F369552

General Info

Members Datasets Scaffolds Average Seq Length
260 152 520 188

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10015107|Ga0157369_100151075
Length 180
Sequence VTVCSGNPGKVDELAELFPEWQLELLHAGPFPPEDGATYVDNARIKARFGRAHGPADRWMLADDSGIEIAALGGEPGVHTARWAEGRHVEKALAAVSDDRRARYVCELVLLAPDGAEHRGTGVLEGSIAEAAAGDGGFGFDPVFIPAGKTRTVAELGDAWKAVHSHRALAATALRSTLVP

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 2.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10015107 3300013105 Bacteria 8713
2 ARcpr5yngRDRAFT_c001757 3300000043 Bacteria 2328
3 Ga0070658_10001993 3300005327 Bacteria 17160
4 Ga0070658_10471780 3300005327 Bacteria 1082
5 Ga0070658_10546761 3300005327 Bacteria 1002
6 Ga0070658_10640810 3300005327 Bacteria 922
7 Ga0070683_100039849 3300005329 Bacteria 4315
8 Ga0070683_100181209 3300005329 Bacteria 2000
9 Ga0070683_100565390 3300005329 Unclassified 1087
10 Ga0068869_100159642 3300005334 Bacteria 1754
11 Ga0070680_100010976 3300005336 Bacteria 7002
12 Ga0070680_100015119 3300005336 Bacteria 6043
13 Ga0070680_100034323 3300005336 Bacteria 4090
14 Ga0070682_100107583 3300005337 Bacteria 1852
15 Ga0070682_100440903 3300005337 Bacteria 995
16 Ga0070660_100001527 3300005339 Bacteria 15890
17 Ga0070660_100023766 3300005339 Bacteria 4542
18 Ga0070660_100078856 3300005339 Bacteria 2583
19 Ga0070660_100130086 3300005339 Bacteria 2014
20 Ga0070660_100397396 3300005339 Bacteria 1139
21 Ga0070660_100842925 3300005339 Bacteria 772
22 Ga0070661_100016499 3300005344 Bacteria 5223
23 Ga0070661_100130265 3300005344 Bacteria 1889
24 Ga0070692_10064608 3300005345 Bacteria 1936
25 Ga0070659_100014624 3300005366 Bacteria 5868
26 Ga0070659_100070016 3300005366 Bacteria 2786
27 Ga0070714_100501564 3300005435 Bacteria 1157
28 Ga0070700_100215414 3300005441 Bacteria 1357
29 Ga0070681_10001845 3300005458 Bacteria 19131
30 Ga0070681_10003441 3300005458 Bacteria 14822
31 Ga0070681_10004166 3300005458 Bacteria 13683
32 Ga0070681_10048007 3300005458 Bacteria 4267
33 Ga0070679_100003543 3300005530 Bacteria 14302
34 Ga0070679_100013139 3300005530 Bacteria 7927
35 Ga0070679_100025373 3300005530 Bacteria 5816
36 Ga0070679_100045355 3300005530 Bacteria 4380
37 Ga0070679_100070874 3300005530 Bacteria 3476
38 Ga0070679_100120178 3300005530 Bacteria 2612
39 Ga0070684_100000815 3300005535 Bacteria 21767
40 Ga0070684_100040946 3300005535 Bacteria 3991
41 Ga0070684_100198744 3300005535 Unclassified 1826
42 Ga0070684_100217001 3300005535 Bacteria 1745
43 Ga0068853_100072024 3300005539 Bacteria 3011
44 Ga0068853_100095894 3300005539 Bacteria 2616
45 Ga0068853_100211215 3300005539 Bacteria 1769
46 Ga0070672_100497694 3300005543 Bacteria 1054
47 Ga0070696_100183072 3300005546 Bacteria 1555
48 Ga0070665_100073832 3300005548 Bacteria 3416
49 Ga0070665_100258932 3300005548 Bacteria 1741
50 Ga0068855_100016333 3300005563 Bacteria 8927
51 Ga0068855_100084028 3300005563 Bacteria 3687
