_100051141 3300007076 Bacteria 3328
85 Ga0075435_100149697 3300007076 Bacteria 1961
86 Ga0075435_100167953 3300007076 Bacteria 1850
87 Ga0099794_10000181 3300007265 Bacteria 23021
88 Ga0105240_10020136 3300009093 Bacteria 8904
89 Ga0114129_10006176 3300009147 Bacteria 16998
90 Ga0114129_10184750 3300009147 Unclassified 2834
91 Ga0105243_10002971 3300009148 Bacteria 14010
92 Ga0105243_10181511 3300009148 Bacteria 1831
93 Ga0105239_10044881 3300010375 Bacteria 4845
94 Ga0157369_10036524 3300013105 Bacteria 5382
95 Ga0157378_10007606 3300013297 Bacteria 9458
96 Ga0157372_10128778 3300013307 Bacteria 2911
97 Ga0163163_10064939 3300014325 Bacteria 3622
98 Ga0157377_10029859 3300014745 Bacteria 2948
99 Ga0157379_10034548 3300014968 Bacteria 4508
100 Ga0206356_11896627 3300020070 Bacteria 2646
101 Ga0207653_10000002 3300025885 Bacteria 270513
102 Ga0207653_10005138 3300025885 Bacteria 4090
103 Ga0207642_10031532 3300025899 Bacteria 2221
104 Ga0207684_10000010 3300025910 Bacteria 552805
105 Ga0207684_10000020 3300025910 Bacteria 342787
106 Ga0207684_10000033 3300025910 Bacteria 291567
107 Ga0207684_10000123 3300025910 Bacteria 142518
108 Ga0207684_10003599 3300025910 Bacteria 15083
109 Ga0207684_10011437 3300025910 Bacteria 7764
110 Ga0207684_10120547 3300025910 Bacteria 2249
111 Ga0207707_10048894 3300025912 Bacteria 3685
112 Ga0207695_10069171 3300025913 Bacteria 3614
113 Ga0207652_10018263 3300025921 Bacteria 5751
114 Ga0207646_10000007 3300025922 Bacteria 478285
115 Ga0207646_10000021 3300025922 Bacteria 272003
116 Ga0207646_10000883 3300025922 Bacteria 38704
117 Ga0207646_10001140 3300025922 Bacteria 33868
118 Ga0207646_10003812 3300025922 Bacteria 16764
119 Ga0207646_10008333 3300025922 Bacteria 10404
120 Ga0207646_10033287 3300025922 Bacteria 4663
121 Ga0207646_10034740 3300025922 Bacteria 4557
122 Ga0207700_10000004 3300025928 Bacteria 443409
123 Ga0207686_10032391 3300025934 Bacteria 3111
124 Ga0207709_10094158 3300025935 Bacteria 1966
125 Ga0207709_10095581 3300025935 Bacteria 1953
126 Ga0207665_10012541 3300025939 Bacteria 5568
127 Ga0207665_10043260 3300025939 Bacteria 3011
128 Ga0207661_10010514 3300025944 Bacteria 6664
129 Ga0207679_10091214 3300025945 Bacteria 2357
130 Ga0207648_10125435 3300026089 Bacteria 2258
131 Ga0207674_10070899 3300026116 Bacteria 3503
132 Ga0207675_100031800 3300026118 Bacteria 4916
133 Ga0207675_100036715 3300026118 Bacteria 4570
134 Ga0207683_10062882 3300026121 Bacteria 3269
135 Ga0209588_1000216 3300027671 Bacteria 15517
136 Ga0268266_10004842 3300028379 Bacteria 12782
137 Ga0268266_10061897 3300028379 Bacteria 3228
138 Ga0268265_10007240 3300028380 Bacteria 7500
139 Ga0316176_1086441 3300030732 Bacteria 6459
140 Ga0314311_1023733 3300030733 Bacteria 3253
141 Ga0316180_1036789 3300030736 Bacteria 3474
142 Ga0307509_10000021 3300031507 Bacteria 250589
143 Ga0307408_100100619 3300031548 Bacteria 2202
144 Ga0307514_10002647 3300031649 Bacteria 18263
145 Ga0307410_10006759 3300031852 Bacteria 6220
146 Ga0307406_10055956 3300031901 Bacteria 2523
147 Ga0307407_10075636 3300031903 Bacteria 2019
148 Ga0307409_100056284 3300031995 Bacteria 3040
149 Ga0307416_100056262 3300032002 Bacteria 3173
150 Ga0307416_100101707 3300032002 Bacteria 2504