52 Ga0070664_100091073 3300005564 Bacteria 2640
53 Ga0068857_100160092 3300005577 Bacteria 2042
54 Ga0068857_100179648 3300005577 Bacteria 1926
55 Ga0068857_100220377 3300005577 Bacteria 1733
56 Ga0068854_100209231 3300005578 Bacteria 1538
57 Ga0068854_100425544 3300005578 Bacteria 1104
58 Ga0068856_100245409 3300005614 Bacteria 1806
59 Ga0068856_100272495 3300005614 Bacteria 1708
60 Ga0070702_100197130 3300005615 Bacteria 1330
61 Ga0068852_100058062 3300005616 Bacteria 3350
62 Ga0068852_100226288 3300005616 Bacteria 1781
63 Ga0068851_10282232 3300005834 Bacteria 950
64 Ga0075432_10000203 3300006058 Bacteria 15608
65 Ga0070712_101135605 3300006175 Bacteria 679
66 Ga0097621_101291325 3300006237 Unclassified 689
67 Ga0075428_100010299 3300006844 Bacteria 10375
68 Ga0075431_100420310 3300006847 Bacteria 1336
69 Ga0075433_10030880 3300006852 Bacteria 4575
70 Ga0075429_100009941 3300006880 Bacteria 8243
71 Ga0105240_10222637 3300009093 Bacteria 2197
72 Ga0111539_10014812 3300009094 Bacteria 9727
73 Ga0111539_10270549 3300009094 Bacteria 1978
74 Ga0114129_10021333 3300009147 Bacteria 9196
75 Ga0105243_10034402 3300009148 Bacteria 3922
76 Ga0105242_11575747 3300009176 Unclassified 690
77 Ga0105237_10097294 3300009545 Bacteria 2933
78 Ga0105238_10106211 3300009551 Bacteria 2789
79 Ga0105238_11103174 3300009551 Bacteria 816
80 Ga0157371_10169695 3300013102 Bacteria 1559
81 Ga0157370_10003987 3300013104 Bacteria 17162
82 Ga0157370_10012088 3300013104 Bacteria 8982
83 Ga0157370_10122871 3300013104 Bacteria 2424
84 Ga0157370_10300874 3300013104 Bacteria 1481
85 Ga0157369_11967061 3300013105 Unclassified 593
86 Ga0157372_10205361 3300013307 Bacteria 2283
87 Ga0157375_10024859 3300013308 Bacteria 5552
88 Ga0157377_10052858 3300014745 Bacteria 2295
89 Ga0206356_10796851 3300020070 Bacteria 1029
90 Ga0206356_10807692 3300020070 Bacteria 1790
91 Ga0206354_10363399 3300020081 Bacteria 1886
92 Ga0206353_10738964 3300020082 Bacteria 1185
93 Ga0206353_11009259 3300020082 Bacteria 4301
94 Ga0206353_11446319 3300020082 Bacteria 837
95 Ga0207656_10079332 3300025321 Bacteria 1473
96 Ga0207656_10186818 3300025321 Bacteria 997
97 Ga0207705_10026906 3300025909 Bacteria 4099
98 Ga0207707_10010931 3300025912 Bacteria 7895
99 Ga0207707_10020116 3300025912 Bacteria 5825
100 Ga0207707_10037931 3300025912 Bacteria 4210
101 Ga0207707_10499417 3300025912 Bacteria 1038
102 Ga0207695_10053635 3300025913 Bacteria 4216
103 Ga0207695_10310252 3300025913 Bacteria 1468
104 Ga0207671_10365980 3300025914 Bacteria 1145
105 Ga0207693_10170247 3300025915 Bacteria 1715
106 Ga0207693_10223953 3300025915 Bacteria 1477
107 Ga0207660_10008785 3300025917 Bacteria 6531
108 Ga0207660_10016515 3300025917 Bacteria 4887
109 Ga0207660_10240622 3300025917 Bacteria 1426
110 Ga0207657_10000433 3300025919 Bacteria 44551
111 Ga0207657_10007058 3300025919 Bacteria 11541
112 Ga0207657_10038427 3300025919 Bacteria 4261
113 Ga0207657_10089800 3300025919 Bacteria 2565
114 Ga0207657_10128134 3300025919 Bacteria 2082
115 Ga0207657_10212653 3300025919 Unclassified 1551
116 Ga0207657_10526471 3300025919 Unclassified 925
117 Ga0207652_10006889 3300025921 Bacteria 9157
118 Ga0207652_10019344 3300025921 Bacteria 5600
119 Ga0207652_10035757 3300025921 Bacteria 4195
120 Ga0207652_10083735 3300025921 Bacteria 2793
121 Ga0207694_10197174 3300025924 Bacteria 1637
122 Ga0207690_10068243 3300025932 Bacteria 2442
123 Ga0207690_10094182 3300025932 Bacteria 2124
124 Ga0207706_10003187 3300025933 Bacteria 15753
125 Ga0207686_10322874 3300025934 Bacteria 1154
126 Ga0207709_10022697 3300025935 Bacteria 3563
127 Ga0207691_10433053 3300025940 Bacteria 1120
128 Ga0207689_10319951 3300025942 Bacteria 1287
129 Ga0207661_10012205 3300025944 Bacteria 6240
130 Ga0207661_10050137 3300025944 Bacteria 3324
131 Ga0207661_10064527 3300025944 Bacteria 2969
132 Ga0207661_10762864 3300025944 Bacteria 890
133 Ga0207667_10046078 3300025949 Bacteria 4617
134 Ga0207667_10276142 3300025949 Bacteria 1717
135 Ga0207667_10628003 3300025949 Bacteria 1081
136 Ga0207640_10203529 3300025981 Bacteria 1502
137 Ga0207640_10730735 3300025981 Bacteria 852
138 Ga0207639_10367078 3300026041 Bacteria 1290
139 Ga0207678_10079511 3300026067 Bacteria 2807
140 Ga0207678_10658173 3300026067 Unclassified 920
141 Ga0207708_10117763 3300026075 Bacteria 2067
142 Ga0207702_10189760 3300026078 Bacteria 1898
143 Ga0207674_10035613 3300026116 Bacteria 5195
144 Ga0207698_10529215 3300026142 Bacteria 1152
145 Ga0207428_10000104 3300027907 Bacteria 116036
146 Ga0207428_10289533 3300027907 Bacteria 1214
147 Ga0268266_10106847 3300028379 Bacteria 2475
148 Ga0373944_0003319 3300035089 Bacteria 4144
149 Ga0373945_0003783 3300035116 Bacteria 4776
150 Ga0373943_0005386 3300035170 Bacteria 5756
151 Ga0373946_0018674 3300035171 Bacteria 2665
152 Ga0373927_0095303 3300035695 Bacteria 1934
153 Ga0373947_0012454 3300035725 Bacteria 4874
154 Ga0373925_0001868 3300037068 Bacteria 17520
155 Ga0395900_0077253 3300037418 Bacteria 3421
156 Ga0395900_0150100 3300037418 Bacteria 2381
157 Ga0395900_1282333 3300037418 Bacteria 647
158 Ga0395900_1373092 3300037418 Bacteria 620
159 Ga0395898_0115481 3300037466 Bacteria 2572
160 Ga0395898_0195602 3300037466 Bacteria 1932
161 Ga0395905_0064576 3300037471 Bacteria 3426
162 Ga0395905_0356061 3300037471 Bacteria 1356
163 Ga0395901_0042300 3300038443 Bacteria 4723
164 Ga0395901_0162059 3300038443 Bacteria 2349
165 Ga0395901_0583776 3300038443 Bacteria 1129
166 Ga0436365_0723683 3300039437 Bacteria 3526
167 Ga0466966_0053318 3300044684 Bacteria 2566
168 Ga0466961_0021306 3300044693 Bacteria 4172
169 Ga0466963_0001406 3300044694 Bacteria 12923
170 Ga0466963_0003471 3300044694 Bacteria 9040
171 Ga0466963_0004079 3300044694 Bacteria 8450
172 Ga0466963_0029303 3300044694 Bacteria 3542
173 Ga0466963_0050775 3300044694 Bacteria 2746
174 Ga0466963_0132055 3300044694 Bacteria 1726