151 Ga0307414_10009879 3300032004 Bacteria 5503
152 Ga0307411_10000444 3300032005 Bacteria 14183
153 Ga0307415_100074877 3300032126 Bacteria 2394
154 Ga0307415_100114742 3300032126 Bacteria 2006
155 Ga0307415_100139728 3300032126 Unclassified 1848
156 Ga0307510_10005631 3300033180 Bacteria 14933
157 Ga0373943_0091276 3300035170 Bacteria 1578
158 Ga0373925_0094391 3300037068 Unclassified 2291
159 Ga0395899_0008088 3300037312 Bacteria 8099
160 Ga0395899_0075229 3300037312 Bacteria 2466
161 Ga0395900_0004695 3300037418 Bacteria 14403
162 Ga0395900_0014914 3300037418 Bacteria 7918
163 Ga0395900_0051185 3300037418 Bacteria 4255
164 Ga0395900_0136937 3300037418 Bacteria 2509
165 Ga0395898_0012585 3300037466 Bacteria 8748
166 Ga0395898_0032724 3300037466 Bacteria 5191
167 Ga0395905_0005367 3300037471 Bacteria 13098
168 Ga0395905_0030310 3300037471 Bacteria 5098
169 Ga0395905_0039875 3300037471 Bacteria 4406
170 Ga0395905_0110367 3300037471 Bacteria 2583
171 Ga0395905_0147967 3300037471 Bacteria 2210
172 Ga0395905_0184474 3300037471 Bacteria 1959
173 Ga0395901_0020725 3300038443 Bacteria 6729
174 Ga0395901_0021239 3300038443 Bacteria 6649
175 Ga0395901_0023073 3300038443 Bacteria 6377
176 Ga0395901_0027160 3300038443 Bacteria 5880
177 Ga0395901_0029029 3300038443 Bacteria 5690
178 Ga0395901_0069541 3300038443 Bacteria 3667
179 Ga0395901_0101293 3300038443 Bacteria 3022
180 Ga0395901_0168556 3300038443 Unclassified 2298
181 Ga0395901_0199610 3300038443 Bacteria 2097
182 Ga0451577_0009815 3300042876 Bacteria 9172
183 Ga0466972_0021208 3300044658 Bacteria 3241
184 Ga0466965_0002513 3300044683 Bacteria 7814
185 Ga0466965_0060935 3300044683 Bacteria 1886
186 Ga0466961_0009732 3300044693 Bacteria 6119
187 Ga0466963_0000821 3300044694 Bacteria 15534
188 Ga0466963_0005422 3300044694 Bacteria 7469
189 Ga0466963_0008659 3300044694 Bacteria 6107
190 Ga0466963_0041428 3300044694 Bacteria 3020
191 Ga0466963_0111922 3300044694 Bacteria 1875
192 Ga0466963_0153080 3300044694 Bacteria 1602
193 Ga0453684_0093873 3300044712 Unclassified 3694
194 Ga0466971_0004420 3300044719 Bacteria 6065
195 Ga0466971_0021676 3300044719 Bacteria 2860
196 Ga0466968_0027917 3300044735 Bacteria 2324
197 Ga0466957_0013862 3300044842 Bacteria 4686
198 Ga0466957_0086297 3300044842 Bacteria 1961
199 Ga0466958_0002025 3300045836 Bacteria 9996
200 Ga0466958_0007325 3300045836 Bacteria 6062
201 Ga0466958_0095428 3300045836 Bacteria 1844
202 Ga0466967_0020549 3300045976 Bacteria 5342
203 Ga0466967_0038486 3300045976 Bacteria 4103
204 Ga0466967_0090395 3300045976 Bacteria 2781
205 Ga0495603_0034677 3300046455 Bacteria 3033
206 Ga0495629_0030535 3300046459 Bacteria 3819
207 Ga0495580_0085942 3300046472 Bacteria 2190
208 Ga0495605_0004600 3300046474 Bacteria 8076
209 Ga0495584_0037823 3300046491 Bacteria 2440
210 Ga0495584_0042986 3300046491 Bacteria 2281
211 Ga0495606_0005571 3300046507 Bacteria 12001
212 Ga0495616_0015796 3300046513 Bacteria 4190
213 Ga0495618_0047537 3300046514 Bacteria 2708
214 Ga0495630_0030565 3300046517 Bacteria 4008
215 Ga0495630_0050916 3300046517 Bacteria 3099
216 Ga0495643_0034517 3300046522 Bacteria 2790
217 Ga0495648_0117133 3300046524 Bacteria 1438