175 Ga0466964_0066763 3300044706 Bacteria 1510
176 Ga0466971_0000385 3300044719 Bacteria 16997
177 Ga0466971_0404103 3300044719 Bacteria 666
178 Ga0466957_0000164 3300044842 Bacteria 29396
179 Ga0466959_0017043 3300045049 Bacteria 5318
180 Ga0466959_0128663 3300045049 Bacteria 1796
181 Ga0466958_0000218 3300045836 Bacteria 21642
182 Ga0466958_0016660 3300045836 Bacteria 4236
183 Ga0466967_0000911 3300045976 Bacteria 15866
184 Ga0466967_0008663 3300045976 Bacteria 7481
185 Ga0466967_0009015 3300045976 Bacteria 7374
186 Ga0466967_0016228 3300045976 Bacteria 5864
187 Ga0466967_0018643 3300045976 Bacteria 5554
188 Ga0466967_0019021 3300045976 Bacteria 5512
189 Ga0466967_0039862 3300045976 Bacteria 4041
190 Ga0466967_0057552 3300045976 Bacteria 3432
191 Ga0466967_0072291 3300045976 Bacteria 3091
192 Ga0466967_0093246 3300045976 Bacteria 2739
193 Ga0466967_0156287 3300045976 Bacteria 2137
194 Ga0466967_0165342 3300045976 Bacteria 2079
195 Ga0466967_0253429 3300045976 Bacteria 1682
196 Ga0466967_0516343 3300045976 Bacteria 1174
197 Ga0495592_0102941 3300046454 Bacteria 2032
198 Ga0495603_0001762 3300046455 Bacteria 12748
199 Ga0495603_0177422 3300046455 Bacteria 1233
200 Ga0495603_0352510 3300046455 Unclassified 844
201 Ga0495629_0078821 3300046459 Bacteria 2299
202 Ga0495641_0001534 3300046461 Bacteria 19606
203 Ga0495651_0018108 3300046462 Bacteria 5454
204 Ga0495653_0083000 3300046463 Bacteria 2364
205 Ga0495582_0000391 3300046473 Bacteria 23825
206 Ga0495639_0000300 3300046475 Bacteria 24087
207 Ga0495662_0002922 3300046476 Bacteria 8634
208 Ga0495664_0301388 3300046477 Unclassified 967
209 Ga0495607_0294417 3300046501 Bacteria 766
210 Ga0495608_0109639 3300046511 Bacteria 1775
211 Ga0495618_0155895 3300046514 Bacteria 1457
212 Ga0495628_0615426 3300046516 Unclassified 774
213 Ga0495630_0016630 3300046517 Bacteria 5379
214 Ga0495652_0353781 3300046529 Unclassified 1051
215 Ga0495640_0268460 3300046533 Unclassified 1064
216 Ga0495645_0114242 3300046543 Bacteria 1908
217 Ga0495667_0036052 3300046559 Bacteria 3304
218 Ga0495634_0090220 3300046642 Bacteria 1991
219 Ga0495635_0084327 3300046663 Bacteria 2174
220 Ga0495646_0171875 3300046680 Bacteria 1194
221 Ga0495658_0000043 3300046683 Bacteria 62762
222 Ga0495624_0013568 3300046690 Bacteria 5554
223 Ga0495589_0067058 3300046794 Bacteria 1757
224 Ga0495600_0031371 3300046809 Unclassified 3442
225 Ga0495581_0007634 3300047315 Bacteria 6257
226 Ga0495604_0053474 3300047317 Unclassified 3120
227 Ga0495674_0016527 3300047319 Bacteria 6886
228 Ga0495676_0004468 3300047321 Bacteria 12780
229 Ga0495680_0005179 3300047322 Bacteria 12301
230 Ga0495593_0029268 3300047673 Bacteria 3021
231 Ga0495602_0073480 3300048088 Bacteria 2911
232 Ga0495602_0547021 3300048088 Unclassified 803
233 Ga0495614_0018155 3300048089 Bacteria 3048
234 Ga0496100_0095539 3300048903 Bacteria 2038
235 Ga0496101_0009104 3300048904 Bacteria 6514
236 Ga0496102_0829425 3300048905 Bacteria 847
237 Ga0496104_0098115 3300048907 Bacteria 2805
238 Ga0496104_0297165 3300048907 Unclassified 1527
239 Ga0496105_0221594 3300048908 Unclassified 1540
240 Ga0496111_0224786 3300048914 Unclassified 1394
241 Ga0496114_0038883 3300048917 Bacteria 3937
242 Ga0496114_0043615 3300048917 Bacteria 3719
243 Ga0496115_0097096 3300048918 Unclassified 2413
244 Ga0501067_0000899 3300049583 Bacteria 15969
245 Ga0501068_0280453 3300049584 Bacteria 1065
246 Ga0501069_0002903 3300049585 Bacteria 8803
247 Ga0501069_0446151 3300049585 Bacteria 769
248 nmdc:mga05p37_179621_c1 3300050507 Bacteria 2576
249 nmdc:mga05p37_491127_c1 3300050507 Bacteria 1411
250 nmdc:mga09592_14123_c1 3300050508 Bacteria 6517
251 nmdc:mga06r32_401471_c1 3300050510 Bacteria 1353
252 nmdc:mga08y16_367118_c1 3300050511 Bacteria 1477
253 nmdc:mga08y16_67106_c1 3300050511 Bacteria 3743
254 nmdc:mga0a205_36235_c1 3300050515 Bacteria 4739
255 Ga0495595_0005937 3300053084 Bacteria 4953
256 Ga0495595_0087914 3300053084 Bacteria 1488
257 Ga0495619_0010554 3300053085 Bacteria 5812
258 Ga0495619_0035623 3300053085 Bacteria 3237
259 Ga0466962_0021539 3300061719 Bacteria 3095
260 Ga0530510_0052325 3300061734 Bacteria 2951
261 Ga0157369_10015107
262 ARcpr5yngRDRAFT_c001757
263 Ga0070658_10001993
264 Ga0070658_10471780
265 Ga0070658_10546761
266 Ga0070658_10640810
267 Ga0070683_100039849
268 Ga0070683_100181209
269 Ga0070683_100565390
270 Ga0068869_100159642
271 Ga0070680_100010976
272 Ga0070680_100015119
273 Ga0070680_100034323
274 Ga0070682_100107583
275 Ga0070682_100440903
276 Ga0070660_100001527
277 Ga0070660_100023766
278 Ga0070660_100078856
279 Ga0070660_100130086
280 Ga0070660_100397396
281 Ga0070660_100842925
282 Ga0070661_100016499
283 Ga0070661_100130265
284 Ga0070692_10064608
285 Ga0070659_100014624
286 Ga0070659_100070016
287 Ga0070714_100501564
288 Ga0070700_100215414
289 Ga0070681_10001845
290 Ga0070681_10003441
291 Ga0070681_10004166
292 Ga0070681_10048007
293 Ga0070679_100003543
294 Ga0070679_100013139
295 Ga0070679_100025373
296 Ga0070679_100045355
297 Ga0070679_100070874
298 Ga0070679_100120178
299 Ga0070684_100000815
300 Ga0070684_100040946
301 Ga0070684_100198744
302 Ga0070684_100217001
303 Ga0068853_100072024
304 Ga0068853_100095894
305 Ga0068853_100211215
306 Ga0070672_100497694
307 Ga0070696_100183072
308 Ga0070665_100073832
309 Ga0070665_100258932
310 Ga0068855_100016333
311 Ga0068855_100084028
312 Ga0070664_100091073
313 Ga0068857_100160092
314 Ga0068857_100179648
315 Ga0068857_100220377
316 Ga0068854_100209231
317 Ga0068854_100425544
318 Ga0068856_100245409
319 Ga0068856_100272495
320 Ga0070702_100197130
321 Ga0068852_100058062
322 Ga0068852_100226288
323 Ga0068851_10282232
324 Ga0075432_10000203
325 Ga0070712_101135605
326 Ga0097621_101291325
327 Ga0075428_100010299
328 Ga0075431_100420310
329 Ga0075433_10030880
330 Ga0075429_100009941
331 Ga0105240_10222637
332 Ga0111539_10014812
333 Ga0111539_10270549