218 Ga0495609_0023136 3300046538 Bacteria 2856
219 Ga0495597_0019018 3300046542 Bacteria 3218
220 Ga0495622_0035079 3300046557 Bacteria 2339
221 Ga0495667_0046471 3300046559 Bacteria 2871
222 Ga0495634_0055865 3300046642 Bacteria 2639
223 Ga0495613_0018952 3300046689 Bacteria 5127
224 Ga0495613_0113029 3300046689 Bacteria 1955
225 Ga0495624_0023619 3300046690 Bacteria 4053
226 Ga0495683_0037454 3300047323 Bacteria 2458
227 Ga0495687_025998 3300047443 Bacteria 2760
228 Ga0495686_0032592 3300047472 Bacteria 3371
229 Ga0496104_0062087 3300048907 Bacteria 3543
230 Ga0496104_0079600 3300048907 Bacteria 3124
231 Ga0496105_0032378 3300048908 Bacteria 4290
232 Ga0496105_0168370 3300048908 Bacteria 1797
233 Ga0496108_0018827 3300048911 Bacteria 5661
234 Ga0496109_0012049 3300048912 Bacteria 7448
235 Ga0496110_0022580 3300048913 Bacteria 5344
236 Ga0496110_0052263 3300048913 Bacteria 3591
237 Ga0496110_0055692 3300048913 Bacteria 3480
238 Ga0496111_0038468 3300048914 Bacteria 3428
239 Ga0496112_0056128 3300048915 Bacteria 3876
240 Ga0496113_0138984 3300048916 Bacteria 1910
241 Ga0496114_0068700 3300048917 Bacteria 2975
242 Ga0496116_0023761 3300048919 Bacteria 4555
243 Ga0496117_0000229 3300048920 Bacteria 105861
244 Ga0496118_0000016 3300048921 Bacteria 549586
245 Ga0496119_0000446 3300048922 Bacteria 56404
246 Ga0496125_0006382 3300048928 Bacteria 12778
247 Ga0496126_0037579 3300048929 Bacteria 4516
248 Ga0496126_0243352 3300048929 Bacteria 1502
249 nmdc:mga00v17_20443_c1 3300050491 Bacteria 3792
250 nmdc:mga0yw44_47428_c1 3300050492 Bacteria 2586
251 nmdc:mga05p37_145483_c1 3300050507 Unclassified 2903
252 nmdc:mga05p37_74069_c1 3300050507 Unclassified 4191
253 nmdc:mga09592_128662_c1 3300050508 Unclassified 2178
254 nmdc:mga0n895_113695_c1 3300050512 Bacteria 2725
255 nmdc:mga0rr50_101000_c1 3300050513 Bacteria 2267
256 nmdc:mga0a205_43014_c1 3300050515 Bacteria 4355
257 Ga0500600_0068730 3300053149 Bacteria 1949
258 2644270731 2643221647 Bacteria 10741251
259 2819426219 2818991318 Bacteria 5266538
260 2862289090 2862281513 Bacteria 9621493
261 Ga0207646_10021464
262 JGI25406J46586_10001283
263 rootL2_10040494
264 Ga0070683_100023892
265 Ga0070683_100048843
266 Ga0070670_100076895
267 Ga0070680_100086569
268 Ga0070674_100099133
269 Ga0070703_10000005
270 Ga0070714_100022001
271 Ga0070714_100061933
272 Ga0070713_100037003
273 Ga0070705_100002304
274 Ga0070705_100038778
275 Ga0070705_100056845
276 Ga0070708_100000001
277 Ga0070708_100000685
278 Ga0070708_100008749
279 Ga0070708_100170102
280 Ga0070681_10016532
281 Ga0068867_100069248
282 Ga0068867_100097719
283 Ga0070706_100000004
284 Ga0070706_100000036
285 Ga0070706_100000231
286 Ga0070706_100000536
287 Ga0070706_100001798
288 Ga0070706_100033101
289 Ga0070706_100177655
290 Ga0070707_100000002
291 Ga0070707_100002755
292 Ga0070707_100003166
293 Ga0070707_100006357
294 Ga0070707_100006537
295 Ga0070707_100006629
296 Ga0070707_100014194
297 Ga0070707_100014831
298 Ga0070707_100037177
299 Ga0070698_100000129
300 Ga0070698_100002508
301 Ga0070698_100008230
302 Ga0070698_100009053
303 Ga0070698_100012870
304 Ga0070698_100056577
305 Ga0070699_100000111
306 Ga0070699_100010699
307 Ga0070699_100038017
308 Ga0070699_100043328
309 Ga0070699_100058050