334 Ga0114129_10021333
335 Ga0105243_10034402
336 Ga0105242_11575747
337 Ga0105237_10097294
338 Ga0105238_10106211
339 Ga0105238_11103174
340 Ga0157371_10169695
341 Ga0157370_10003987
342 Ga0157370_10012088
343 Ga0157370_10122871
344 Ga0157370_10300874
345 Ga0157369_11967061
346 Ga0157372_10205361
347 Ga0157375_10024859
348 Ga0157377_10052858
349 Ga0206356_10796851
350 Ga0206356_10807692
351 Ga0206354_10363399
352 Ga0206353_10738964
353 Ga0206353_11009259
354 Ga0206353_11446319
355 Ga0207656_10079332
356 Ga0207656_10186818
357 Ga0207705_10026906
358 Ga0207707_10010931
359 Ga0207707_10020116
360 Ga0207707_10037931
361 Ga0207707_10499417
362 Ga0207695_10053635
363 Ga0207695_10310252
364 Ga0207671_10365980
365 Ga0207693_10170247
366 Ga0207693_10223953
367 Ga0207660_10008785
368 Ga0207660_10016515
369 Ga0207660_10240622
370 Ga0207657_10000433
371 Ga0207657_10007058
372 Ga0207657_10038427
373 Ga0207657_10089800
374 Ga0207657_10128134
375 Ga0207657_10212653
376 Ga0207657_10526471
377 Ga0207652_10006889
378 Ga0207652_10019344
379 Ga0207652_10035757
380 Ga0207652_10083735
381 Ga0207694_10197174
382 Ga0207690_10068243
383 Ga0207690_10094182
384 Ga0207706_10003187
385 Ga0207686_10322874
386 Ga0207709_10022697
387 Ga0207691_10433053
388 Ga0207689_10319951
389 Ga0207661_10012205
390 Ga0207661_10050137
391 Ga0207661_10064527
392 Ga0207661_10762864
393 Ga0207667_10046078
394 Ga0207667_10276142
395 Ga0207667_10628003
396 Ga0207640_10203529
397 Ga0207640_10730735
398 Ga0207639_10367078
399 Ga0207678_10079511
400 Ga0207678_10658173
401 Ga0207708_10117763
402 Ga0207702_10189760
403 Ga0207674_10035613
404 Ga0207698_10529215
405 Ga0207428_10000104
406 Ga0207428_10289533
407 Ga0268266_10106847
408 Ga0373944_0003319
409 Ga0373945_0003783
410 Ga0373943_0005386
411 Ga0373946_0018674
412 Ga0373927_0095303
413 Ga0373947_0012454
414 Ga0373925_0001868
415 Ga0395900_0077253
416 Ga0395900_0150100
417 Ga0395900_1282333
418 Ga0395900_1373092
419 Ga0395898_0115481
420 Ga0395898_0195602
421 Ga0395905_0064576
422 Ga0395905_0356061
423 Ga0395901_0042300
424 Ga0395901_0162059
425 Ga0395901_0583776
426 Ga0436365_0723683
427 Ga0466966_0053318
428 Ga0466961_0021306
429 Ga0466963_0001406
430 Ga0466963_0003471
431 Ga0466963_0004079
432 Ga0466963_0029303
433 Ga0466963_0050775
434 Ga0466963_0132055
435 Ga0466964_0066763
436 Ga0466971_0000385
437 Ga0466971_0404103
438 Ga0466957_0000164
439 Ga0466959_0017043
440 Ga0466959_0128663
441 Ga0466958_0000218
442 Ga0466958_0016660
443 Ga0466967_0000911
444 Ga0466967_0008663
445 Ga0466967_0009015
446 Ga0466967_0016228
447 Ga0466967_0018643
448 Ga0466967_0019021
449 Ga0466967_0039862
450 Ga0466967_0057552
451 Ga0466967_0072291
452 Ga0466967_0093246
453 Ga0466967_0156287
454 Ga0466967_0165342
455 Ga0466967_0253429
456 Ga0466967_0516343
457 Ga0495592_0102941
458 Ga0495603_0001762
459 Ga0495603_0177422
460 Ga0495603_0352510
461 Ga0495629_0078821
462 Ga0495641_0001534
463 Ga0495651_0018108