310 Ga0070679_100049814
311 Ga0070679_100260998
312 Ga0070684_100109346
313 Ga0070697_100003852
314 Ga0070697_100014002
315 Ga0070697_100015599
316 Ga0070697_100023861
317 Ga0070697_100025484
318 Ga0070697_100050898
319 Ga0070697_100069026
320 Ga0068853_100048525
321 Ga0070696_100010456
322 Ga0070665_100025186
323 Ga0070665_100030782
324 Ga0070664_100037229
325 Ga0068857_100108178
326 Ga0068856_100082031
327 Ga0068856_100104309
328 Ga0068856_100192868
329 Ga0068852_100160638
330 Ga0068864_100092659
331 Ga0081455_10016092
332 Ga0081538_10005894
333 Ga0081539_10000347
334 Ga0075365_10012837
335 Ga0075363_100027998
336 Ga0075364_10028455
337 Ga0070716_100007058
338 Ga0070716_100067099
339 Ga0075428_100101762
340 Ga0075433_10008959
341 Ga0075434_100023358
342 Ga0075429_100128432
343 Ga0075436_100014206
344 Ga0075435_100051141
345 Ga0075435_100149697
346 Ga0075435_100167953
347 Ga0099794_10000181
348 Ga0105240_10020136
349 Ga0114129_10006176
350 Ga0114129_10184750
351 Ga0105243_10002971
352 Ga0105243_10181511
353 Ga0105239_10044881
354 Ga0157369_10036524
355 Ga0157378_10007606
356 Ga0157372_10128778
357 Ga0163163_10064939
358 Ga0157377_10029859
359 Ga0157379_10034548
360 Ga0206356_11896627
361 Ga0207653_10000002
362 Ga0207653_10005138
363 Ga0207642_10031532
364 Ga0207684_10000010
365 Ga0207684_10000020
366 Ga0207684_10000033
367 Ga0207684_10000123
368 Ga0207684_10003599
369 Ga0207684_10011437
370 Ga0207684_10120547
371 Ga0207707_10048894
372 Ga0207695_10069171
373 Ga0207652_10018263
374 Ga0207646_10000007
375 Ga0207646_10000021
376 Ga0207646_10000883
377 Ga0207646_10001140
378 Ga0207646_10003812
379 Ga0207646_10008333
380 Ga0207646_10033287
381 Ga0207646_10034740
382 Ga0207700_10000004
383 Ga0207686_10032391
384 Ga0207709_10094158
385 Ga0207709_10095581
386 Ga0207665_10012541
387 Ga0207665_10043260
388 Ga0207661_10010514
389 Ga0207679_10091214
390 Ga0207648_10125435
391 Ga0207674_10070899
392 Ga0207675_100031800
393 Ga0207675_100036715
394 Ga0207683_10062882
395 Ga0209588_1000216
396 Ga0268266_10004842
397 Ga0268266_10061897
398 Ga0268265_10007240
399 Ga0316176_1086441
400 Ga0314311_1023733
401 Ga0316180_1036789
402 Ga0307509_10000021
403 Ga0307408_100100619
404 Ga0307514_10002647
405 Ga0307410_10006759
406 Ga0307406_10055956
407 Ga0307407_10075636
408 Ga0307409_100056284
409 Ga0307416_100056262
410 Ga0307416_100101707
411 Ga0307414_10009879
412 Ga0307411_10000444
413 Ga0307415_100074877
414 Ga0307415_100114742
415 Ga0307415_100139728
416 Ga0307510_10005631
417 Ga0373943_0091276
418 Ga0373925_0094391
419 Ga0395899_0008088
420 Ga0395899_0075229
421 Ga0395900_0004695
422 Ga0395900_0014914
423 Ga0395900_0051185
424 Ga0395900_0136937
425 Ga0395898_0012585
426 Ga0395898_0032724
427 Ga0395905_0005367
428 Ga0395905_0030310
429 Ga0395905_0039875
430 Ga0395905_0110367
431 Ga0395905_0147967
432 Ga0395905_0184474
433 Ga0395901_0020725
434 Ga0395901_0021239
435 Ga0395901_0023073
436 Ga0395901_0027160
437 Ga0395901_0029029
438 Ga0395901_0069541
439 Ga0395901_0101293
440 Ga0395901_0168556
441 Ga0395901_0199610
442 Ga0451577_0009815
443 Ga0466972_0021208
444 Ga0466965_0002513
445 Ga0466965_0060935
446 Ga0466961_0009732
447 Ga0466963_0000821
448 Ga0466963_0005422
449 Ga0466963_0008659
450 Ga0466963_0041428
451 Ga0466963_0111922
452 Ga0466963_0153080
453 Ga0453684_0093873
454 Ga0466971_0004420
455 Ga0466971_0021676
456 Ga0466968_0027917
457 Ga0466957_0013862
458 Ga0466957_0086297
459 Ga0466958_0002025
460 Ga0466958_0007325
461 Ga0466958_0095428
462 Ga0466967_0020549
463 Ga0466967_0038486
464 Ga0466967_0090395
465 Ga0495603_0034677
466 Ga0495629_0030535
467 Ga0495580_0085942
468 Ga0495605_0004600
469 Ga0495584_0037823
470 Ga0495584_0042986
471 Ga0495606_0005571
472 Ga0495616_0015796
473 Ga0495618_0047537
474 Ga0495630_0030565
475 Ga0495630_0050916
476 Ga0495643_0034517
477 Ga0495648_0117133
478 Ga0495609_0023136
479 Ga0495597_0019018
480 Ga0495622_0035079
481 Ga0495667_0046471
482 Ga0495634_0055865
483 Ga0495613_0018952
484 Ga0495613_0113029
485 Ga0495624_0023619
486 Ga0495683_0037454
487 Ga0495687_025998
488 Ga0495686_0032592
489 Ga0496104_0062087
490 Ga0496104_0079600
491 Ga0496105_0032378
492 Ga0496105_0168370
493 Ga0496108_0018827
494 Ga0496109_0012049
495 Ga0496110_0022580
496 Ga0496110_0052263
497 Ga0496110_0055692
498 Ga0496111_0038468
499 Ga0496112_0056128
500 Ga0496113_0138984
501 Ga0496114_0068700
502 Ga0496116_0023761
503 Ga0496117_0000229
504 Ga0496118_0000016
505 Ga0496119_0000446
506 Ga0496125_0006382
507 Ga0496126_0037579
508 Ga0496126_0243352
509 nmdc:mga00v17_20443_c1
510 nmdc:mga0yw44_47428_c1
511 nmdc:mga05p37_145483_c1
512 nmdc:mga05p37_74069_c1
513 nmdc:mga09592_128662_c1
514 nmdc:mga0n895_113695_c1
515 nmdc:mga0rr50_101000_c1
516 nmdc:mga0a205_43014_c1
517 Ga0500600_0068730
518 2644270731
519 2819426219
520 2862289090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00082

Peptidase_S8

Subtilase family

180

542

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1st3-assembly1.cif.gz_A the crystal structure of the bacillus lentus alkaline protease, subtilisin bl, at 1.4 angstroms resolution 0.9276 104 468
1iav-assembly1.cif.gz_A structure on native (asn 87) subtilisin from bacillus lentus 0.9206 104 468
5aqe-assembly1.cif.gz_A cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase 0.9161 104 468
1c9m-assembly1.cif.gz_A bacillus lentus subtilsin (ser 87) n76d/s103a/v104i 0.9144 104 468
1ndu-assembly1.cif.gz_A bacillus lentus subtilisin variant s101g/v104n 0.9132 104 468
ID Description Score Start End Superfamily
1dbiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8804 98 467 3.40.50.200
2b6nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8788 125 423 3.40.50.200
1ah2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8786 105 468 3.40.50.200
1ah2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8602 105 468 3.40.50.200
1dbiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8585 98 467 3.40.50.200
ID Description Score Start End GO Terms
AF-A0A7V9CWD2-F1-model_v4 S8 family serine peptidase 0.9801 107 222 GO:0004252
GO:0016020
GO:0016485
AF-A0A538BFT3-F1-model_v4 Peptidase S8 0.9727 109 236 GO:0004252
GO:0016020
GO:0016485
AF-A0A536DWH8-F1-model_v4 Inhibitor I9 domain-containing protein 0.9726 10 72
AF-A0A7K2L107-F1-model_v4 S8 family serine peptidase 0.9688 166 467 GO:0004252
GO:0016020
GO:0016485
AF-A0A538CHJ2-F1-model_v4 Peptidase S8 0.9611 144 292 GO:0004252
GO:0006508

Map