464 Ga0495653_0083000
465 Ga0495582_0000391
466 Ga0495639_0000300
467 Ga0495662_0002922
468 Ga0495664_0301388
469 Ga0495607_0294417
470 Ga0495608_0109639
471 Ga0495618_0155895
472 Ga0495628_0615426
473 Ga0495630_0016630
474 Ga0495652_0353781
475 Ga0495640_0268460
476 Ga0495645_0114242
477 Ga0495667_0036052
478 Ga0495634_0090220
479 Ga0495635_0084327
480 Ga0495646_0171875
481 Ga0495658_0000043
482 Ga0495624_0013568
483 Ga0495589_0067058
484 Ga0495600_0031371
485 Ga0495581_0007634
486 Ga0495604_0053474
487 Ga0495674_0016527
488 Ga0495676_0004468
489 Ga0495680_0005179
490 Ga0495593_0029268
491 Ga0495602_0073480
492 Ga0495602_0547021
493 Ga0495614_0018155
494 Ga0496100_0095539
495 Ga0496101_0009104
496 Ga0496102_0829425
497 Ga0496104_0098115
498 Ga0496104_0297165
499 Ga0496105_0221594
500 Ga0496111_0224786
501 Ga0496114_0038883
502 Ga0496114_0043615
503 Ga0496115_0097096
504 Ga0501067_0000899
505 Ga0501068_0280453
506 Ga0501069_0002903
507 Ga0501069_0446151
508 nmdc:mga05p37_179621_c1
509 nmdc:mga05p37_491127_c1
510 nmdc:mga09592_14123_c1
511 nmdc:mga06r32_401471_c1
512 nmdc:mga08y16_367118_c1
513 nmdc:mga08y16_67106_c1
514 nmdc:mga0a205_36235_c1
515 Ga0495595_0005937
516 Ga0495595_0087914
517 Ga0495619_0010554
518 Ga0495619_0035623
519 Ga0466962_0021539
520 Ga0530510_0052325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

1

177

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.8952 3 189
2dvn-assembly1.cif.gz_A structure of ph1917 protein with the complex of imp from pyrococcus horikoshii 0.8878 5 187
2e5x-assembly1.cif.gz_A-2 structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 0.8837 5 187
2qdd-assembly1.cif.gz_A crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism 0.8822 109 131
2j4e-assembly1.cif.gz_A the itp complex of human inosine triphosphatase 0.8716 4 184
ID Description Score Start End Superfamily
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8952 3 189 3.90.950.10
2ztiA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8943 5 187 3.90.950.10
af_Q4DRX4_9_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8921 3 185 3.90.950.10
af_Q9UU89_2_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8848 1 187 3.90.950.10
af_P47119_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8818 5 187 3.90.950.10
ID Description Score Start End GO Terms
AF-R6I9R5-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.979 97 188 GO:0005829
GO:0009143
GO:0047429
AF-A0A538HX84-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9539 5 187 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7W0PG27-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9513 5 188 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A537TWG4-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9439 3 187 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7W0N033-F1-model_v4 CdiI immunity protein domain-containing protein 0.9399 2 180 GO:0005829
GO:0009143
GO:0047429

Map